F477361

General Info

Members Datasets Scaffolds Average Seq Length
721 282 1442 283

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10143472|Ga0105239_101434722
Length 316
Sequence LSYRNIAVRSIDPHAICINPIQNYKLTGVNMSRRTLGRTLKLCTIAALVSSAAAHAADWSDTSLSWRYGNSFREPFNTEDISKHILAFTHADGYKYGTNFFNIDFLMSDSKDPGSLTQSGGAQEAYIVYRNTFDIGKIQGKDVKFGAVRGVGITVGFDVNTKNDVGYNSRKRMIVAGPTLMWDVPGFLNTSLLILEESNAPSGAFPPISGVTGRYHYKTHPMLTAAWGIPVGANLSFEGYANFIASKGKDEVGGDTAAETNIDMELMFDVGAATGGAKNTFKVGLEYQYWKNKFGNPSSVPGSKASTPMIRAEYHF

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
14 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
15 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
72 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
76 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
87 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
135 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
142 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
154 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
155 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
156 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
157 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
161 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
165 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
177 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
178 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
183 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
188 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
196 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
214 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
217 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
225 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
228 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
229 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
232 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
258 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
262 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
265 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
266 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
267 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
268 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
269 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
270 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
271 2643221664 Massilia sp. Root418 Isolate Unclassified
272 2738543018 Massilia sp. GV045 Isolate Unclassified
273 2738543030 Massilia sp. GV097 Isolate Unclassified
274 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
275 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
276 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
277 2842711865 Duganella sp. R-73148 Isolate Unclassified
278 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
279 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
280 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
281 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
282 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.21
Nodule 0
Rhizoplane 2.91
Rhizosphere 83.63
Stem 0
Stem Tuber 0
Unclassified 1.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10143472 3300010375 Bacteria 2662
2 JGI25155J39150_1000449 3300002704 Bacteria 10563
3 JGI25156J39149_1000447 3300002705 Bacteria 25213
4 JGI25156J39149_1001687 3300002705 Bacteria 8897
5 JGI25154J39366_1000400 3300002738 Bacteria 23688
6 JGI25154J39366_1002034 3300002738 Bacteria 5815
7 JGI25154J39366_1002063 3300002738 Bacteria 5711
8 JGI25157J39369_1000267 3300002741 Bacteria 38232
9 JGI25164J39214_1003139 3300002772 Bacteria 2195
10 rootH1_10027638 3300003316 Bacteria 5133
11 rootL2_10141155 3300003322 Bacteria 10739
12 rootH1_10000796 3300003323 Bacteria 3970
13 rootH1_10028606 3300003323 Bacteria 2654
14 rootH1_10281587 3300003323 Bacteria 1351
15 Ga0055539_1000197 3300003752 Bacteria 49212
16 Ga0055533_1000040 3300003756 Bacteria 242927
17 Ga0055525_1000038 3300003759 Bacteria 297540
18 Ga0055525_1001871 3300003759 Bacteria 2786
19 Ga0055529_1000032 3300003763 Bacteria 255895
20 Ga0055526_1000001 3300003771 Bacteria 669703
21 Ga0055526_1000951 3300003771 Bacteria 21419
22 Ga0055537_1000030 3300003773 Bacteria 100491
23 Ga0055524_1012479 3300003775 Bacteria 3259
24 Ga0055534_1000203 3300003784 Bacteria 43799
25 Ga0055528_1000439 3300003790 Bacteria 33348
26 Ga0065165_1004849 3300005262 Bacteria 7996
27 Ga0065715_10136858 3300005293 Bacteria 1915
28 Ga0070658_10227554 3300005327 Bacteria 1578
29 Ga0070690_100003934 3300005330 Bacteria 8200
30 Ga0070690_100012655 3300005330 Bacteria 4967
31 Ga0068869_100002249 3300005334 Bacteria 11627
32 Ga0070666_10024809 3300005335 Unclassified 3908
33 Ga0068868_100040353 3300005338 Unclassified 3633
34 Ga0070689_100418602 3300005340 Bacteria 1135
35 Ga0070687_100009783 3300005343 Bacteria 4119
36 Ga0070668_100001840 3300005347 Bacteria 15451
37 Ga0070669_100005015 3300005353 Bacteria 9567
38 Ga0070675_100011382 3300005354 Bacteria 6963
39 Ga0070674_100001933 3300005356 Bacteria 11306
40 Ga0070659_100070640 3300005366 Bacteria 2774
41 Ga0070667_100011858 3300005367 Bacteria 7208
42 Ga0070667_100464792 3300005367 Bacteria 1157
43 Ga0070700_100017319 3300005441 Bacteria 4117
44 Ga0070662_100010014 3300005457 Bacteria 6208
45 Ga0068867_100004249 3300005459 Bacteria 10078
46 Ga0070684_100343569 3300005535 Bacteria 1372
47 Ga0068853_100120915 3300005539 Bacteria 2336
48 Ga0068853_100226687 3300005539 Unclassified 1708
49 Ga0070672_100012264 3300005543 Bacteria 6008
50 Ga0068855_100012110 3300005563 Bacteria 10421
51 Ga0068857_100019689 3300005577 Bacteria 5928
52 Ga0068856_100001658 3300005614 Bacteria 23333
53 Ga0068852_100016167 3300005616 Bacteria 5810
54 Ga0068852_100053382 3300005616 Bacteria 3479
55 Ga0068852_100551788 3300005616 Bacteria 1153
56 Ga0068859_100033169 3300005617 Bacteria 5186
57 Ga0068864_100014855 3300005618 Bacteria 6469
58 Ga0068866_10002463 3300005718 Bacteria 7635
59 Ga0068861_100009071 3300005719 Bacteria 6856
60 Ga0068861_100022899 3300005719 Bacteria 4504
61 Ga0068863_100006509 3300005841 Bacteria 11458
62 Ga0068858_100059421 3300005842 Unclassified 3533
63 Ga0068860_100037393 3300005843 Bacteria 4647
64 Ga0068860_100286754 3300005843 Bacteria 1610
65 Ga0068860_100746281 3300005843 Bacteria 990
66 Ga0075363_100112634 3300006048 Bacteria 1513
67 Ga0075366_10013595 3300006195 Bacteria 4638
68 Ga0075366_10043139 3300006195 Bacteria 2671
69 Ga0075366_10043223 3300006195 Bacteria 2669
70 Ga0075370_10025252 3300006353 Bacteria 3285
71 Ga0068865_100003333 3300006881 Bacteria 9616
72 Ga0097620_100033170 3300006931 Bacteria 5186
73 Ga0099795_10080417 3300007788 Bacteria 1246
74 Ga0105240_10018053 3300009093 Bacteria 9488
75 Ga0105240_10069749 3300009093 Bacteria 4350
76 Ga0105245_10069680 3300009098 Unclassified 3189
77 Ga0105243_10005749 3300009148 Bacteria 9632
78 Ga0105242_10067100 3300009176 Bacteria 2965
79 Ga0105242_10068765 3300009176 Bacteria 2931
80 Ga0105238_10281555 3300009551 Bacteria 1644
81 Ga0105249_10003818 3300009553 Bacteria 13005
82 Ga0105239_10045708 3300010375 Bacteria 4799
83 Ga0105239_10128780 3300010375 Bacteria 2814
84 Ga0157369_10120704 3300013105 Bacteria 2781
85 Ga0157378_10040424 3300013297 Bacteria 4135
86 Ga0157378_10184633 3300013297 Bacteria 1963
87 Ga0163162_10015948 3300013306 Bacteria 7342
88 Ga0157375_10056412 3300013308 Unclassified 3878
89 Ga0157375_10252616 3300013308 Bacteria 1924
90 Ga0157380_10011647 3300014326 Bacteria 6357
91 Ga0182008_10000303 3300014497 Bacteria 38737
92 Ga0157379_10004848 3300014968 Bacteria 11551
93 Ga0157379_10022057 3300014968 Bacteria 5643
94 Ga0182006_1000004 3300015261 Bacteria 622190
95 Ga0182007_10000018 3300015262 Bacteria 198916
96 Ga0182005_1000011 3300015265 Bacteria 420605
97 Ga0163161_10004156 3300017792 Bacteria 10123
98 Ga0163161_10016812 3300017792 Bacteria 5115
99 Ga0213872_10005914 3300021361 Bacteria 6207
100 Ga0213872_10013618 3300021361 Bacteria 3808
101 Ga0209435_100112 3300025206 Bacteria 31239
102 Ga0209784_100021 3300025224 Bacteria 408534
103 Ga0209566_100039 3300025225 Bacteria 303368
104 Ga0209674_100036 3300025226 Bacteria 408534
105 Ga0209674_100066 3300025226 Bacteria 256739
106 Ga0209563_100005 3300025230 Bacteria 1774893
107 Ga0209563_100040 3300025230 Bacteria 408534
108 Ga0209563_100129 3300025230 Bacteria 99977
109 Ga0207427_100314 3300025231 Bacteria 33014
110 Ga0209437_101493 3300025233 Bacteria 5588
111 Ga0209258_100419 3300025242 Bacteria 50513
112 Ga0209646_1000020 3300025246 Bacteria 462204
113 Ga0209646_1000054 3300025246 Bacteria 279447
114 Ga0209646_1000076 3300025246 Bacteria 212891
115 Ga0209026_1000011 3300025250 Bacteria 507291
116 Ga0209677_100023 3300025253 Bacteria 408534
117 Ga0209677_100157 3300025253 Bacteria 62213
118 Ga0209677_100160 3300025253 Bacteria 60301
119 Ga0209759_1000034 3300025256 Bacteria 271209
120 Ga0209759_1000073 3300025256 Bacteria 178048
121 Ga0209759_1000352 3300025256 Bacteria 59801
122 Ga0209759_1014509 3300025256 Bacteria 2079
123 Ga0209565_1000017 3300025263 Bacteria 462438
124 Ga0209455_1000043 3300025272 Bacteria 413928
125 Ga0209673_1000007 3300025273 Bacteria 634477
126 Ga0209675_1000009 3300025291 Bacteria 562872
127 Ga0209564_1000002 3300025295 Bacteria 1636803
128 Ga0209564_1000055 3300025295 Bacteria 343782
129 Ga0209256_1000559 3300025299 Bacteria 53325
130 Ga0209051_1004150 3300025303 Bacteria 9056
131 Ga0207642_10002016 3300025899 Bacteria 6264
132 Ga0207680_10008600 3300025903 Bacteria 5021
133 Ga0207645_10000262 3300025907 Bacteria 43561
134 Ga0207705_10277109 3300025909 Bacteria 1283
135 Ga0207654_10021849 3300025911 Bacteria 3408
136 Ga0207695_10009345 3300025913 Bacteria 12125
137 Ga0207695_10022459 3300025913 Bacteria 7159
138 Ga0207671_10032860 3300025914 Bacteria 3861
139 Ga0207662_10002649 3300025918 Bacteria 9029
140 Ga0207657_10028964 3300025919 Bacteria 5045
141 Ga0207657_10099837 3300025919 Bacteria 2410
142 Ga0207681_10007608 3300025923 Bacteria 6639
143 Ga0207694_10040610 3300025924 Bacteria 3583
144 Ga0207687_10154904 3300025927 Unclassified 1752
145 Ga0207690_10285974 3300025932 Bacteria 1285
146 Ga0207690_10541175 3300025932 Bacteria 946
147 Ga0207706_10002487 3300025933 Bacteria 17961
148 Ga0207686_10083547 3300025934 Bacteria 2090
149 Ga0207709_10009363 3300025935 Bacteria 5389
150 Ga0207669_10006468 3300025937 Bacteria 5357
151 Ga0207704_10005165 3300025938 Bacteria 6012
152 Ga0207691_10004507 3300025940 Bacteria 13486
153 Ga0207689_10001349 3300025942 Bacteria 23560
154 Ga0207689_10314573 3300025942 Bacteria 1299
155 Ga0207667_10012991 3300025949 Bacteria 9559
156 Ga0207651_10024234 3300025960 Unclassified 3749
157 Ga0207712_10023893 3300025961 Bacteria 4041
158 Ga0207668_10005376 3300025972 Bacteria 7536
159 Ga0207640_10015038 3300025981 Bacteria 4471
160 Ga0207658_10002923 3300025986 Bacteria 12231
161 Ga0207677_10025514 3300026023 Bacteria 3689
162 Ga0207703_10031541 3300026035 Bacteria 4191
163 Ga0207639_10096759 3300026041 Bacteria 2376
164 Ga0207708_10010773 3300026075 Bacteria 6795
165 Ga0207702_10002567 3300026078 Bacteria 17081
166 Ga0207641_10003275 3300026088 Bacteria 14413
167 Ga0207648_10003878 3300026089 Bacteria 15609
168 Ga0207648_10343067 3300026089 Bacteria 1345
169 Ga0207676_10038326 3300026095 Bacteria 3657
170 Ga0207674_10007284 3300026116 Bacteria 12896
171 Ga0207675_100011808 3300026118 Bacteria 8164
172 Ga0207675_100021794 3300026118 Bacteria 5964
173 Ga0207683_10055825 3300026121 Unclassified 3464
174 Ga0207683_10154393 3300026121 Bacteria 2073
175 Ga0207698_10009829 3300026142 Bacteria 6113
176 Ga0207698_10032690 3300026142 Bacteria 3772
177 Ga0207698_10434803 3300026142 Bacteria 1263
178 Ga0268264_10054528 3300028381 Unclassified 3338
179 Ga0307515_10205931 3300028794 Bacteria 1827
180 Ga0307511_10000574 3300030521 Bacteria 39348
181 Ga0316182_1375358 3300030745 Bacteria 2514
182 Ga0265331_10003107 3300031250 Bacteria 10866
183 Ga0265327_10000083 3300031251 Bacteria 204923
184 Ga0307513_10006896 3300031456 Bacteria 14785
185 Ga0307412_10516676 3300031911 Bacteria 997
186 Ga0307414_10054142 3300032004 Bacteria 2802
187 Ga0307507_10180068 3300033179 Bacteria 1513
188 Ga0373934_0050556 3300035086 Bacteria 1647
189 Ga0373939_0000097 3300035114 Bacteria 27307
190 Ga0373931_0000147 3300035691 Bacteria 30931
191 Ga0373931_0060823 3300035691 Bacteria 2035
192 Ga0395899_0060977 3300037312 Bacteria 2778
193 Ga0395900_0055755 3300037418 Bacteria 4069
194 Ga0395898_0044271 3300037466 Bacteria 4383
195 Ga0395905_0026780 3300037471 Bacteria 5437
196 Ga0395905_0222610 3300037471 Bacteria 1766
197 Ga0395905_0314674 3300037471 Bacteria 1454
198 Ga0395901_0002036 3300038443 Bacteria 20762
199 Ga0436360_0997915 3300039438 Bacteria 1444
200 Ga0436361_0420166 3300039447 Bacteria 2774
201 Ga0436361_0534903 3300039447 Bacteria 8061
202 Ga0436361_0695712 3300039447 Bacteria 3931
203 Ga0451577_0015275 3300042876 Bacteria 7145
204 Ga0451577_0124285 3300042876 Bacteria 2312
205 Ga0466972_0026272 3300044658 Bacteria 2885
206 Ga0466972_0053888 3300044658 Bacteria 1936
207 Ga0466965_0041380 3300044683 Bacteria 2270
208 Ga0466965_0042023 3300044683 Bacteria 2253
209 Ga0466964_0008294 3300044706 Bacteria 3898
210 Ga0466964_0041507 3300044706 Bacteria 1861
211 Ga0453684_0113609 3300044712 Bacteria 3285
212 Ga0466968_0002881 3300044735 Bacteria 6360
213 Ga0466968_0007155 3300044735 Bacteria 4239
214 Ga0451576_0269599 3300045051 Bacteria 1780
215 Ga0466967_0083388 3300045976 Bacteria 2890
216 Ga0495617_000087 3300046452 Bacteria 67401
217 Ga0495617_000290 3300046452 Bacteria 28770
218 Ga0495627_000463 3300046453 Bacteria 35122
219 Ga0495627_022867 3300046453 Bacteria 2053
220 Ga0495603_0025372 3300046455 Bacteria 3584
221 Ga0495603_0069133 3300046455 Bacteria 2078
222 Ga0495603_0137007 3300046455 Bacteria 1424
223 Ga0495590_0000034 3300046457 Bacteria 129910
224 Ga0495590_0000069 3300046457 Bacteria 73784
225 Ga0495590_0005517 3300046457 Bacteria 5010
226 Ga0495590_0013494 3300046457 Bacteria 3001
227 Ga0495591_000370 3300046458 Bacteria 38562
228 Ga0495591_011655 3300046458 Bacteria 3313
229 Ga0495629_0002150 3300046459 Bacteria 15267
230 Ga0495629_0035370 3300046459 Bacteria 3530
231 Ga0495629_0040206 3300046459 Bacteria 3289
232 Ga0495638_0000072 3300046460 Bacteria 164926
233 Ga0495638_0004326 3300046460 Bacteria 10769
234 Ga0495638_0031645 3300046460 Bacteria 3398
235 Ga0495638_0097807 3300046460 Bacteria 1759
236 Ga0495638_0201746 3300046460 Bacteria 1122
237 Ga0495638_0203808 3300046460 Bacteria 1115
238 Ga0495653_0031373 3300046463 Bacteria 4223
239 Ga0495650_0005074 3300046471 Bacteria 8712
240 Ga0495650_0009804 3300046471 Bacteria 5413
241 Ga0495582_0036959 3300046473 Bacteria 2686
242 Ga0495605_0000238 3300046474 Bacteria 66355
243 Ga0495605_0004352 3300046474 Bacteria 8327
244 Ga0495605_0007732 3300046474 Bacteria 6093
245 Ga0495605_0008039 3300046474 Bacteria 5972
246 Ga0495605_0018205 3300046474 Bacteria 3770
247 Ga0495605_0023450 3300046474 Bacteria 3244
248 Ga0495605_0032973 3300046474 Bacteria 2633
249 Ga0495605_0079681 3300046474 Bacteria 1533
250 Ga0495584_0000165 3300046491 Bacteria 46858
251 Ga0495584_0000573 3300046491 Bacteria 24792
252 Ga0495584_0001012 3300046491 Bacteria 17554
253 Ga0495584_0003264 3300046491 Bacteria 8989
254 Ga0495584_0011854 3300046491 Bacteria 4458
255 Ga0495584_0012480 3300046491 Bacteria 4337
256 Ga0495584_0035410 3300046491 Bacteria 2523
257 Ga0495584_0052214 3300046491 Bacteria 2057
258 Ga0495584_0065504 3300046491 Bacteria 1827
259 Ga0495585_0000114 3300046492 Bacteria 86587
260 Ga0495585_0000249 3300046492 Bacteria 55924
261 Ga0495585_0001056 3300046492 Bacteria 22787
262 Ga0495585_0001261 3300046492 Bacteria 20317
263 Ga0495585_0007090 3300046492 Bacteria 6885
264 Ga0495585_0008225 3300046492 Bacteria 6331
265 Ga0495585_0010267 3300046492 Bacteria 5583
266 Ga0495585_0012029 3300046492 Bacteria 5107
267 Ga0495585_0012749 3300046492 Bacteria 4946
268 Ga0495585_0016207 3300046492 Bacteria 4318
269 Ga0495585_0018643 3300046492 Bacteria 4002
270 Ga0495585_0025681 3300046492 Bacteria 3370
271 Ga0495585_0028872 3300046492 Bacteria 3161
272 Ga0495585_0030953 3300046492 Bacteria 3041
273 Ga0495585_0031175 3300046492 Bacteria 3028
274 Ga0495585_0052330 3300046492 Bacteria 2260
275 Ga0495585_0116020 3300046492 Bacteria 1420
276 Ga0495585_0211257 3300046492 Bacteria 983
277 Ga0495594_0000661 3300046499 Bacteria 17833
278 Ga0495594_0009492 3300046499 Bacteria 5028
279 Ga0495594_0011150 3300046499 Bacteria 4666
280 Ga0495594_0138748 3300046499 Bacteria 1378
281 Ga0495596_0000286 3300046500 Bacteria 33687
282 Ga0495596_0001162 3300046500 Bacteria 15439
283 Ga0495596_0002482 3300046500 Bacteria 9894
284 Ga0495596_0004823 3300046500 Bacteria 6484
285 Ga0495596_0009669 3300046500 Bacteria 4236
286 Ga0495596_0010660 3300046500 Bacteria 3993
287 Ga0495596_0019401 3300046500 Bacteria 2793
288 Ga0495596_0024009 3300046500 Bacteria 2472
289 Ga0495596_0025834 3300046500 Bacteria 2371
290 Ga0495607_0009178 3300046501 Bacteria 6721
291 Ga0495607_0010087 3300046501 Bacteria 6360
292 Ga0495607_0011159 3300046501 Bacteria 6000
293 Ga0495607_0015607 3300046501 Bacteria 4920
294 Ga0495607_0024614 3300046501 Bacteria 3750
295 Ga0495607_0032554 3300046501 Bacteria 3181
296 Ga0495607_0038547 3300046501 Bacteria 2862
297 Ga0495607_0058959 3300046501 Bacteria 2191
298 Ga0495607_0071431 3300046501 Bacteria 1935
299 Ga0495607_0073431 3300046501 Bacteria 1901
300 Ga0495583_0000148 3300046506 Bacteria 118749
301 Ga0495583_0000272 3300046506 Bacteria 84886
302 Ga0495583_0000336 3300046506 Bacteria 74005
303 Ga0495583_0000340 3300046506 Bacteria 73583
304 Ga0495583_0000374 3300046506 Bacteria 69535
305 Ga0495583_0000873 3300046506 Bacteria 36542
306 Ga0495583_0001741 3300046506 Bacteria 20775
307 Ga0495583_0006709 3300046506 Bacteria 7457
308 Ga0495583_0008300 3300046506 Bacteria 6368
309 Ga0495583_0024307 3300046506 Bacteria 3047
310 Ga0495583_0025925 3300046506 Bacteria 2918
311 Ga0495583_0055718 3300046506 Bacteria 1785
312 Ga0495583_0118455 3300046506 Bacteria 1116
313 Ga0495583_0163038 3300046506 Bacteria 919
314 Ga0495606_0001703 3300046507 Bacteria 28385
315 Ga0495606_0011209 3300046507 Bacteria 7337
316 Ga0495606_0027198 3300046507 Bacteria 4061
317 Ga0495606_0043982 3300046507 Bacteria 2973
318 Ga0495606_0050745 3300046507 Bacteria 2711
319 Ga0495606_0063133 3300046507 Bacteria 2362
320 Ga0495606_0079285 3300046507 Bacteria 2045
321 Ga0495606_0104565 3300046507 Bacteria 1718
322 Ga0495606_0175792 3300046507 Bacteria 1238
323 Ga0495610_0000448 3300046512 Bacteria 42572
324 Ga0495610_0031255 3300046512 Bacteria 2780
325 Ga0495610_0068082 3300046512 Bacteria 1670
326 Ga0495610_0089803 3300046512 Bacteria 1395
327 Ga0495616_0000255 3300046513 Bacteria 43270
328 Ga0495616_0002876 3300046513 Bacteria 11237
329 Ga0495616_0003165 3300046513 Bacteria 10626
330 Ga0495616_0006552 3300046513 Bacteria 7033
331 Ga0495616_0018313 3300046513 Bacteria 3846
332 Ga0495616_0029944 3300046513 Bacteria 2866
333 Ga0495616_0036975 3300046513 Bacteria 2515
334 Ga0495616_0072604 3300046513 Bacteria 1661
335 Ga0495616_0118751 3300046513 Bacteria 1223
336 Ga0495620_0053584 3300046515 Bacteria 1707
337 Ga0495631_0001384 3300046518 Bacteria 14735
338 Ga0495631_0001392 3300046518 Bacteria 14697
339 Ga0495631_0002906 3300046518 Bacteria 9490
340 Ga0495631_0005307 3300046518 Bacteria 6767
341 Ga0495631_0009828 3300046518 Bacteria 4762
342 Ga0495631_0015726 3300046518 Bacteria 3618
343 Ga0495631_0018610 3300046518 Bacteria 3267
344 Ga0495631_0022866 3300046518 Bacteria 2904
345 Ga0495631_0024806 3300046518 Bacteria 2766
346 Ga0495631_0025266 3300046518 Bacteria 2737
347 Ga0495631_0029718 3300046518 Bacteria 2483
348 Ga0495631_0046494 3300046518 Bacteria 1907
349 Ga0495632_0000145 3300046519 Bacteria 72949
350 Ga0495632_0000160 3300046519 Bacteria 69602
351 Ga0495632_0000958 3300046519 Bacteria 25232
352 Ga0495632_0004211 3300046519 Bacteria 9834
353 Ga0495632_0020304 3300046519 Bacteria 3598
354 Ga0495632_0022255 3300046519 Bacteria 3399
355 Ga0495637_0000095 3300046520 Bacteria 69092
356 Ga0495637_0021936 3300046520 Bacteria 2919
357 Ga0495643_0000099 3300046522 Bacteria 145425
358 Ga0495643_0000135 3300046522 Bacteria 118587
359 Ga0495643_0036636 3300046522 Bacteria 2694
360 Ga0495643_0090542 3300046522 Bacteria 1578
361 Ga0495643_0149433 3300046522 Bacteria 1158
362 Ga0495644_0000135 3300046523 Bacteria 35398
363 Ga0495644_0001024 3300046523 Bacteria 11647
364 Ga0495644_0003309 3300046523 Bacteria 6372
365 Ga0495644_0010915 3300046523 Bacteria 3501
366 Ga0495644_0016030 3300046523 Bacteria 2871
367 Ga0495644_0016962 3300046523 Bacteria 2786
368 Ga0495644_0022768 3300046523 Bacteria 2386
369 Ga0495644_0025877 3300046523 Bacteria 2226
370 Ga0495644_0028194 3300046523 Bacteria 2125
371 Ga0495644_0030021 3300046523 Bacteria 2052
372 Ga0495644_0045397 3300046523 Bacteria 1652
373 Ga0495648_0000037 3300046524 Bacteria 195401
374 Ga0495648_0000174 3300046524 Bacteria 74225
375 Ga0495648_0000540 3300046524 Bacteria 40830
376 Ga0495648_0000622 3300046524 Bacteria 37974
377 Ga0495648_0001727 3300046524 Bacteria 21088
378 Ga0495648_0016428 3300046524 Bacteria 5338
379 Ga0495648_0020390 3300046524 Bacteria 4624
380 Ga0495648_0025668 3300046524 Bacteria 3984
381 Ga0495648_0132844 3300046524 Bacteria 1321
382 Ga0495663_0005750 3300046525 Bacteria 3433
383 Ga0495663_0022940 3300046525 Bacteria 1805
384 Ga0495666_0002988 3300046526 Bacteria 8486
385 Ga0495642_0000102 3300046528 Bacteria 48179
386 Ga0495642_0000404 3300046528 Bacteria 23219
387 Ga0495642_0000540 3300046528 Bacteria 19040
388 Ga0495642_0001408 3300046528 Bacteria 10781
389 Ga0495642_0002114 3300046528 Bacteria 8212
390 Ga0495642_0011415 3300046528 Bacteria 3413
391 Ga0495642_0012299 3300046528 Bacteria 3298
392 Ga0495642_0013070 3300046528 Bacteria 3207
393 Ga0495642_0015048 3300046528 Bacteria 3003
394 Ga0495642_0030408 3300046528 Bacteria 2160
395 Ga0495642_0050791 3300046528 Bacteria 1705
396 Ga0495642_0052474 3300046528 Bacteria 1679
397 Ga0495654_0003810 3300046530 Bacteria 9118
398 Ga0495654_0003860 3300046530 Bacteria 9051
399 Ga0495654_0017026 3300046530 Bacteria 3828
400 Ga0495665_0035123 3300046531 Bacteria 2679
401 Ga0495640_0043506 3300046533 Bacteria 3127
402 Ga0495586_0000564 3300046535 Bacteria 21474
403 Ga0495587_0045980 3300046536 Bacteria 2593
404 Ga0495587_0200203 3300046536 Bacteria 1129
405 Ga0495609_0000992 3300046538 Bacteria 20251
406 Ga0495609_0001788 3300046538 Bacteria 13793
407 Ga0495609_0002768 3300046538 Bacteria 10554
408 Ga0495609_0003858 3300046538 Bacteria 8429
409 Ga0495609_0004975 3300046538 Bacteria 7120
410 Ga0495609_0009226 3300046538 Bacteria 4780
411 Ga0495609_0012527 3300046538 Bacteria 4023
412 Ga0495609_0013043 3300046538 Bacteria 3931
413 Ga0495609_0051931 3300046538 Bacteria 1824
414 Ga0495609_0123099 3300046538 Bacteria 1114
415 Ga0495597_0000156 3300046542 Bacteria 60520
416 Ga0495597_0000172 3300046542 Bacteria 57536
417 Ga0495597_0000279 3300046542 Bacteria 46410
418 Ga0495597_0000298 3300046542 Bacteria 44574
419 Ga0495597_0000318 3300046542 Bacteria 43381
420 Ga0495597_0001246 3300046542 Bacteria 18849
421 Ga0495597_0003999 3300046542 Bacteria 8283
422 Ga0495597_0004715 3300046542 Bacteria 7394
423 Ga0495597_0005162 3300046542 Bacteria 6956
424 Ga0495597_0009704 3300046542 Bacteria 4743
425 Ga0495597_0074508 3300046542 Bacteria 1457
426 Ga0495597_0079024 3300046542 Bacteria 1409
427 Ga0495597_0085927 3300046542 Bacteria 1340
428 Ga0495645_0027365 3300046543 Bacteria 4143
429 Ga0495622_0000040 3300046557 Bacteria 118542
430 Ga0495622_0001638 3300046557 Bacteria 11062
431 Ga0495622_0025512 3300046557 Bacteria 2760
432 Ga0495622_0028151 3300046557 Bacteria 2623
433 Ga0495622_0038292 3300046557 Bacteria 2232
434 Ga0495622_0177392 3300046557 Bacteria 956
435 Ga0495633_0000121 3300046558 Bacteria 105197
436 Ga0495633_0000349 3300046558 Bacteria 50979
437 Ga0495633_0000455 3300046558 Bacteria 42004
438 Ga0495633_0002132 3300046558 Bacteria 14171
439 Ga0495633_0002398 3300046558 Bacteria 13265
440 Ga0495633_0002575 3300046558 Bacteria 12699
441 Ga0495633_0003155 3300046558 Bacteria 11156
442 Ga0495633_0005792 3300046558 Bacteria 7456
443 Ga0495633_0006230 3300046558 Bacteria 7121
444 Ga0495633_0013639 3300046558 Bacteria 4274
445 Ga0495633_0033290 3300046558 Bacteria 2485
446 Ga0495633_0050694 3300046558 Bacteria 1956
447 Ga0495633_0068729 3300046558 Bacteria 1653
448 Ga0495633_0071886 3300046558 Bacteria 1613
449 Ga0495633_0092913 3300046558 Bacteria 1402
450 Ga0495633_0096108 3300046558 Bacteria 1376
451 Ga0495633_0110648 3300046558 Bacteria 1273
452 Ga0495633_0130375 3300046558 Bacteria 1163
453 Ga0495667_0164163 3300046559 Bacteria 1428
454 Ga0495656_0002423 3300046615 Bacteria 6187
455 Ga0495656_0040517 3300046615 Bacteria 1941
456 Ga0495668_0000285 3300046616 Bacteria 70023
457 Ga0495668_0000404 3300046616 Bacteria 56317
458 Ga0495668_0002059 3300046616 Bacteria 17461
459 Ga0495668_0002934 3300046616 Bacteria 13461
460 Ga0495668_0004168 3300046616 Bacteria 10433
461 Ga0495668_0005606 3300046616 Bacteria 8444
462 Ga0495668_0008722 3300046616 Bacteria 6296
463 Ga0495668_0016009 3300046616 Bacteria 4367
464 Ga0495668_0023122 3300046616 Bacteria 3547
465 Ga0495668_0023903 3300046616 Bacteria 3479
466 Ga0495668_0030062 3300046616 Bacteria 3068
467 Ga0495668_0030333 3300046616 Bacteria 3053
468 Ga0495668_0045168 3300046616 Bacteria 2448
469 Ga0495668_0123369 3300046616 Bacteria 1417
470 Ga0495668_0128119 3300046616 Bacteria 1389
471 Ga0495611_0000173 3300046648 Bacteria 46907
472 Ga0495611_0000924 3300046648 Bacteria 15830
473 Ga0495611_0003078 3300046648 Bacteria 7405
474 Ga0495611_0003527 3300046648 Bacteria 6887
475 Ga0495611_0006515 3300046648 Bacteria 4975
476 Ga0495611_0013911 3300046648 Bacteria 3432
477 Ga0495611_0015931 3300046648 Bacteria 3212
478 Ga0495611_0019296 3300046648 Bacteria 2927
479 Ga0495611_0024690 3300046648 Bacteria 2615
480 Ga0495625_0000023 3300046660 Bacteria 274067
481 Ga0495625_0004975 3300046660 Bacteria 12344
482 Ga0495625_0007596 3300046660 Bacteria 9413
483 Ga0495625_0011673 3300046660 Bacteria 7146
484 Ga0495625_0012646 3300046660 Bacteria 6830
485 Ga0495625_0019667 3300046660 Bacteria 5229
486 Ga0495625_0026549 3300046660 Bacteria 4375
487 Ga0495625_0085821 3300046660 Bacteria 2184
488 Ga0495625_0199258 3300046660 Bacteria 1322
489 Ga0495625_0220737 3300046660 Bacteria 1242
490 Ga0495659_0001953 3300046664 Bacteria 6789
491 Ga0495659_0003081 3300046664 Bacteria 5355
492 Ga0495659_0042254 3300046664 Bacteria 1631
493 Ga0495659_0079060 3300046664 Bacteria 1245
494 Ga0495661_0000559 3300046665 Bacteria 38444
495 Ga0495661_0000741 3300046665 Bacteria 31777
496 Ga0495661_0007629 3300046665 Bacteria 7538
497 Ga0495661_0010844 3300046665 Bacteria 6198
498 Ga0495661_0017689 3300046665 Bacteria 4702
499 Ga0495661_0030115 3300046665 Bacteria 3458
500 Ga0495661_0033199 3300046665 Bacteria 3256
501 Ga0495661_0035341 3300046665 Bacteria 3136
502 Ga0495661_0057391 3300046665 Bacteria 2324
503 Ga0495661_0066202 3300046665 Bacteria 2127
504 Ga0495661_0092619 3300046665 Bacteria 1716
505 Ga0495661_0183407 3300046665 Bacteria 1107
506 Ga0495588_0003827 3300046674 Bacteria 6593
507 Ga0495588_0029355 3300046674 Bacteria 2758
508 Ga0495588_0116572 3300046674 Bacteria 1407
509 Ga0495623_0082622 3300046679 Bacteria 1985
510 Ga0495669_0000079 3300046684 Bacteria 64091
511 Ga0495669_0002027 3300046684 Bacteria 8305
512 Ga0495669_0002782 3300046684 Bacteria 7170
513 Ga0495669_0004395 3300046684 Bacteria 5820
514 Ga0495669_0013658 3300046684 Bacteria 3465
515 Ga0495613_0009834 3300046689 Bacteria 7113
516 Ga0495613_0188557 3300046689 Bacteria 1458
517 Ga0495624_0008965 3300046690 Bacteria 6951
518 Ga0495624_0059677 3300046690 Bacteria 2393
519 Ga0495670_0000174 3300046691 Bacteria 28766
520 Ga0495670_0001062 3300046691 Bacteria 13322
521 Ga0495670_0004373 3300046691 Bacteria 6928
522 Ga0495670_0008286 3300046691 Bacteria 5111
523 Ga0495670_0011396 3300046691 Bacteria 4372
524 Ga0495670_0019955 3300046691 Bacteria 3303
525 Ga0495670_0020440 3300046691 Bacteria 3265
526 Ga0495670_0045816 3300046691 Bacteria 2183
527 Ga0495670_0092823 3300046691 Bacteria 1546
528 Ga0495671_0000233 3300046692 Bacteria 47785
529 Ga0495671_0006510 3300046692 Bacteria 6743
530 Ga0495671_0007352 3300046692 Bacteria 6285
531 Ga0495671_0011162 3300046692 Bacteria 4955
532 Ga0495671_0020289 3300046692 Bacteria 3502
533 Ga0495671_0024472 3300046692 Bacteria 3144
534 Ga0495671_0070053 3300046692 Bacteria 1723
535 Ga0495649_0000433 3300046694 Bacteria 36167
536 Ga0495649_0001256 3300046694 Bacteria 19524
537 Ga0495649_0013109 3300046694 Bacteria 4791
538 Ga0495649_0019677 3300046694 Bacteria 3791
539 Ga0495649_0104600 3300046694 Bacteria 1503
540 Ga0495649_0104714 3300046694 Bacteria 1502
541 Ga0495649_0166534 3300046694 Bacteria 1154
542 Ga0495649_0247895 3300046694 Bacteria 915
543 Ga0495589_0000410 3300046794 Bacteria 32229
544 Ga0495589_0006370 3300046794 Bacteria 6235
545 Ga0495589_0027743 3300046794 Bacteria 2861
546 Ga0495589_0047043 3300046794 Bacteria 2138
547 Ga0495589_0084022 3300046794 Bacteria 1547
548 Ga0495589_0084525 3300046794 Bacteria 1542
549 Ga0495589_0135404 3300046794 Bacteria 1181
550 Ga0495589_0173785 3300046794 Bacteria 1023
551 Ga0495600_0304443 3300046809 Bacteria 1005
552 Ga0495660_0002258 3300046810 Bacteria 12399
553 Ga0495660_0008047 3300046810 Bacteria 6194
554 Ga0495660_0010318 3300046810 Bacteria 5431
555 Ga0495660_0021917 3300046810 Bacteria 3653
556 Ga0495660_0029176 3300046810 Bacteria 3114
557 Ga0495660_0030404 3300046810 Bacteria 3042
558 Ga0495660_0044375 3300046810 Bacteria 2445
559 Ga0495660_0185110 3300046810 Bacteria 1004
560 Ga0495581_0023057 3300047315 Bacteria 3607
561 Ga0495604_0007669 3300047317 Bacteria 8547
562 Ga0495604_0035726 3300047317 Bacteria 3922
563 Ga0495604_0093325 3300047317 Bacteria 2227
564 Ga0495636_0001041 3300047318 Bacteria 10404
565 Ga0495636_0001847 3300047318 Bacteria 8101
566 Ga0495636_0004009 3300047318 Bacteria 5755
567 Ga0495636_0005679 3300047318 Bacteria 4890
568 Ga0495636_0024505 3300047318 Bacteria 2447
569 Ga0495636_0034617 3300047318 Bacteria 2079
570 Ga0495636_0034699 3300047318 Bacteria 2076
571 Ga0495636_0129851 3300047318 Bacteria 1120
572 Ga0495672_0000277 3300047320 Bacteria 71082
573 Ga0495672_0000557 3300047320 Bacteria 42365
574 Ga0495672_0000771 3300047320 Bacteria 34831
575 Ga0495672_0005240 3300047320 Bacteria 10330
576 Ga0495672_0006405 3300047320 Bacteria 9135
577 Ga0495672_0036338 3300047320 Bacteria 3026
578 Ga0495676_0000084 3300047321 Bacteria 68514
579 Ga0495676_0031692 3300047321 Bacteria 4466
580 Ga0495676_0041437 3300047321 Bacteria 3790
581 Ga0495680_0011851 3300047322 Bacteria 7695
582 Ga0495683_0000293 3300047323 Bacteria 43121
583 Ga0495683_0000853 3300047323 Bacteria 21599
584 Ga0495683_0003728 3300047323 Bacteria 8817
585 Ga0495683_0036871 3300047323 Bacteria 2480
586 Ga0495683_0055048 3300047323 Bacteria 1981
587 Ga0495687_000274 3300047443 Bacteria 68218
588 Ga0495687_000306 3300047443 Bacteria 64641
589 Ga0495687_000666 3300047443 Bacteria 39241
590 Ga0495687_000677 3300047443 Bacteria 38715
591 Ga0495687_000710 3300047443 Bacteria 36977
592 Ga0495687_057267 3300047443 Bacteria 1621
593 Ga0495675_0000965 3300047444 Bacteria 17473
594 Ga0495677_0000335 3300047445 Bacteria 20261
595 Ga0495677_0001846 3300047445 Bacteria 8465
596 Ga0495677_0003809 3300047445 Bacteria 5834
597 Ga0495677_0011700 3300047445 Bacteria 3207
598 Ga0495677_0012507 3300047445 Bacteria 3094
599 Ga0495677_0015759 3300047445 Bacteria 2744
600 Ga0495677_0038816 3300047445 Bacteria 1740
601 Ga0495677_0043034 3300047445 Bacteria 1655
602 Ga0495677_0063800 3300047445 Bacteria 1368
603 Ga0495677_0107977 3300047445 Bacteria 1056
604 Ga0495679_001821 3300047446 Bacteria 11567
605 Ga0495679_007612 3300047446 Bacteria 4498
606 Ga0495679_016717 3300047446 Bacteria 2647
607 Ga0495679_027617 3300047446 Bacteria 1869
608 Ga0495679_029895 3300047446 Bacteria 1773
609 Ga0495685_000014 3300047447 Bacteria 77520
610 Ga0495685_010885 3300047447 Bacteria 3057
611 Ga0495685_018612 3300047447 Bacteria 2384
612 Ga0495685_033554 3300047447 Bacteria 1763
613 Ga0495685_043184 3300047447 Bacteria 1538
614 Ga0495673_0003321 3300047469 Bacteria 10668
615 Ga0495673_0012427 3300047469 Bacteria 4516
616 Ga0495681_0000147 3300047470 Bacteria 59493
617 Ga0495681_0000260 3300047470 Bacteria 43076
618 Ga0495681_0002009 3300047470 Bacteria 14874
619 Ga0495681_0012016 3300047470 Bacteria 5111
620 Ga0495681_0017096 3300047470 Bacteria 4040
621 Ga0495681_0035679 3300047470 Bacteria 2467
622 Ga0495681_0040690 3300047470 Bacteria 2261
623 Ga0495686_0004325 3300047472 Bacteria 11741
624 Ga0495686_0005772 3300047472 Bacteria 9668
625 Ga0495686_0005849 3300047472 Bacteria 9589
626 Ga0495686_0014823 3300047472 Bacteria 5354
627 Ga0495686_0015905 3300047472 Bacteria 5116
628 Ga0495686_0051227 3300047472 Bacteria 2591
629 Ga0495686_0116848 3300047472 Bacteria 1594
630 Ga0495593_0017028 3300047673 Bacteria 4091
631 Ga0495593_0034941 3300047673 Bacteria 2731
632 Ga0495593_0116752 3300047673 Bacteria 1359
633 Ga0495602_0047551 3300048088 Bacteria 3865
634 Ga0495614_0001003 3300048089 Bacteria 12041
635 Ga0495614_0002147 3300048089 Bacteria 8732
636 Ga0495626_0003144 3300048091 Bacteria 10805
637 Ga0495626_0004662 3300048091 Bacteria 8324
638 Ga0495626_0005832 3300048091 Bacteria 7105
639 Ga0495626_0007478 3300048091 Bacteria 6078
640 Ga0495626_0008966 3300048091 Bacteria 5429
641 Ga0495626_0011597 3300048091 Bacteria 4657
642 Ga0495626_0014126 3300048091 Bacteria 4130
643 Ga0495626_0027651 3300048091 Bacteria 2756
644 Ga0495626_0029826 3300048091 Bacteria 2635
645 Ga0495626_0051113 3300048091 Bacteria 1907
646 Ga0495626_0077340 3300048091 Bacteria 1483
647 Ga0496100_0061979 3300048903 Bacteria 2466
648 Ga0496101_0136408 3300048904 Bacteria 1867
649 Ga0496102_0000300 3300048905 Bacteria 63230
650 Ga0496103_0008742 3300048906 Bacteria 6008
651 Ga0496103_0042535 3300048906 Bacteria 2796
652 Ga0496103_0163703 3300048906 Bacteria 1427
653 Ga0496106_0018136 3300048909 Bacteria 5205
654 Ga0496106_0434297 3300048909 Bacteria 1055
655 Ga0496107_0021505 3300048910 Bacteria 4559
656 Ga0496108_0431465 3300048911 Bacteria 1151
657 Ga0496108_0463177 3300048911 Bacteria 1107
658 Ga0496109_0201291 3300048912 Bacteria 1872
659 Ga0496110_0000186 3300048913 Bacteria 39023
660 Ga0496110_0726503 3300048913 Bacteria 895
661 Ga0496111_0024155 3300048914 Bacteria 4277
662 Ga0496113_0011652 3300048916 Bacteria 5880
663 Ga0496115_0032132 3300048918 Bacteria 4140
664 Ga0496115_0082588 3300048918 Bacteria 2618
665 Ga0496115_0104805 3300048918 Bacteria 2321
666 Ga0496115_0324216 3300048918 Bacteria 1259
667 Ga0496116_0016950 3300048919 Bacteria 5679
668 Ga0496117_0000011 3300048920 Bacteria 610930
669 Ga0496118_0000010 3300048921 Bacteria 610930
670 Ga0496121_0010997 3300048924 Bacteria 10102
671 Ga0496121_0016538 3300048924 Bacteria 7609
672 Ga0496121_0348423 3300048924 Bacteria 987
673 Ga0496122_0000628 3300048925 Bacteria 71974
674 Ga0496122_0002807 3300048925 Bacteria 23886
675 Ga0496123_0000537 3300048926 Bacteria 65355
676 Ga0496123_0001409 3300048926 Bacteria 33622
677 Ga0496124_0031761 3300048927 Bacteria 4671
678 Ga0496124_0115964 3300048927 Bacteria 2148
679 Ga0496124_0240913 3300048927 Bacteria 1345
680 Ga0496125_0000674 3300048928 Bacteria 56950
681 Ga0496125_0020221 3300048928 Bacteria 6254
682 Ga0495678_000181 3300049459 Bacteria 72694
683 Ga0495678_000195 3300049459 Bacteria 71179
684 Ga0495678_000262 3300049459 Bacteria 58570
685 Ga0495678_000491 3300049459 Bacteria 39051
686 Ga0495678_003500 3300049459 Bacteria 9660
687 Ga0495678_012244 3300049459 Bacteria 4072
688 Ga0495678_029752 3300049459 Bacteria 2291
689 Ga0495678_043015 3300049459 Bacteria 1797
690 Ga0495682_0000121 3300049460 Bacteria 68179
691 Ga0495682_0000195 3300049460 Bacteria 48762
692 Ga0495682_0000306 3300049460 Bacteria 36976
693 Ga0495682_0000782 3300049460 Bacteria 20155
694 Ga0495682_0010739 3300049460 Bacteria 3536
695 nmdc:mga03683_135658_c1 3300050489 Bacteria 1104
696 nmdc:mga03683_64020_c1 3300050489 Bacteria 1559
697 nmdc:mga03n38_197802_c1 3300050490 Bacteria 1039
698 nmdc:mga00v17_71093_c1 3300050491 Bacteria 2157
699 nmdc:mga0k408_138114_c1 3300050493 Bacteria 1449
700 nmdc:mga0k408_32983_c1 3300050493 Bacteria 2959
701 nmdc:mga0k408_72121_c1 3300050493 Bacteria 2016
702 nmdc:mga07m45_82887_c1 3300050496 Bacteria 1832
703 nmdc:mga0sz30_27928_c1 3300050516 Bacteria 2320
704 Ga0500644_0064032 3300053088 Bacteria 1305
705 Ga0500646_0011557 3300053090 Bacteria 2272
706 Ga0500583_0004651 3300053092 Bacteria 4505
707 Ga0500637_0042673 3300053178 Bacteria 2565
708 2511250136 2511231003 Bacteria 5606035
709 2601669373 2600255292 Bacteria 6300551
710 2644360509 2643221664 Bacteria 7272945
711 2739275619 2738543018 Bacteria 6718814
712 2739344663 2738543030 Bacteria 6719714
713 2808981370 2808606386 Bacteria 4471946
714 2809128956 2808606415 Bacteria 4576710
715 2809148577 2808606419 Bacteria 4576925
716 2842715653 2842711865 Bacteria 7155354
717 2852621110 2852618963 Bacteria 4577824
718 2857549492 2857547612 Bacteria 6179999
719 2885085125 2885080285 Bacteria 6355622
720 2932414643 2932410948 Bacteria 6312192
721 2932420837 2932416698 Bacteria 6315112
722 Ga0105239_10143472
723 JGI25155J39150_1000449
724 JGI25156J39149_1000447
725 JGI25156J39149_1001687
726 JGI25154J39366_1000400
727 JGI25154J39366_1002034
728 JGI25154J39366_1002063
729 JGI25157J39369_1000267
730 JGI25164J39214_1003139
731 rootH1_10027638
732 rootL2_10141155
733 rootH1_10000796
734 rootH1_10028606
735 rootH1_10281587
736 Ga0055539_1000197
737 Ga0055533_1000040
738 Ga0055525_1000038
739 Ga0055525_1001871
740 Ga0055529_1000032
741 Ga0055526_1000001
742 Ga0055526_1000951
743 Ga0055537_1000030
744 Ga0055524_1012479
745 Ga0055534_1000203
746 Ga0055528_1000439
747 Ga0065165_1004849
748 Ga0065715_10136858
749 Ga0070658_10227554
750 Ga0070690_100003934
751 Ga0070690_100012655
752 Ga0068869_100002249
753 Ga0070666_10024809
754 Ga0068868_100040353
755 Ga0070689_100418602
756 Ga0070687_100009783
757 Ga0070668_100001840
758 Ga0070669_100005015
759 Ga0070675_100011382
760 Ga0070674_100001933
761 Ga0070659_100070640
762 Ga0070667_100011858
763 Ga0070667_100464792
764 Ga0070700_100017319
765 Ga0070662_100010014
766 Ga0068867_100004249
767 Ga0070684_100343569
768 Ga0068853_100120915
769 Ga0068853_100226687
770 Ga0070672_100012264
771 Ga0068855_100012110
772 Ga0068857_100019689
773 Ga0068856_100001658
774 Ga0068852_100016167
775 Ga0068852_100053382
776 Ga0068852_100551788
777 Ga0068859_100033169
778 Ga0068864_100014855
779 Ga0068866_10002463
780 Ga0068861_100009071
781 Ga0068861_100022899
782 Ga0068863_100006509
783 Ga0068858_100059421
784 Ga0068860_100037393
785 Ga0068860_100286754
786 Ga0068860_100746281
787 Ga0075363_100112634
788 Ga0075366_10013595
789 Ga0075366_10043139
790 Ga0075366_10043223
791 Ga0075370_10025252
792 Ga0068865_100003333
793 Ga0097620_100033170
794 Ga0099795_10080417
795 Ga0105240_10018053
796 Ga0105240_10069749
797 Ga0105245_10069680
798 Ga0105243_10005749
799 Ga0105242_10067100
800 Ga0105242_10068765
801 Ga0105238_10281555
802 Ga0105249_10003818
803 Ga0105239_10045708
804 Ga0105239_10128780
805 Ga0157369_10120704
806 Ga0157378_10040424
807 Ga0157378_10184633
808 Ga0163162_10015948
809 Ga0157375_10056412
810 Ga0157375_10252616
811 Ga0157380_10011647
812 Ga0182008_10000303
813 Ga0157379_10004848
814 Ga0157379_10022057
815 Ga0182006_1000004
816 Ga0182007_10000018
817 Ga0182005_1000011
818 Ga0163161_10004156
819 Ga0163161_10016812
820 Ga0213872_10005914
821 Ga0213872_10013618
822 Ga0209435_100112
823 Ga0209784_100021
824 Ga0209566_100039
825 Ga0209674_100036
826 Ga0209674_100066
827 Ga0209563_100005
828 Ga0209563_100040
829 Ga0209563_100129
830 Ga0207427_100314
831 Ga0209437_101493
832 Ga0209258_100419
833 Ga0209646_1000020
834 Ga0209646_1000054
835 Ga0209646_1000076
836 Ga0209026_1000011
837 Ga0209677_100023
838 Ga0209677_100157
839 Ga0209677_100160
840 Ga0209759_1000034
841 Ga0209759_1000073
842 Ga0209759_1000352
843 Ga0209759_1014509
844 Ga0209565_1000017
845 Ga0209455_1000043
846 Ga0209673_1000007
847 Ga0209675_1000009
848 Ga0209564_1000002
849 Ga0209564_1000055
850 Ga0209256_1000559
851 Ga0209051_1004150
852 Ga0207642_10002016
853 Ga0207680_10008600
854 Ga0207645_10000262
855 Ga0207705_10277109
856 Ga0207654_10021849
857 Ga0207695_10009345
858 Ga0207695_10022459
859 Ga0207671_10032860
860 Ga0207662_10002649
861 Ga0207657_10028964
862 Ga0207657_10099837
863 Ga0207681_10007608
864 Ga0207694_10040610
865 Ga0207687_10154904
866 Ga0207690_10285974
867 Ga0207690_10541175
868 Ga0207706_10002487
869 Ga0207686_10083547
870 Ga0207709_10009363
871 Ga0207669_10006468
872 Ga0207704_10005165
873 Ga0207691_10004507
874 Ga0207689_10001349
875 Ga0207689_10314573
876 Ga0207667_10012991
877 Ga0207651_10024234
878 Ga0207712_10023893
879 Ga0207668_10005376
880 Ga0207640_10015038
881 Ga0207658_10002923
882 Ga0207677_10025514
883 Ga0207703_10031541
884 Ga0207639_10096759
885 Ga0207708_10010773
886 Ga0207702_10002567
887 Ga0207641_10003275
888 Ga0207648_10003878
889 Ga0207648_10343067
890 Ga0207676_10038326
891 Ga0207674_10007284
892 Ga0207675_100011808
893 Ga0207675_100021794
894 Ga0207683_10055825
895 Ga0207683_10154393
896 Ga0207698_10009829
897 Ga0207698_10032690
898 Ga0207698_10434803
899 Ga0268264_10054528
900 Ga0307515_10205931
901 Ga0307511_10000574
902 Ga0316182_1375358
903 Ga0265331_10003107
904 Ga0265327_10000083
905 Ga0307513_10006896
906 Ga0307412_10516676
907 Ga0307414_10054142
908 Ga0307507_10180068
909 Ga0373934_0050556
910 Ga0373939_0000097
911 Ga0373931_0000147
912 Ga0373931_0060823
913 Ga0395899_0060977
914 Ga0395900_0055755
915 Ga0395898_0044271
916 Ga0395905_0026780
917 Ga0395905_0222610
918 Ga0395905_0314674
919 Ga0395901_0002036
920 Ga0436360_0997915
921 Ga0436361_0420166
922 Ga0436361_0534903
923 Ga0436361_0695712
924 Ga0451577_0015275
925 Ga0451577_0124285
926 Ga0466972_0026272
927 Ga0466972_0053888
928 Ga0466965_0041380
929 Ga0466965_0042023
930 Ga0466964_0008294
931 Ga0466964_0041507
932 Ga0453684_0113609
933 Ga0466968_0002881
934 Ga0466968_0007155
935 Ga0451576_0269599
936 Ga0466967_0083388
937 Ga0495617_000087
938 Ga0495617_000290
939 Ga0495627_000463
940 Ga0495627_022867
941 Ga0495603_0025372
942 Ga0495603_0069133
943 Ga0495603_0137007
944 Ga0495590_0000034
945 Ga0495590_0000069
946 Ga0495590_0005517
947 Ga0495590_0013494
948 Ga0495591_000370
949 Ga0495591_011655
950 Ga0495629_0002150
951 Ga0495629_0035370
952 Ga0495629_0040206
953 Ga0495638_0000072
954 Ga0495638_0004326
955 Ga0495638_0031645
956 Ga0495638_0097807
957 Ga0495638_0201746
958 Ga0495638_0203808
959 Ga0495653_0031373
960 Ga0495650_0005074
961 Ga0495650_0009804
962 Ga0495582_0036959
963 Ga0495605_0000238
964 Ga0495605_0004352
965 Ga0495605_0007732
966 Ga0495605_0008039
967 Ga0495605_0018205
968 Ga0495605_0023450
969 Ga0495605_0032973
970 Ga0495605_0079681
971 Ga0495584_0000165
972 Ga0495584_0000573
973 Ga0495584_0001012
974 Ga0495584_0003264
975 Ga0495584_0011854
976 Ga0495584_0012480
977 Ga0495584_0035410
978 Ga0495584_0052214
979 Ga0495584_0065504
980 Ga0495585_0000114
981 Ga0495585_0000249
982 Ga0495585_0001056
983 Ga0495585_0001261
984 Ga0495585_0007090
985 Ga0495585_0008225
986 Ga0495585_0010267
987 Ga0495585_0012029
988 Ga0495585_0012749
989 Ga0495585_0016207
990 Ga0495585_0018643
991 Ga0495585_0025681
992 Ga0495585_0028872
993 Ga0495585_0030953
994 Ga0495585_0031175
995 Ga0495585_0052330
996 Ga0495585_0116020
997 Ga0495585_0211257
998 Ga0495594_0000661
999 Ga0495594_0009492
1000 Ga0495594_0011150
1001 Ga0495594_0138748
1002 Ga0495596_0000286
1003 Ga0495596_0001162
1004 Ga0495596_0002482
1005 Ga0495596_0004823
1006 Ga0495596_0009669
1007 Ga0495596_0010660
1008 Ga0495596_0019401
1009 Ga0495596_0024009
1010 Ga0495596_0025834
1011 Ga0495607_0009178
1012 Ga0495607_0010087
1013 Ga0495607_0011159
1014 Ga0495607_0015607
1015 Ga0495607_0024614
1016 Ga0495607_0032554
1017 Ga0495607_0038547
1018 Ga0495607_0058959
1019 Ga0495607_0071431
1020 Ga0495607_0073431
1021 Ga0495583_0000148
1022 Ga0495583_0000272
1023 Ga0495583_0000336
1024 Ga0495583_0000340
1025 Ga0495583_0000374
1026 Ga0495583_0000873
1027 Ga0495583_0001741
1028 Ga0495583_0006709
1029 Ga0495583_0008300
1030 Ga0495583_0024307
1031 Ga0495583_0025925
1032 Ga0495583_0055718
1033 Ga0495583_0118455
1034 Ga0495583_0163038
1035 Ga0495606_0001703
1036 Ga0495606_0011209
1037 Ga0495606_0027198
1038 Ga0495606_0043982
1039 Ga0495606_0050745
1040 Ga0495606_0063133
1041 Ga0495606_0079285
1042 Ga0495606_0104565
1043 Ga0495606_0175792
1044 Ga0495610_0000448
1045 Ga0495610_0031255
1046 Ga0495610_0068082
1047 Ga0495610_0089803
1048 Ga0495616_0000255
1049 Ga0495616_0002876
1050 Ga0495616_0003165
1051 Ga0495616_0006552
1052 Ga0495616_0018313
1053 Ga0495616_0029944
1054 Ga0495616_0036975
1055 Ga0495616_0072604
1056 Ga0495616_0118751
1057 Ga0495620_0053584
1058 Ga0495631_0001384
1059 Ga0495631_0001392
1060 Ga0495631_0002906
1061 Ga0495631_0005307
1062 Ga0495631_0009828
1063 Ga0495631_0015726
1064 Ga0495631_0018610
1065 Ga0495631_0022866
1066 Ga0495631_0024806
1067 Ga0495631_0025266
1068 Ga0495631_0029718
1069 Ga0495631_0046494
1070 Ga0495632_0000145
1071 Ga0495632_0000160
1072 Ga0495632_0000958
1073 Ga0495632_0004211
1074 Ga0495632_0020304
1075 Ga0495632_0022255
1076 Ga0495637_0000095
1077 Ga0495637_0021936
1078 Ga0495643_0000099
1079 Ga0495643_0000135
1080 Ga0495643_0036636
1081 Ga0495643_0090542
1082 Ga0495643_0149433
1083 Ga0495644_0000135
1084 Ga0495644_0001024
1085 Ga0495644_0003309
1086 Ga0495644_0010915
1087 Ga0495644_0016030
1088 Ga0495644_0016962
1089 Ga0495644_0022768
1090 Ga0495644_0025877
1091 Ga0495644_0028194
1092 Ga0495644_0030021
1093 Ga0495644_0045397
1094 Ga0495648_0000037
1095 Ga0495648_0000174
1096 Ga0495648_0000540
1097 Ga0495648_0000622
1098 Ga0495648_0001727
1099 Ga0495648_0016428
1100 Ga0495648_0020390
1101 Ga0495648_0025668
1102 Ga0495648_0132844
1103 Ga0495663_0005750
1104 Ga0495663_0022940
1105 Ga0495666_0002988
1106 Ga0495642_0000102
1107 Ga0495642_0000404
1108 Ga0495642_0000540
1109 Ga0495642_0001408
1110 Ga0495642_0002114
1111 Ga0495642_0011415
1112 Ga0495642_0012299
1113 Ga0495642_0013070
1114 Ga0495642_0015048
1115 Ga0495642_0030408
1116 Ga0495642_0050791
1117 Ga0495642_0052474
1118 Ga0495654_0003810
1119 Ga0495654_0003860
1120 Ga0495654_0017026
1121 Ga0495665_0035123
1122 Ga0495640_0043506
1123 Ga0495586_0000564
1124 Ga0495587_0045980
1125 Ga0495587_0200203
1126 Ga0495609_0000992
1127 Ga0495609_0001788
1128 Ga0495609_0002768
1129 Ga0495609_0003858
1130 Ga0495609_0004975
1131 Ga0495609_0009226
1132 Ga0495609_0012527
1133 Ga0495609_0013043
1134 Ga0495609_0051931
1135 Ga0495609_0123099
1136 Ga0495597_0000156
1137 Ga0495597_0000172
1138 Ga0495597_0000279
1139 Ga0495597_0000298
1140 Ga0495597_0000318
1141 Ga0495597_0001246
1142 Ga0495597_0003999
1143 Ga0495597_0004715
1144 Ga0495597_0005162
1145 Ga0495597_0009704
1146 Ga0495597_0074508
1147 Ga0495597_0079024
1148 Ga0495597_0085927
1149 Ga0495645_0027365
1150 Ga0495622_0000040
1151 Ga0495622_0001638
1152 Ga0495622_0025512
1153 Ga0495622_0028151
1154 Ga0495622_0038292
1155 Ga0495622_0177392
1156 Ga0495633_0000121
1157 Ga0495633_0000349
1158 Ga0495633_0000455
1159 Ga0495633_0002132
1160 Ga0495633_0002398
1161 Ga0495633_0002575
1162 Ga0495633_0003155
1163 Ga0495633_0005792
1164 Ga0495633_0006230
1165 Ga0495633_0013639
1166 Ga0495633_0033290
1167 Ga0495633_0050694
1168 Ga0495633_0068729
1169 Ga0495633_0071886
1170 Ga0495633_0092913
1171 Ga0495633_0096108
1172 Ga0495633_0110648
1173 Ga0495633_0130375
1174 Ga0495667_0164163
1175 Ga0495656_0002423
1176 Ga0495656_0040517
1177 Ga0495668_0000285
1178 Ga0495668_0000404
1179 Ga0495668_0002059
1180 Ga0495668_0002934
1181 Ga0495668_0004168
1182 Ga0495668_0005606
1183 Ga0495668_0008722
1184 Ga0495668_0016009
1185 Ga0495668_0023122
1186 Ga0495668_0023903
1187 Ga0495668_0030062
1188 Ga0495668_0030333
1189 Ga0495668_0045168
1190 Ga0495668_0123369
1191 Ga0495668_0128119
1192 Ga0495611_0000173
1193 Ga0495611_0000924
1194 Ga0495611_0003078
1195 Ga0495611_0003527
1196 Ga0495611_0006515
1197 Ga0495611_0013911
1198 Ga0495611_0015931
1199 Ga0495611_0019296
1200 Ga0495611_0024690
1201 Ga0495625_0000023
1202 Ga0495625_0004975
1203 Ga0495625_0007596
1204 Ga0495625_0011673
1205 Ga0495625_0012646
1206 Ga0495625_0019667
1207 Ga0495625_0026549
1208 Ga0495625_0085821
1209 Ga0495625_0199258
1210 Ga0495625_0220737
1211 Ga0495659_0001953
1212 Ga0495659_0003081
1213 Ga0495659_0042254
1214 Ga0495659_0079060
1215 Ga0495661_0000559
1216 Ga0495661_0000741
1217 Ga0495661_0007629
1218 Ga0495661_0010844
1219 Ga0495661_0017689
1220 Ga0495661_0030115
1221 Ga0495661_0033199
1222 Ga0495661_0035341
1223 Ga0495661_0057391
1224 Ga0495661_0066202
1225 Ga0495661_0092619
1226 Ga0495661_0183407
1227 Ga0495588_0003827
1228 Ga0495588_0029355
1229 Ga0495588_0116572
1230 Ga0495623_0082622
1231 Ga0495669_0000079
1232 Ga0495669_0002027
1233 Ga0495669_0002782
1234 Ga0495669_0004395
1235 Ga0495669_0013658
1236 Ga0495613_0009834
1237 Ga0495613_0188557
1238 Ga0495624_0008965
1239 Ga0495624_0059677
1240 Ga0495670_0000174
1241 Ga0495670_0001062
1242 Ga0495670_0004373
1243 Ga0495670_0008286
1244 Ga0495670_0011396
1245 Ga0495670_0019955
1246 Ga0495670_0020440
1247 Ga0495670_0045816
1248 Ga0495670_0092823
1249 Ga0495671_0000233
1250 Ga0495671_0006510
1251 Ga0495671_0007352
1252 Ga0495671_0011162
1253 Ga0495671_0020289
1254 Ga0495671_0024472
1255 Ga0495671_0070053
1256 Ga0495649_0000433
1257 Ga0495649_0001256
1258 Ga0495649_0013109
1259 Ga0495649_0019677
1260 Ga0495649_0104600
1261 Ga0495649_0104714
1262 Ga0495649_0166534
1263 Ga0495649_0247895
1264 Ga0495589_0000410
1265 Ga0495589_0006370
1266 Ga0495589_0027743
1267 Ga0495589_0047043
1268 Ga0495589_0084022
1269 Ga0495589_0084525
1270 Ga0495589_0135404
1271 Ga0495589_0173785
1272 Ga0495600_0304443
1273 Ga0495660_0002258
1274 Ga0495660_0008047
1275 Ga0495660_0010318
1276 Ga0495660_0021917
1277 Ga0495660_0029176
1278 Ga0495660_0030404
1279 Ga0495660_0044375
1280 Ga0495660_0185110
1281 Ga0495581_0023057
1282 Ga0495604_0007669
1283 Ga0495604_0035726
1284 Ga0495604_0093325
1285 Ga0495636_0001041
1286 Ga0495636_0001847
1287 Ga0495636_0004009
1288 Ga0495636_0005679
1289 Ga0495636_0024505
1290 Ga0495636_0034617
1291 Ga0495636_0034699
1292 Ga0495636_0129851
1293 Ga0495672_0000277
1294 Ga0495672_0000557
1295 Ga0495672_0000771
1296 Ga0495672_0005240
1297 Ga0495672_0006405
1298 Ga0495672_0036338
1299 Ga0495676_0000084
1300 Ga0495676_0031692
1301 Ga0495676_0041437
1302 Ga0495680_0011851
1303 Ga0495683_0000293
1304 Ga0495683_0000853
1305 Ga0495683_0003728
1306 Ga0495683_0036871
1307 Ga0495683_0055048
1308 Ga0495687_000274
1309 Ga0495687_000306
1310 Ga0495687_000666
1311 Ga0495687_000677
1312 Ga0495687_000710
1313 Ga0495687_057267
1314 Ga0495675_0000965
1315 Ga0495677_0000335
1316 Ga0495677_0001846
1317 Ga0495677_0003809
1318 Ga0495677_0011700
1319 Ga0495677_0012507
1320 Ga0495677_0015759
1321 Ga0495677_0038816
1322 Ga0495677_0043034
1323 Ga0495677_0063800
1324 Ga0495677_0107977
1325 Ga0495679_001821
1326 Ga0495679_007612
1327 Ga0495679_016717
1328 Ga0495679_027617
1329 Ga0495679_029895
1330 Ga0495685_000014
1331 Ga0495685_010885
1332 Ga0495685_018612
1333 Ga0495685_033554
1334 Ga0495685_043184
1335 Ga0495673_0003321
1336 Ga0495673_0012427
1337 Ga0495681_0000147
1338 Ga0495681_0000260
1339 Ga0495681_0002009
1340 Ga0495681_0012016
1341 Ga0495681_0017096
1342 Ga0495681_0035679
1343 Ga0495681_0040690
1344 Ga0495686_0004325
1345 Ga0495686_0005772
1346 Ga0495686_0005849
1347 Ga0495686_0014823
1348 Ga0495686_0015905
1349 Ga0495686_0051227
1350 Ga0495686_0116848
1351 Ga0495593_0017028
1352 Ga0495593_0034941
1353 Ga0495593_0116752
1354 Ga0495602_0047551
1355 Ga0495614_0001003
1356 Ga0495614_0002147
1357 Ga0495626_0003144
1358 Ga0495626_0004662
1359 Ga0495626_0005832
1360 Ga0495626_0007478
1361 Ga0495626_0008966
1362 Ga0495626_0011597
1363 Ga0495626_0014126
1364 Ga0495626_0027651
1365 Ga0495626_0029826
1366 Ga0495626_0051113
1367 Ga0495626_0077340
1368 Ga0496100_0061979
1369 Ga0496101_0136408
1370 Ga0496102_0000300
1371 Ga0496103_0008742
1372 Ga0496103_0042535
1373 Ga0496103_0163703
1374 Ga0496106_0018136
1375 Ga0496106_0434297
1376 Ga0496107_0021505
1377 Ga0496108_0431465
1378 Ga0496108_0463177
1379 Ga0496109_0201291
1380 Ga0496110_0000186
1381 Ga0496110_0726503
1382 Ga0496111_0024155
1383 Ga0496113_0011652
1384 Ga0496115_0032132
1385 Ga0496115_0082588
1386 Ga0496115_0104805
1387 Ga0496115_0324216
1388 Ga0496116_0016950
1389 Ga0496117_0000011
1390 Ga0496118_0000010
1391 Ga0496121_0010997
1392 Ga0496121_0016538
1393 Ga0496121_0348423
1394 Ga0496122_0000628
1395 Ga0496122_0002807
1396 Ga0496123_0000537
1397 Ga0496123_0001409
1398 Ga0496124_0031761
1399 Ga0496124_0115964
1400 Ga0496124_0240913
1401 Ga0496125_0000674
1402 Ga0496125_0020221
1403 Ga0495678_000181
1404 Ga0495678_000195
1405 Ga0495678_000262
1406 Ga0495678_000491
1407 Ga0495678_003500
1408 Ga0495678_012244
1409 Ga0495678_029752
1410 Ga0495678_043015
1411 Ga0495682_0000121
1412 Ga0495682_0000195
1413 Ga0495682_0000306
1414 Ga0495682_0000782
1415 Ga0495682_0010739
1416 nmdc:mga03683_135658_c1
1417 nmdc:mga03683_64020_c1
1418 nmdc:mga03n38_197802_c1
1419 nmdc:mga00v17_71093_c1
1420 nmdc:mga0k408_138114_c1
1421 nmdc:mga0k408_32983_c1
1422 nmdc:mga0k408_72121_c1
1423 nmdc:mga07m45_82887_c1
1424 nmdc:mga0sz30_27928_c1
1425 Ga0500644_0064032
1426 Ga0500646_0011557
1427 Ga0500583_0004651
1428 Ga0500637_0042673
1429 2511250136
1430 2601669373
1431 2644360509
1432 2739275619
1433 2739344663
1434 2808981370
1435 2809128956
1436 2809148577
1437 2842715653
1438 2852621110
1439 2857549492
1440 2885085125
1441 2932414643
1442 2932420837

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tlz-assembly2.cif.gz_B tsx structure complexed with uridine 0.6452 37 271
1tlz-assembly2.cif.gz_B tsx structure complexed with uridine 0.6133 37 271
4fqe-assembly1.cif.gz_A kdgm porin 0.5723 42 271
4fqe-assembly1.cif.gz_A kdgm porin 0.5647 42 271
7ye6-assembly1.cif.gz_P bam-espp complex structure with bama-n427c/espp-r1297c mutations in nanodisc 0.5164 34 266
ID Description Score Start End Superfamily
1tlyB00 Mainly Beta;Beta Barrel;Outer membrane phospholipase (ompla); Chain C;Nucleoside-specific channel-forming protein, Tsx-like 0.6702 37 271 2.40.230.20
af_P76206_47_252_2.40.128.130 Mainly Beta;Beta Barrel;Lipocalin;Autotransporter beta-domain 0.6597 42 269 2.40.128.130
af_P76206_47_252_2.40.128.130 Mainly Beta;Beta Barrel;Lipocalin;Autotransporter beta-domain 0.6484 42 269 2.40.128.130
1tlyB00 Mainly Beta;Beta Barrel;Outer membrane phospholipase (ompla); Chain C;Nucleoside-specific channel-forming protein, Tsx-like 0.6364 37 271 2.40.230.20
af_Q5A893_109_250_3.90.1150.210 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;F-actin capping protein, beta subunit 0.6228 174 257 3.90.1150.210
ID Description Score Start End GO Terms
AF-A0A0J9DMH1-F1-model_v4 deleted 0.965 38 226
AF-A0A4R5Q981-F1-model_v4 Outer envelope protein 0.9493 40 271 GO:0009279
AF-A0A132F449-F1-model_v4 Nucleoside-specific outer membrane channel protein Tsx 0.9488 38 271 GO:0009279
AF-A0A3D2SH49-F1-model_v4 Outer envelope protein 0.9478 125 254 GO:0009279
AF-A0A855HNE1-F1-model_v4 deleted 0.9388 163 271

Map