F477368

General Info

Members Datasets Scaffolds Average Seq Length
721 364 711 291

Family's Representative Sequence

Representative Sequence 3300025939|Ga0207665_10099187|Ga0207665_100991872
Length 312
Sequence MTKPQFSTLAAEPAPPVADRTAAPVPPGRRWRPRLRLPFSPWHLVLIPLSFILVVPLLWMLVTSLETEGEANRFPPVLIPERPRFENYSEAWAAAPFGHFFVNSALVTLVVLVSNLVVCSLAGYAFARIRFLGRGALFVTLMATLMVPFQVTMIPVFLIVKWFGDNVWAGLGIDHIGALMLPNLATAFGIFFLRQFFQTVPVELEEAARVDGTSRLGVLFKIVLPLSLPALSTLAALTVLTSWNDFLWPLIVITSQDQMTIPLGLSYFQGAHRVKWPLLMAANVMSLLPMLLVFIGAQRYFVQSVASTGLKG

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
3 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
4 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
5 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
6 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
7 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
8 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
9 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
181 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
182 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
183 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
184 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
185 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
186 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
187 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
192 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
200 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
201 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
202 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
203 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
221 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
222 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
226 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
227 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
228 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
229 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
230 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
231 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
241 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
251 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
263 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
271 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
272 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
273 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
274 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
279 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
280 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
281 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
282 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
283 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
284 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
294 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
311 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
312 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
313 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
314 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
315 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
316 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
317 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
318 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
327 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
328 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
329 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
330 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
346 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
347 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
348 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
349 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
350 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
351 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
352 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
353 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
354 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
355 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
356 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
357 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
358 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
359 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
360 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
361 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
363 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
364 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.34
Metatranscriptomes 0.28
Isolates 1.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.46
Nodule 0
Rhizoplane 7.77
Rhizosphere 80.58
Stem 0
Stem Tuber 0
Unclassified 3.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000089 3300001977 Bacteria 10008
2 JGI24743J22301_10021890 3300001991 Bacteria 1223
3 JGI24735J21928_10032869 3300002067 Bacteria 1535
4 JGI24745J21846_1007302 3300002073 Bacteria 1235
5 JGI24748J21848_1002478 3300002074 Bacteria 2083
6 JGI24738J21930_10003332 3300002075 Bacteria 4074
7 JGI24744J21845_10000059 3300002077 Bacteria 13116
8 JGI24742J22300_10000896 3300002244 Bacteria 4563
9 JGI24742J22300_10012450 3300002244 Bacteria 1418
10 JGI25406J46586_10021790 3300003203 Bacteria 2565
11 Ga0055540_1000941 3300003792 Bacteria 18922
12 Ga0055540_1001155 3300003792 Bacteria 16426
13 Ga0055540_1002276 3300003792 Bacteria 10354
14 Ga0058862_12428665 3300004803 Unclassified 1415
15 Ga0070683_100141571 3300005329 Bacteria 2279
16 Ga0070670_100102481 3300005331 Bacteria 2465
17 Ga0070682_100014158 3300005337 Bacteria 4606
18 Ga0070682_100090665 3300005337 Bacteria 1999
19 Ga0070682_100211224 3300005337 Bacteria 1375
20 Ga0068868_100000529 3300005338 Bacteria 25593
21 Ga0068868_100072971 3300005338 Bacteria 2739
22 Ga0070660_100146561 3300005339 Bacteria 1896
23 Ga0070660_100244164 3300005339 Bacteria 1463
24 Ga0070691_10077817 3300005341 Bacteria 1619
25 Ga0070687_100033142 3300005343 Bacteria 2547
26 Ga0070687_100063030 3300005343 Bacteria 1964
27 Ga0070692_10035737 3300005345 Bacteria 2517
28 Ga0070668_100005441 3300005347 Bacteria 9451
29 Ga0070669_100023391 3300005353 Bacteria 4424
30 Ga0070671_100013019 3300005355 Bacteria 6704
31 Ga0070671_100228139 3300005355 Bacteria 1580
32 Ga0070674_100003430 3300005356 Bacteria 8897
33 Ga0070674_100038775 3300005356 Bacteria 3213
34 Ga0070688_100057587 3300005365 Bacteria 2443
35 Ga0070659_100040259 3300005366 Bacteria 3651
36 Ga0070667_100002267 3300005367 Bacteria 16931
37 Ga0070667_100048331 3300005367 Bacteria 3581
38 Ga0070667_100482840 3300005367 Bacteria 1134
39 Ga0070703_10000001 3300005406 Bacteria 202194
40 Ga0070709_10055022 3300005434 Bacteria 2511
41 Ga0070714_100003345 3300005435 Bacteria 11961
42 Ga0070714_100051812 3300005435 Bacteria 3500
43 Ga0070713_100004385 3300005436 Bacteria 9479
44 Ga0070713_100021003 3300005436 Bacteria 5013
45 Ga0070713_100021199 3300005436 Bacteria 4993
46 Ga0070713_100040216 3300005436 Bacteria 3800
47 Ga0070713_100078053 3300005436 Bacteria 2818
48 Ga0070710_10000900 3300005437 Bacteria 14236
49 Ga0070710_10001923 3300005437 Bacteria 9836
50 Ga0070710_10003412 3300005437 Bacteria 7527
51 Ga0070710_10027440 3300005437 Bacteria 3036
52 Ga0070710_10274469 3300005437 Bacteria 1092
53 Ga0070701_10003486 3300005438 Bacteria 6233
54 Ga0070701_10027888 3300005438 Bacteria 2771
55 Ga0070711_100001095 3300005439 Bacteria 14465
56 Ga0070711_100001607 3300005439 Bacteria 12467
57 Ga0070711_100261435 3300005439 Bacteria 1362
58 Ga0070705_100051171 3300005440 Bacteria 2407
59 Ga0070705_100275775 3300005440 Bacteria 1193
60 Ga0070700_100009233 3300005441 Bacteria 5406
61 Ga0070700_100017215 3300005441 Bacteria 4128
62 Ga0070700_100053837 3300005441 Bacteria 2513
63 Ga0070694_100122060 3300005444 Bacteria 1871
64 Ga0070694_100256217 3300005444 Bacteria 1326
65 Ga0070708_100001542 3300005445 Bacteria 17625
66 Ga0070708_100005610 3300005445 Bacteria 9950
67 Ga0070708_100309692 3300005445 Bacteria 1487
68 Ga0070663_100063252 3300005455 Bacteria 2671
69 Ga0070678_100009361 3300005456 Bacteria 5929
70 Ga0070678_100074709 3300005456 Bacteria 2548
71 Ga0070678_100194916 3300005456 Bacteria 1668
72 Ga0070662_100017040 3300005457 Bacteria 4889
73 Ga0070662_100188999 3300005457 Bacteria 1627
74 Ga0068867_100001323 3300005459 Bacteria 17157
75 Ga0068867_100070938 3300005459 Bacteria 2605
76 Ga0068867_100093721 3300005459 Bacteria 2283
77 Ga0070685_10178881 3300005466 Bacteria 1364
78 Ga0070706_100003990 3300005467 Bacteria 14367
79 Ga0070706_100010233 3300005467 Bacteria 8717
80 Ga0070706_100020205 3300005467 Bacteria 6137
81 Ga0070706_100143748 3300005467 Bacteria 2227
82 Ga0070706_100209148 3300005467 Bacteria 1822
83 Ga0070707_100000041 3300005468 Bacteria 111077
84 Ga0070707_100008503 3300005468 Bacteria 9535
85 Ga0070707_100011480 3300005468 Bacteria 8262
86 Ga0070707_100030744 3300005468 Bacteria 5115
87 Ga0070707_100209642 3300005468 Bacteria 1899
88 Ga0070698_100000082 3300005471 Bacteria 73573
89 Ga0070698_100001142 3300005471 Bacteria 29387
90 Ga0070698_100001184 3300005471 Bacteria 28906
91 Ga0070698_100001707 3300005471 Bacteria 24503
92 Ga0070698_100088595 3300005471 Bacteria 3080
93 Ga0070698_100225844 3300005471 Bacteria 1806
94 Ga0070698_100538532 3300005471 Bacteria 1107
95 Ga0070699_100000528 3300005518 Bacteria 36100
96 Ga0070699_100009389 3300005518 Bacteria 8473
97 Ga0070699_100024677 3300005518 Bacteria 5183
98 Ga0070679_100100836 3300005530 Bacteria 2873
99 Ga0070684_100007016 3300005535 Bacteria 8754
100 Ga0070684_100050062 3300005535 Bacteria 3628
101 Ga0070697_100205425 3300005536 Bacteria 1675
102 Ga0068853_100016775 3300005539 Bacteria 6034
103 Ga0068853_100098184 3300005539 Bacteria 2586
104 Ga0070672_100069003 3300005543 Bacteria 2805
105 Ga0070672_100207881 3300005543 Bacteria 1639
106 Ga0070686_100313683 3300005544 Bacteria 1167
107 Ga0070696_100003305 3300005546 Bacteria 10765
108 Ga0070696_100003753 3300005546 Bacteria 10149
109 Ga0070696_100047606 3300005546 Bacteria 2975
110 Ga0070693_100027531 3300005547 Bacteria 3082
111 Ga0070693_100039640 3300005547 Bacteria 2640
112 Ga0070665_100001745 3300005548 Bacteria 24881
113 Ga0070665_100015595 3300005548 Bacteria 7634
114 Ga0070665_100045725 3300005548 Bacteria 4396
115 Ga0070665_100307865 3300005548 Bacteria 1587
116 Ga0070665_100389553 3300005548 Bacteria 1401
117 Ga0070704_100000706 3300005549 Bacteria 16275
118 Ga0070704_100121270 3300005549 Bacteria 2009
119 Ga0068855_100055086 3300005563 Bacteria 4672
120 Ga0070664_100047870 3300005564 Bacteria 3614
121 Ga0068857_100011640 3300005577 Bacteria 7652
122 Ga0068854_100001286 3300005578 Bacteria 15104
123 Ga0068854_100030428 3300005578 Bacteria 3745
124 Ga0068854_100311600 3300005578 Bacteria 1277
125 Ga0068856_100004148 3300005614 Bacteria 14481
126 Ga0068856_100317942 3300005614 Bacteria 1574
127 Ga0070702_100057182 3300005615 Bacteria 2255
128 Ga0068852_100040065 3300005616 Bacteria 3950
129 Ga0068852_100276451 3300005616 Bacteria 1617
130 Ga0068859_100003134 3300005617 Bacteria 16809
131 Ga0068859_100093089 3300005617 Bacteria 3065
132 Ga0068859_100150089 3300005617 Bacteria 2406
133 Ga0068864_100083451 3300005618 Bacteria 2806
134 Ga0068864_100342077 3300005618 Bacteria 1410
135 Ga0068866_10000376 3300005718 Bacteria 21007
136 Ga0068866_10013060 3300005718 Bacteria 3633
137 Ga0068866_10020001 3300005718 Bacteria 3059
138 Ga0068861_100018600 3300005719 Bacteria 4951
139 Ga0068861_100048334 3300005719 Bacteria 3215
140 Ga0068863_100001514 3300005841 Bacteria 22958
141 Ga0068863_100308739 3300005841 Bacteria 1535
142 Ga0068858_100002465 3300005842 Bacteria 18668
143 Ga0068858_100009962 3300005842 Bacteria 9028
144 Ga0068858_100311764 3300005842 Bacteria 1502
145 Ga0068858_100445074 3300005842 Bacteria 1248
146 Ga0068860_100025928 3300005843 Bacteria 5656
147 Ga0068860_100307401 3300005843 Bacteria 1554
148 Ga0068862_100002116 3300005844 Bacteria 17897
149 Ga0068862_100246674 3300005844 Bacteria 1626
150 Ga0068862_100291228 3300005844 Bacteria 1499
151 Ga0081455_10001614 3300005937 Bacteria 27559
152 Ga0081540_1000505 3300005983 Bacteria 38435
153 Ga0081539_10001504 3300005985 Bacteria 39371
154 Ga0070717_10018280 3300006028 Bacteria 5470
155 Ga0070717_10034026 3300006028 Bacteria 4116
156 Ga0075365_10005332 3300006038 Bacteria 6922
157 Ga0075365_10015384 3300006038 Bacteria 4627
158 Ga0075365_10152450 3300006038 Bacteria 1608
159 Ga0075365_10179843 3300006038 Bacteria 1478
160 Ga0075363_100000787 3300006048 Bacteria 10932
161 Ga0075363_100002644 3300006048 Bacteria 7388
162 Ga0075363_100014116 3300006048 Bacteria 3893
163 Ga0075363_100044130 3300006048 Bacteria 2361
164 Ga0075363_100053215 3300006048 Bacteria 2163
165 Ga0075364_10000184 3300006051 Bacteria 28604
166 Ga0075364_10006965 3300006051 Bacteria 6679
167 Ga0075364_10040448 3300006051 Bacteria 3024
168 Ga0070715_10008358 3300006163 Bacteria 3605
169 Ga0070715_10010496 3300006163 Bacteria 3303
170 Ga0070715_10010773 3300006163 Bacteria 3270
171 Ga0070716_100002661 3300006173 Bacteria 8264
172 Ga0070716_100004017 3300006173 Bacteria 6984
173 Ga0070716_100015247 3300006173 Bacteria 3945
174 Ga0070712_100001062 3300006175 Bacteria 16596
175 Ga0070712_100017689 3300006175 Bacteria 4618
176 Ga0070712_100109699 3300006175 Bacteria 2057
177 Ga0070712_100263628 3300006175 Bacteria 1381
178 Ga0075362_10001354 3300006177 Bacteria 7756
179 Ga0075367_10001919 3300006178 Bacteria 9229
180 Ga0075369_10001695 3300006186 Bacteria 7622
181 Ga0075369_10010682 3300006186 Bacteria 3596
182 Ga0075369_10047085 3300006186 Bacteria 1859
183 Ga0075366_10018409 3300006195 Bacteria 4031
184 Ga0097621_100015140 3300006237 Bacteria 5795
185 Ga0075370_10008783 3300006353 Bacteria 5215
186 Ga0075370_10127936 3300006353 Bacteria 1481
187 Ga0068871_100259103 3300006358 Bacteria 1517
188 Ga0075428_100051463 3300006844 Bacteria 4516
189 Ga0075434_100003943 3300006871 Bacteria 13290
190 Ga0068865_100000828 3300006881 Bacteria 17443
191 Ga0068865_100011634 3300006881 Bacteria 5514
192 Ga0068865_100030675 3300006881 Bacteria 3578
193 Ga0068865_100053468 3300006881 Bacteria 2802
194 Ga0097620_100003133 3300006931 Bacteria 16809
195 Ga0097620_100093087 3300006931 Bacteria 3065
196 Ga0097620_100150072 3300006931 Bacteria 2406
197 Ga0075435_100007491 3300007076 Bacteria 7786
198 Ga0075435_100079477 3300007076 Bacteria 2692
199 Ga0105240_10420787 3300009093 Bacteria 1501
200 Ga0111539_10241974 3300009094 Bacteria 2101
201 Ga0105245_10003220 3300009098 Bacteria 14625
202 Ga0105245_10060787 3300009098 Bacteria 3403
203 Ga0105245_10571908 3300009098 Bacteria 1154
204 Ga0105247_10004659 3300009101 Bacteria 8741
205 Ga0105247_10031108 3300009101 Bacteria 3238
206 Ga0114129_10039891 3300009147 Bacteria 6623
207 Ga0105243_10003249 3300009148 Bacteria 13257
208 Ga0105243_10007191 3300009148 Bacteria 8556
209 Ga0105243_10028694 3300009148 Bacteria 4273
210 Ga0105241_10019951 3300009174 Bacteria 4948
211 Ga0105242_10000620 3300009176 Bacteria 27832
212 Ga0105242_10232610 3300009176 Bacteria 1652
213 Ga0105242_10396592 3300009176 Bacteria 1287
214 Ga0105242_10644314 3300009176 Bacteria 1029
215 Ga0105248_10008918 3300009177 Bacteria 11025
216 Ga0105248_10044839 3300009177 Bacteria 4960
217 Ga0105248_10702917 3300009177 Bacteria 1141
218 Ga0105237_10000178 3300009545 Bacteria 89960
219 Ga0105237_10002564 3300009545 Bacteria 22427
220 Ga0105237_10034235 3300009545 Bacteria 5144
221 Ga0105237_10666168 3300009545 Bacteria 1047
222 Ga0105249_10000767 3300009553 Bacteria 28791
223 Ga0105249_10181192 3300009553 Bacteria 2050
224 Ga0105249_10413630 3300009553 Bacteria 1381
225 Ga0105249_10430988 3300009553 Bacteria 1354
226 Ga0105239_10007516 3300010375 Bacteria 12498
227 Ga0105239_10007818 3300010375 Bacteria 12230
228 Ga0105239_10030663 3300010375 Bacteria 5914
229 Ga0105246_10049630 3300011119 Bacteria 2875
230 Ga0105246_10390088 3300011119 Bacteria 1153
231 Ga0157371_10134550 3300013102 Bacteria 1760
232 Ga0157370_10413230 3300013104 Bacteria 1242
233 Ga0157369_10239525 3300013105 Bacteria 1895
234 Ga0157369_10466858 3300013105 Bacteria 1307
235 Ga0157374_10041784 3300013296 Bacteria 4227
236 Ga0157374_10047571 3300013296 Bacteria 3977
237 Ga0157378_10001690 3300013297 Bacteria 19860
238 Ga0163162_10003614 3300013306 Bacteria 14814
239 Ga0163162_10026392 3300013306 Bacteria 5740
240 Ga0163162_10112849 3300013306 Bacteria 2817
241 Ga0157372_10026882 3300013307 Bacteria 6264
242 Ga0157372_10071040 3300013307 Bacteria 3919
243 Ga0157375_10003452 3300013308 Bacteria 13692
244 Ga0157375_10320237 3300013308 Bacteria 1715
245 Ga0157375_10786924 3300013308 Bacteria 1101
246 Ga0163163_10124419 3300014325 Bacteria 2615
247 Ga0157380_10003813 3300014326 Bacteria 10374
248 Ga0157380_10155253 3300014326 Bacteria 1983
249 Ga0157380_10261497 3300014326 Bacteria 1572
250 Ga0157377_10007912 3300014745 Bacteria 5159
251 Ga0157379_10037357 3300014968 Bacteria 4330
252 Ga0157379_10133436 3300014968 Bacteria 2236
253 Ga0157376_10072953 3300014969 Bacteria 2921
254 Ga0157376_10192746 3300014969 Bacteria 1870
255 Ga0213875_10000604 3300021388 Bacteria 29093
256 Ga0209673_1008102 3300025273 Bacteria 4724
257 Ga0209051_1000528 3300025303 Bacteria 47444
258 Ga0209051_1001208 3300025303 Bacteria 23322
259 Ga0209051_1006114 3300025303 Bacteria 6849
260 Ga0209051_1008439 3300025303 Bacteria 5451
261 Ga0209051_1028400 3300025303 Bacteria 2210
262 Ga0207653_10000004 3300025885 Bacteria 263142
263 Ga0207692_10001870 3300025898 Bacteria 7987
264 Ga0207692_10019953 3300025898 Bacteria 3040
265 Ga0207692_10022310 3300025898 Bacteria 2911
266 Ga0207692_10022696 3300025898 Bacteria 2892
267 Ga0207642_10002962 3300025899 Bacteria 5313
268 Ga0207642_10032954 3300025899 Bacteria 2187
269 Ga0207710_10043734 3300025900 Bacteria 1993
270 Ga0207688_10000352 3300025901 Bacteria 21384
271 Ga0207688_10014587 3300025901 Bacteria 4269
272 Ga0207688_10045040 3300025901 Bacteria 2460
273 Ga0207688_10178121 3300025901 Bacteria 1267
274 Ga0207680_10022427 3300025903 Bacteria 3433
275 Ga0207685_10004410 3300025905 Bacteria 3573
276 Ga0207685_10024446 3300025905 Bacteria 2071
277 Ga0207699_10002495 3300025906 Bacteria 8691
278 Ga0207699_10012397 3300025906 Bacteria 4336
279 Ga0207645_10179654 3300025907 Bacteria 1388
280 Ga0207684_10000339 3300025910 Bacteria 65102
281 Ga0207684_10000911 3300025910 Bacteria 33666
282 Ga0207684_10083146 3300025910 Bacteria 2726
283 Ga0207684_10119551 3300025910 Bacteria 2258
284 Ga0207684_10170973 3300025910 Bacteria 1873
285 Ga0207684_10212783 3300025910 Bacteria 1668
286 Ga0207684_10507067 3300025910 Bacteria 1034
287 Ga0207671_10008270 3300025914 Bacteria 8850
288 Ga0207671_10019320 3300025914 Bacteria 5211
289 Ga0207671_10092022 3300025914 Bacteria 2286
290 Ga0207693_10001171 3300025915 Bacteria 23404
291 Ga0207693_10001690 3300025915 Bacteria 19437
292 Ga0207693_10072192 3300025915 Bacteria 2703
293 Ga0207693_10164815 3300025915 Bacteria 1744
294 Ga0207693_10424985 3300025915 Bacteria 1039
295 Ga0207663_10005265 3300025916 Bacteria 6513
296 Ga0207663_10017122 3300025916 Bacteria 4032
297 Ga0207663_10139692 3300025916 Bacteria 1686
298 Ga0207663_10159109 3300025916 Bacteria 1592
299 Ga0207662_10050271 3300025918 Bacteria 2476
300 Ga0207646_10000061 3300025922 Bacteria 151425
301 Ga0207646_10004855 3300025922 Bacteria 14404
302 Ga0207646_10007478 3300025922 Bacteria 11089
303 Ga0207646_10020298 3300025922 Bacteria 6158
304 Ga0207681_10034439 3300025923 Bacteria 3330
305 Ga0207681_10415696 3300025923 Bacteria 1089
306 Ga0207687_10001147 3300025927 Bacteria 18035
307 Ga0207687_10176759 3300025927 Bacteria 1651
308 Ga0207687_10416720 3300025927 Bacteria 1108
309 Ga0207700_10006098 3300025928 Bacteria 7263
310 Ga0207700_10020021 3300025928 Bacteria 4534
311 Ga0207700_10025193 3300025928 Bacteria 4128
312 Ga0207700_10029504 3300025928 Bacteria 3871
313 Ga0207700_10078194 3300025928 Bacteria 2572
314 Ga0207700_10179931 3300025928 Bacteria 1770
315 Ga0207700_10181062 3300025928 Bacteria 1764
316 Ga0207700_10378642 3300025928 Bacteria 1237
317 Ga0207664_10002329 3300025929 Bacteria 12548
318 Ga0207664_10002605 3300025929 Bacteria 11947
319 Ga0207664_10024393 3300025929 Bacteria 4544
320 Ga0207664_10032064 3300025929 Bacteria 4025
321 Ga0207664_10181647 3300025929 Bacteria 1806
322 Ga0207664_10474410 3300025929 Bacteria 1119
323 Ga0207644_10005208 3300025931 Bacteria 8493
324 Ga0207690_10053908 3300025932 Bacteria 2701
325 Ga0207706_10001128 3300025933 Bacteria 27189
326 Ga0207706_10019781 3300025933 Bacteria 6054
327 Ga0207709_10007186 3300025935 Bacteria 6215
328 Ga0207709_10184937 3300025935 Bacteria 1475
329 Ga0207709_10547072 3300025935 Bacteria 910
330 Ga0207670_10147758 3300025936 Bacteria 1740
331 Ga0207704_10000377 3300025938 Bacteria 20506
332 Ga0207704_10185174 3300025938 Bacteria 1509
333 Ga0207665_10001670 3300025939 Bacteria 14929
334 Ga0207665_10005772 3300025939 Bacteria 8231
335 Ga0207665_10020830 3300025939 Bacteria 4311
336 Ga0207665_10099187 3300025939 Bacteria 2031
337 Ga0207691_10040532 3300025940 Bacteria 4302
338 Ga0207691_10053456 3300025940 Bacteria 3687
339 Ga0207711_10051435 3300025941 Bacteria 3528
340 Ga0207711_10100926 3300025941 Bacteria 2553
341 Ga0207689_10009916 3300025942 Bacteria 8213
342 Ga0207661_10003465 3300025944 Bacteria 10957
343 Ga0207661_10124084 3300025944 Bacteria 2203
344 Ga0207661_10370158 3300025944 Bacteria 1295
345 Ga0207712_10062243 3300025961 Bacteria 2652
346 Ga0207712_10518163 3300025961 Bacteria 1021
347 Ga0207668_10029780 3300025972 Bacteria 3581
348 Ga0207668_10081132 3300025972 Bacteria 2352
349 Ga0207640_10003409 3300025981 Bacteria 8561
350 Ga0207658_10014963 3300025986 Bacteria 5319
351 Ga0207658_10034788 3300025986 Bacteria 3603
352 Ga0207677_10038154 3300026023 Bacteria 3147
353 Ga0207677_10044279 3300026023 Bacteria 2964
354 Ga0207677_10210639 3300026023 Bacteria 1552
355 Ga0207677_10236837 3300026023 Bacteria 1474
356 Ga0207703_10014135 3300026035 Bacteria 6223
357 Ga0207703_10055546 3300026035 Bacteria 3222
358 Ga0207639_10034426 3300026041 Bacteria 3744
359 Ga0207639_10224493 3300026041 Bacteria 1624
360 Ga0207678_10003778 3300026067 Bacteria 13614
361 Ga0207678_10016407 3300026067 Bacteria 6503
362 Ga0207678_10114208 3300026067 Bacteria 2304
363 Ga0207678_10414553 3300026067 Bacteria 1167
364 Ga0207708_10001592 3300026075 Bacteria 16942
365 Ga0207708_10005234 3300026075 Bacteria 9557
366 Ga0207708_10006707 3300026075 Bacteria 8516
367 Ga0207708_10009373 3300026075 Bacteria 7248
368 Ga0207702_10002286 3300026078 Bacteria 18386
369 Ga0207702_10338627 3300026078 Bacteria 1437
370 Ga0207641_10003507 3300026088 Bacteria 13886
371 Ga0207641_10134177 3300026088 Bacteria 2226
372 Ga0207648_10001355 3300026089 Bacteria 27091
373 Ga0207648_10026700 3300026089 Bacteria 5129
374 Ga0207648_10116894 3300026089 Bacteria 2344
375 Ga0207676_10154531 3300026095 Bacteria 1980
376 Ga0207674_10019592 3300026116 Bacteria 7326
377 Ga0207675_100006054 3300026118 Bacteria 11511
378 Ga0207675_100015022 3300026118 Bacteria 7224
379 Ga0207683_10000201 3300026121 Bacteria 51559
380 Ga0207683_10027425 3300026121 Bacteria 4922
381 Ga0207428_10127037 3300027907 Bacteria 1952
382 Ga0268266_10045864 3300028379 Bacteria 3741
383 Ga0268266_10142200 3300028379 Bacteria 2154
384 Ga0268266_10174708 3300028379 Bacteria 1952
385 Ga0268266_10272479 3300028379 Bacteria 1572
386 Ga0268264_10031711 3300028381 Bacteria 4333
387 Ga0268264_10209352 3300028381 Bacteria 1789
388 Ga0265337_1000027 3300028556 Bacteria 68392
389 Ga0265326_10001234 3300028558 Bacteria 9119
390 Ga0265319_1001055 3300028563 Bacteria 17217
391 Ga0265334_10000773 3300028573 Bacteria 16014
392 Ga0265318_10099600 3300028577 Bacteria 1069
393 Ga0265323_10082254 3300028653 Bacteria 1086
394 Ga0265322_10001284 3300028654 Bacteria 8433
395 Ga0265336_10002288 3300028666 Bacteria 8003
396 Ga0265336_10019643 3300028666 Bacteria 2178
397 Ga0265338_10000227 3300028800 Bacteria 104795
398 Ga0265338_10000868 3300028800 Bacteria 51299
399 Ga0265338_10007886 3300028800 Bacteria 13062
400 Ga0265324_10004386 3300029957 Bacteria 6400
401 Ga0265332_10001185 3300031238 Bacteria 15099
402 Ga0265320_10049797 3300031240 Bacteria 2038
403 Ga0265340_10005777 3300031247 Bacteria 6842
404 Ga0265316_10007705 3300031344 Bacteria 10091
405 Ga0265313_10010516 3300031595 Bacteria 5839
406 Ga0265314_10010105 3300031711 Bacteria 7910
407 Ga0265342_10012177 3300031712 Bacteria 5834
408 Ga0307406_10073259 3300031901 Bacteria 2251
409 Ga0307414_10208689 3300032004 Bacteria 1595
410 Ga0373958_0010115 3300034819 Bacteria 1567
411 Ga0373926_0008701 3300035083 Bacteria 3378
412 Ga0373926_0050445 3300035083 Bacteria 1500
413 Ga0373945_0013583 3300035116 Bacteria 2719
414 Ga0373953_0103639 3300035117 Bacteria 1199
415 Ga0373954_0006920 3300035118 Bacteria 4951
416 Ga0373956_0003259 3300035119 Bacteria 6548
417 Ga0373957_0059689 3300035120 Bacteria 1475
418 Ga0373957_0159239 3300035120 Bacteria 930
419 Ga0373943_0001737 3300035170 Bacteria 9877
420 Ga0373943_0028168 3300035170 Bacteria 2645
421 Ga0373955_0037233 3300035172 Bacteria 2586
422 Ga0373955_0079802 3300035172 Bacteria 1847
423 Ga0373955_0173678 3300035172 Bacteria 1276
424 Ga0373931_0084987 3300035691 Bacteria 1753
425 Ga0373935_0012226 3300035692 Bacteria 5161
426 Ga0373935_0039727 3300035692 Bacteria 2950
427 Ga0373935_0116138 3300035692 Bacteria 1782
428 Ga0373935_0145256 3300035692 Bacteria 1605
429 Ga0373927_0017008 3300035695 Bacteria 4792
430 Ga0373927_0041032 3300035695 Bacteria 3001
431 Ga0373933_0033929 3300035724 Bacteria 2971
432 Ga0373933_0041664 3300035724 Bacteria 2711
433 Ga0373933_0080402 3300035724 Bacteria 1998
434 Ga0373933_0173809 3300035724 Bacteria 1372
435 Ga0373947_0000014 3300035725 Bacteria 135749
436 Ga0373947_0126368 3300035725 Bacteria 1628
437 Ga0373937_0058434 3300036401 Bacteria 3543
438 Ga0373925_0021369 3300037068 Bacteria 4714
439 Ga0373925_0134256 3300037068 Bacteria 1932
440 Ga0373925_0407596 3300037068 Bacteria 1109
441 Ga0395899_0074684 3300037312 Bacteria 2476
442 Ga0395899_0149726 3300037312 Bacteria 1655
443 Ga0395900_0031704 3300037418 Bacteria 5432
444 Ga0395900_0059527 3300037418 Bacteria 3932
445 Ga0395900_0272442 3300037418 Bacteria 1687
446 Ga0395900_0601770 3300037418 Bacteria 1040
447 Ga0395898_0046052 3300037466 Bacteria 4285
448 Ga0395898_0185655 3300037466 Bacteria 1987
449 Ga0395898_0349404 3300037466 Bacteria 1410
450 Ga0395905_0041489 3300037471 Bacteria 4318
451 Ga0436364_0609957 3300037853 Bacteria 1113
452 Ga0436364_0788967 3300037853 Bacteria 3633
453 Ga0436364_1435297 3300037853 Bacteria 74939
454 Ga0436364_1520571 3300037853 Bacteria 46168
455 Ga0395901_0015280 3300038443 Bacteria 7811
456 Ga0395901_0068340 3300038443 Bacteria 3701
457 Ga0436365_0643539 3300039437 Unclassified 2221
458 Ga0439461_0002575 3300041410 Bacteria 2914
459 Ga0439466_0006609 3300041411 Bacteria 4402
460 Ga0439465_0000349 3300041413 Bacteria 13257
461 Ga0439465_0009359 3300041413 Bacteria 3085
462 Ga0451793_1294871 3300041452 Bacteria 1816
463 Ga0451795_0883130 3300041456 Bacteria 1862
464 Ga0451837_0131201 3300041494 Bacteria 1431
465 Ga0439431_0000859 3300041997 Bacteria 6579
466 Ga0439445_0004897 3300042004 Bacteria 3043
467 Ga0439434_0010181 3300042435 Bacteria 2771
468 Ga0439435_0011347 3300042436 Bacteria 2137
469 Ga0466972_0007973 3300044658 Bacteria 5309
470 Ga0466972_0086532 3300044658 Bacteria 1489
471 Ga0466965_0002177 3300044683 Bacteria 8246
472 Ga0466965_0090109 3300044683 Bacteria 1559
473 Ga0466963_0021480 3300044694 Bacteria 4073
474 Ga0466963_0150088 3300044694 Bacteria 1618
475 Ga0466968_0001088 3300044735 Bacteria 9619
476 Ga0466970_0016640 3300044765 Bacteria 3794
477 Ga0466957_0020512 3300044842 Bacteria 3888
478 Ga0466957_0108098 3300044842 Bacteria 1761
479 Ga0466960_0042012 3300044901 Bacteria 2168
480 Ga0466959_0098581 3300045049 Bacteria 2093
481 Ga0466967_0030898 3300045976 Bacteria 4501
482 Ga0466967_0036069 3300045976 Bacteria 4218
483 Ga0466967_0325726 3300045976 Bacteria 1483
484 Ga0466967_0609884 3300045976 Bacteria 1078
485 Ga0495603_0001901 3300046455 Bacteria 12324
486 Ga0495603_0024918 3300046455 Bacteria 3618
487 Ga0495629_0012234 3300046459 Bacteria 6215
488 Ga0495629_0023150 3300046459 Bacteria 4426
489 Ga0495629_0086930 3300046459 Bacteria 2181
490 Ga0495638_0002264 3300046460 Bacteria 15935
491 Ga0495641_0010636 3300046461 Bacteria 5310
492 Ga0495651_0007208 3300046462 Bacteria 8501
493 Ga0495651_0126444 3300046462 Bacteria 1871
494 Ga0495653_0004538 3300046463 Bacteria 11222
495 Ga0495653_0020117 3300046463 Bacteria 5410
496 Ga0495653_0236867 3300046463 Bacteria 1218
497 Ga0495582_0021817 3300046473 Bacteria 3503
498 Ga0495639_0045890 3300046475 Bacteria 1977
499 Ga0495639_0060341 3300046475 Bacteria 1737
500 Ga0495639_0065782 3300046475 Bacteria 1668
501 Ga0495662_0001666 3300046476 Bacteria 11070
502 Ga0495664_0073805 3300046477 Bacteria 2040
503 Ga0495594_0020272 3300046499 Bacteria 3540
504 Ga0495607_0074327 3300046501 Bacteria 1887
505 Ga0495583_0086756 3300046506 Bacteria 1353
506 Ga0495606_0083170 3300046507 Bacteria 1985
507 Ga0495608_0002859 3300046511 Bacteria 12373
508 Ga0495608_0010194 3300046511 Bacteria 6558
509 Ga0495628_0203841 3300046516 Bacteria 1489
510 Ga0495630_0009396 3300046517 Bacteria 7025
511 Ga0495630_0030023 3300046517 Bacteria 4042
512 Ga0495630_0099023 3300046517 Bacteria 2205
513 Ga0495631_0100388 3300046518 Bacteria 1246
514 Ga0495648_0005458 3300046524 Bacteria 10554
515 Ga0495666_0022153 3300046526 Bacteria 3146
516 Ga0495666_0033626 3300046526 Bacteria 2504
517 Ga0495666_0091765 3300046526 Bacteria 1433
518 Ga0495652_0003641 3300046529 Bacteria 15088
519 Ga0495652_0171569 3300046529 Bacteria 1674
520 Ga0495654_0096373 3300046530 Bacteria 1367
521 Ga0495665_0013989 3300046531 Bacteria 4333
522 Ga0495665_0168840 3300046531 Bacteria 1139
523 Ga0495640_0074613 3300046533 Bacteria 2267
524 Ga0495640_0102017 3300046533 Bacteria 1883
525 Ga0495586_0023326 3300046535 Bacteria 3304
526 Ga0495645_0032170 3300046543 Bacteria 3825
527 Ga0495645_0347442 3300046543 Bacteria 956
528 Ga0495667_0000908 3300046559 Bacteria 19115
529 Ga0495667_0001764 3300046559 Bacteria 14367
530 Ga0495634_0048446 3300046642 Bacteria 2861
531 Ga0495634_0093038 3300046642 Bacteria 1955
532 Ga0495635_0011752 3300046663 Bacteria 6139
533 Ga0495635_0025895 3300046663 Bacteria 4085
534 Ga0495635_0312367 3300046663 Bacteria 1053
535 Ga0495659_0070679 3300046664 Bacteria 1307
536 Ga0495588_0079615 3300046674 Bacteria 1710
537 Ga0495588_0106290 3300046674 Bacteria 1477
538 Ga0495657_0002947 3300046675 Bacteria 14105
539 Ga0495657_0007099 3300046675 Bacteria 8687
540 Ga0495599_0094061 3300046678 Bacteria 1869
541 Ga0495623_0022640 3300046679 Bacteria 4057
542 Ga0495647_0020032 3300046681 Bacteria 2398
543 Ga0495658_0103799 3300046683 Bacteria 1700
544 Ga0495658_0211320 3300046683 Bacteria 1212
545 Ga0495613_0035592 3300046689 Bacteria 3694
546 Ga0495613_0333621 3300046689 Bacteria 1045
547 Ga0495671_0071222 3300046692 Bacteria 1708
548 Ga0495589_0158741 3300046794 Bacteria 1078
549 Ga0495600_0009939 3300046809 Bacteria 5894
550 Ga0495600_0016381 3300046809 Bacteria 4703
551 Ga0495581_0006220 3300047315 Bacteria 6924
552 Ga0495604_0202885 3300047317 Bacteria 1374
553 Ga0495604_0206667 3300047317 Bacteria 1358
554 Ga0495674_0013586 3300047319 Bacteria 7649
555 Ga0495672_0030900 3300047320 Bacteria 3350
556 Ga0495676_0040298 3300047321 Bacteria 3856
557 Ga0495676_0255463 3300047321 Bacteria 1194
558 Ga0495680_0001586 3300047322 Bacteria 24314
559 Ga0495680_0009868 3300047322 Bacteria 8558
560 Ga0495680_0029597 3300047322 Bacteria 4483
561 Ga0495675_0049564 3300047444 Bacteria 2669
562 Ga0495675_0069594 3300047444 Bacteria 2222
563 Ga0495673_0001205 3300047469 Bacteria 21534
564 Ga0495684_0009471 3300047471 Bacteria 7516
565 Ga0495684_0040633 3300047471 Bacteria 3565
566 Ga0495684_0102820 3300047471 Bacteria 2159
567 Ga0495684_0126045 3300047471 Bacteria 1926
568 Ga0495686_0003330 3300047472 Bacteria 14025
569 Ga0495593_0009218 3300047673 Bacteria 5722
570 Ga0495593_0010942 3300047673 Bacteria 5225
571 Ga0495602_0036396 3300048088 Bacteria 4581
572 Ga0495602_0320239 3300048088 Bacteria 1128
573 Ga0495614_0004289 3300048089 Bacteria 6425
574 Ga0495626_0067444 3300048091 Bacteria 1616
575 Ga0496100_0002367 3300048903 Bacteria 9542
576 Ga0496100_0004799 3300048903 Bacteria 7220
577 Ga0496100_0009450 3300048903 Bacteria 5482
578 Ga0496100_0046837 3300048903 Bacteria 2783
579 Ga0496100_0308196 3300048903 Bacteria 1186
580 Ga0496101_0000021 3300048904 Bacteria 217090
581 Ga0496101_0015217 3300048904 Bacteria 5178
582 Ga0496101_0025140 3300048904 Bacteria 4128
583 Ga0496101_0058904 3300048904 Bacteria 2783
584 Ga0496101_0105980 3300048904 Bacteria 2110
585 Ga0496102_0000001 3300048905 Bacteria 873433
586 Ga0496102_0000590 3300048905 Bacteria 38332
587 Ga0496102_0001309 3300048905 Bacteria 22360
588 Ga0496102_0050731 3300048905 Bacteria 3779
589 Ga0496102_0379083 3300048905 Bacteria 1331
590 Ga0496103_0000007 3300048906 Bacteria 354915
591 Ga0496103_0019054 3300048906 Bacteria 4120
592 Ga0496103_0266308 3300048906 Bacteria 1102
593 Ga0496104_0010504 3300048907 Bacteria 8271
594 Ga0496104_0040855 3300048907 Bacteria 4348
595 Ga0496104_0080994 3300048907 Bacteria 3095
596 Ga0496104_0082510 3300048907 Bacteria 3065
597 Ga0496104_0134453 3300048907 Bacteria 2375
598 Ga0496105_0023961 3300048908 Bacteria 4957
599 Ga0496106_0003195 3300048909 Bacteria 12259
600 Ga0496106_0100080 3300048909 Bacteria 2248
601 Ga0496106_0237974 3300048909 Bacteria 1454
602 Ga0496107_0000321 3300048910 Bacteria 25887
603 Ga0496107_0003559 3300048910 Bacteria 10431
604 Ga0496107_0011486 3300048910 Bacteria 6170
605 Ga0496107_0073063 3300048910 Bacteria 2494
606 Ga0496108_0000645 3300048911 Bacteria 27126
607 Ga0496108_0021599 3300048911 Bacteria 5289
608 Ga0496109_0016603 3300048912 Bacteria 6438
609 Ga0496109_0053112 3300048912 Bacteria 3694
610 Ga0496110_0034997 3300048913 Bacteria 4354
611 Ga0496110_0040938 3300048913 Bacteria 4041
612 Ga0496110_0292815 3300048913 Bacteria 1483
613 Ga0496111_0051875 3300048914 Bacteria 2962
614 Ga0496111_0083805 3300048914 Bacteria 2330
615 Ga0496111_0164329 3300048914 Bacteria 1648
616 Ga0496112_0051425 3300048915 Bacteria 4042
617 Ga0496113_0229290 3300048916 Bacteria 1481
618 Ga0496113_0234782 3300048916 Bacteria 1463
619 Ga0496114_0000495 3300048917 Bacteria 28787
620 Ga0496114_0002288 3300048917 Bacteria 14597
621 Ga0496114_0041127 3300048917 Bacteria 3830
622 Ga0496114_0088783 3300048917 Bacteria 2622
623 Ga0496114_0097635 3300048917 Bacteria 2503
624 Ga0496114_0220089 3300048917 Bacteria 1666
625 Ga0496115_0003085 3300048918 Bacteria 11965
626 Ga0496115_0014339 3300048918 Bacteria 6000
627 Ga0496115_0077120 3300048918 Bacteria 2710
628 Ga0496115_0105139 3300048918 Bacteria 2317
629 Ga0496116_0000018 3300048919 Bacteria 545877
630 Ga0496116_0000166 3300048919 Bacteria 133474
631 Ga0496117_0000015 3300048920 Bacteria 583316
632 Ga0496118_0000012 3300048921 Bacteria 583316
633 Ga0496119_0026660 3300048922 Bacteria 3998
634 Ga0496120_0006298 3300048923 Bacteria 9148
635 Ga0496121_0000177 3300048924 Bacteria 141456
636 Ga0496125_0126667 3300048928 Bacteria 1808
637 Ga0496126_0001113 3300048929 Bacteria 45012
638 Ga0501033_0243681 3300049570 Bacteria 1275
639 Ga0501034_0033607 3300049571 Bacteria 5201
640 Ga0501034_0154413 3300049571 Bacteria 2270
641 Ga0501036_0222418 3300049572 Bacteria 1585
642 Ga0501036_0423567 3300049572 Bacteria 1110
643 Ga0501039_0120633 3300049575 Bacteria 2055
644 Ga0501042_0127505 3300049578 Bacteria 1833
645 Ga0501047_0349300 3300049581 Bacteria 1316
646 Ga0501047_0392040 3300049581 Bacteria 1222
647 Ga0501048_0139082 3300049582 Bacteria 1717
648 Ga0501067_0004530 3300049583 Bacteria 7678
649 Ga0501067_0012811 3300049583 Bacteria 4644
650 Ga0501068_0010913 3300049584 Bacteria 5113
651 Ga0501068_0133839 3300049584 Bacteria 1551
652 Ga0501070_0097237 3300049586 Bacteria 2435
653 Ga0501071_0007468 3300049587 Bacteria 7182
654 Ga0501072_0064713 3300049588 Bacteria 2883
655 Ga0501073_0045442 3300049589 Bacteria 3092
656 Ga0501073_0046934 3300049589 Bacteria 3036
657 Ga0501074_0004203 3300049590 Bacteria 10289
658 Ga0501074_0034406 3300049590 Bacteria 3672
659 Ga0501077_0031697 3300049593 Bacteria 3363
660 Ga0501077_0060270 3300049593 Bacteria 2409
661 Ga0501257_006903 3300049686 Bacteria 2527
662 Ga0501080_0004291 3300049742 Bacteria 12654
663 Ga0501083_0016126 3300049744 Bacteria 5233
664 Ga0501083_0055094 3300049744 Bacteria 2667
665 nmdc:mga03683_3552_c1 3300050489 Bacteria 5050
666 nmdc:mga03n38_107121_c1 3300050490 Bacteria 1356
667 nmdc:mga03n38_21081_c1 3300050490 Bacteria 2617
668 nmdc:mga03n38_48851_c1 3300050490 Bacteria 1879
669 nmdc:mga03n38_7306_c1 3300050490 Bacteria 3903
670 nmdc:mga00v17_135666_c1 3300050491 Bacteria 1575
671 nmdc:mga00v17_17742_c2 3300050491 Bacteria 3508
672 nmdc:mga00v17_56229_c1 3300050491 Bacteria 2405
673 nmdc:mga00v17_5888_c1 3300050491 Bacteria 6476
674 nmdc:mga0yw44_20758_c1 3300050492 Bacteria 3652
675 nmdc:mga0yw44_250629_c1 3300050492 Bacteria 1178
676 nmdc:mga0yw44_361372_c1 3300050492 Bacteria 978
677 nmdc:mga0k408_17139_c1 3300050493 Bacteria 4031
678 nmdc:mga06z11_20869_c1 3300050494 Bacteria 3034
679 nmdc:mga06z11_300570_c1 3300050494 Bacteria 954
680 nmdc:mga06z11_4051_c1 3300050494 Bacteria 5725
681 nmdc:mga07m45_345017_c1 3300050496 Bacteria 865
682 nmdc:mga07m45_35430_c1 3300050496 Bacteria 2775
683 nmdc:mga05p37_47560_c1 3300050507 Bacteria 5275
684 nmdc:mga0n895_17799_c1 3300050512 Bacteria 6560
685 nmdc:mga0n895_706032_c1 3300050512 Bacteria 1004
686 nmdc:mga0rr50_3260_c1 3300050513 Bacteria 9300
687 nmdc:mga0a205_2637_c1 3300050515 Bacteria 15841
688 nmdc:mga0sz30_10406_c1 3300050516 Bacteria 3564
689 nmdc:mga0sz30_29531_c1 3300050516 Bacteria 2261
690 nmdc:mga0sz30_3201_c1 3300050516 Bacteria 5873
691 nmdc:mga0sz30_56394_c1 3300050516 Bacteria 1454
692 Ga0495601_0016295 3300053077 Bacteria 4503
693 Ga0495601_0070868 3300053077 Bacteria 2225
694 Ga0495612_0003214 3300053078 Bacteria 6774
695 Ga0500635_0001094 3300053080 Bacteria 6484
696 Ga0495619_0044877 3300053085 Bacteria 2902
697 Ga0495619_0223465 3300053085 Bacteria 1304
698 Ga0500643_001154 3300053087 Bacteria 15747
699 Ga0500643_001862 3300053087 Bacteria 11500
700 Ga0500643_006474 3300053087 Bacteria 4886
701 Ga0500556_0001572 3300053104 Bacteria 9240
702 Ga0500562_017191 3300053108 Bacteria 1863
703 Ga0500595_005721 3300053119 Bacteria 5384
704 Ga0500652_009427 3300053131 Bacteria 3302
705 Ga0500616_0011465 3300053153 Bacteria 5232
706 Ga0500645_000035 3300053730 Bacteria 113679
707 Ga0501084_0077695 3300054114 Bacteria 2783
708 Ga0501084_0234005 3300054114 Bacteria 1551
709 Ga0587088_015224 3300059508 Bacteria 1209
710 Ga0501082_0022336 3300060353 Bacteria 5450
711 Ga0501082_0205960 3300060353 Bacteria 1711

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 3002998708 3003003444 239
2 iso_pu_bacteria 8053945823 8053951101 240
3 3300028666 Ga0265336_10019643 Ga0265336_100196432 242
4 3300037418 Ga0395900_0031704 Ga0395900_0031704_948_1709 242
5 3300037466 Ga0395898_0046052 Ga0395898_0046052_3314_4075 242
6 3300045976 Ga0466967_0325726 Ga0466967_0325726_604_1398 242
7 3300046794 Ga0495589_0158741 Ga0495589_0158741_24_785 242
8 3300049581 Ga0501047_0349300 Ga0501047_0349300_243_1037 242
9 3300005367 Ga0070667_100048331 Ga0070667_1000483313 243
10 3300025986 Ga0207658_10034788 Ga0207658_100347883 243
11 3300003203 JGI25406J46586_10021790 JGI25406J46586_100217902 244
12 3300005985 Ga0081539_10001504 Ga0081539_1000150418 244
13 3300025935 Ga0207709_10547072 Ga0207709_105470721 244
14 3300009101 Ga0105247_10031108 Ga0105247_100311084 246
15 3300013105 Ga0157369_10239525 Ga0157369_102395252 246
16 3300037418 Ga0395900_0601770 Ga0395900_0601770_91_975 248
17 3300044694 Ga0466963_0150088 Ga0466963_0150088_446_1330 248
18 3300044842 Ga0466957_0108098 Ga0466957_0108098_864_1742 248
19 3300048910 Ga0496107_0073063 Ga0496107_0073063_1644_2426 248
20 3300050492 nmdc:mga0yw44_361372_c1 nmdc:mga0yw44_361372_c1_110_871 249
21 3300050494 nmdc:mga06z11_300570_c1 nmdc:mga06z11_300570_c1_15_776 249
22 3300050496 nmdc:mga07m45_345017_c1 nmdc:mga07m45_345017_c1_85_846 249
23 3300002067 JGI24735J21928_10032869 JGI24735J21928_100328692 252
24 3300009545 Ga0105237_10000178 Ga0105237_1000017823 252
25 3300025914 Ga0207671_10008270 Ga0207671_100082706 252
26 3300041494 Ga0451837_0131201 Ga0451837_0131201_247_1041 252
27 3300050516 nmdc:mga0sz30_56394_c1 nmdc:mga0sz30_56394_c1_679_1440 252
28 3300005563 Ga0068855_100055086 Ga0068855_1000550862 253
29 3300009545 Ga0105237_10002564 Ga0105237_100025649 253
30 3300010375 Ga0105239_10030663 Ga0105239_100306635 253
31 3300025914 Ga0207671_10019320 Ga0207671_100193202 253
32 3300003792 Ga0055540_1000941 Ga0055540_10009415 256
33 3300025273 Ga0209673_1008102 Ga0209673_10081024 256
34 3300025303 Ga0209051_1006114 Ga0209051_10061144 256
35 3300050490 nmdc:mga03n38_21081_c1 nmdc:mga03n38_21081_c1_739_1545 256
36 3300050516 nmdc:mga0sz30_3201_c1 nmdc:mga0sz30_3201_c1_2040_2945 256
37 3300009553 Ga0105249_10430988 Ga0105249_104309882 258
38 3300053087 Ga0500643_001154 Ga0500643_001154_10801_11715 258
39 3300005337 Ga0070682_100090665 Ga0070682_1000906652 260
40 3300005459 Ga0068867_100093721 Ga0068867_1000937213 260
41 3300005578 Ga0068854_100030428 Ga0068854_1000304283 260
42 3300005614 Ga0068856_100004148 Ga0068856_10000414816 260
43 3300005617 Ga0068859_100093089 Ga0068859_1000930893 260
44 3300005842 Ga0068858_100009962 Ga0068858_1000099625 260
45 3300006931 Ga0097620_100093087 Ga0097620_1000930873 260
46 3300009176 Ga0105242_10644314 Ga0105242_106443142 260
47 3300013296 Ga0157374_10047571 Ga0157374_100475714 260
48 3300025900 Ga0207710_10043734 Ga0207710_100437342 260
49 3300026035 Ga0207703_10055546 Ga0207703_100555462 260
50 3300026041 Ga0207639_10224493 Ga0207639_102244932 260
51 3300026078 Ga0207702_10002286 Ga0207702_1000228618 260
52 3300035170 Ga0373943_0001737 Ga0373943_0001737_273_1091 260
53 3300035172 Ga0373955_0037233 Ga0373955_0037233_1668_2486 260
54 3300035692 Ga0373935_0145256 Ga0373935_0145256_720_1538 260
55 3300035695 Ga0373927_0017008 Ga0373927_0017008_1135_1953 260
56 3300035724 Ga0373933_0173809 Ga0373933_0173809_184_1002 260
57 3300037068 Ga0373925_0134256 Ga0373925_0134256_926_1744 260
58 3300046459 Ga0495629_0023150 Ga0495629_0023150_1073_1891 260
59 3300046463 Ga0495653_0004538 Ga0495653_0004538_5966_6784 260
60 3300046475 Ga0495639_0060341 Ga0495639_0060341_90_908 260
61 3300046499 Ga0495594_0020272 Ga0495594_0020272_2202_3020 260
62 3300046511 Ga0495608_0002859 Ga0495608_0002859_11367_12185 260
63 3300046517 Ga0495630_0099023 Ga0495630_0099023_1197_2015 260
64 3300046526 Ga0495666_0033626 Ga0495666_0033626_1384_2202 260
65 3300046531 Ga0495665_0168840 Ga0495665_0168840_132_950 260
66 3300046533 Ga0495640_0074613 Ga0495640_0074613_888_1706 260
67 3300046559 Ga0495667_0001764 Ga0495667_0001764_5111_5929 260
68 3300046642 Ga0495634_0093038 Ga0495634_0093038_189_1007 260
69 3300046663 Ga0495635_0025895 Ga0495635_0025895_1669_2487 260
70 3300046674 Ga0495588_0106290 Ga0495588_0106290_229_1047 260
71 3300046675 Ga0495657_0002947 Ga0495657_0002947_4603_5421 260
72 3300046683 Ga0495658_0103799 Ga0495658_0103799_820_1638 260
73 3300046689 Ga0495613_0035592 Ga0495613_0035592_1861_2679 260
74 3300047315 Ga0495581_0006220 Ga0495581_0006220_5639_6457 260
75 3300047317 Ga0495604_0202885 Ga0495604_0202885_514_1332 260
76 3300047319 Ga0495674_0013586 Ga0495674_0013586_1257_2075 260
77 3300047321 Ga0495676_0255463 Ga0495676_0255463_43_861 260
78 3300047322 Ga0495680_0009868 Ga0495680_0009868_6072_6890 260
79 3300047471 Ga0495684_0009471 Ga0495684_0009471_4949_5767 260
80 3300048088 Ga0495602_0320239 Ga0495602_0320239_288_1106 260
81 3300048089 Ga0495614_0004289 Ga0495614_0004289_5558_6376 260
82 3300053077 Ga0495601_0070868 Ga0495601_0070868_1357_2175 260
83 3300053085 Ga0495619_0223465 Ga0495619_0223465_276_1094 260
84 3300005439 Ga0070711_100261435 Ga0070711_1002614352 261
85 3300005441 Ga0070700_100017215 Ga0070700_1000172153 261
86 3300005535 Ga0070684_100007016 Ga0070684_1000070165 261
87 3300005549 Ga0070704_100121270 Ga0070704_1001212702 261
88 3300005564 Ga0070664_100047870 Ga0070664_1000478703 261
89 3300005577 Ga0068857_100011640 Ga0068857_1000116406 261
90 3300005618 Ga0068864_100342077 Ga0068864_1003420771 261
91 3300006844 Ga0075428_100051463 Ga0075428_1000514633 261
92 3300006881 Ga0068865_100011634 Ga0068865_1000116342 261
93 3300009094 Ga0111539_10241974 Ga0111539_102419742 261
94 3300014325 Ga0163163_10124419 Ga0163163_101244192 261
95 3300025901 Ga0207688_10045040 Ga0207688_100450402 261
96 3300025927 Ga0207687_10176759 Ga0207687_101767592 261
97 3300025938 Ga0207704_10185174 Ga0207704_101851742 261
98 3300025944 Ga0207661_10003465 Ga0207661_100034658 261
99 3300026023 Ga0207677_10210639 Ga0207677_102106392 261
100 3300026067 Ga0207678_10414553 Ga0207678_104145532 261
101 3300026075 Ga0207708_10009373 Ga0207708_100093733 261
102 3300026116 Ga0207674_10019592 Ga0207674_100195924 261
103 3300027907 Ga0207428_10127037 Ga0207428_101270372 261
104 3300035120 Ga0373957_0159239 Ga0373957_0159239_24_845 261
105 3300035172 Ga0373955_0079802 Ga0373955_0079802_808_1629 261
106 3300035724 Ga0373933_0080402 Ga0373933_0080402_447_1268 261
107 3300046529 Ga0495652_0171569 Ga0495652_0171569_811_1632 261
108 3300049686 Ga0501257_006903 Ga0501257_006903_814_1698 261
109 3300050512 nmdc:mga0n895_706032_c1 nmdc:mga0n895_706032_c1_173_994 261
110 3300005456 Ga0070678_100194916 Ga0070678_1001949162 263
111 3300013306 Ga0163162_10112849 Ga0163162_101128492 263
112 3300005436 Ga0070713_100021199 Ga0070713_1000211994 264
113 3300025929 Ga0207664_10181647 Ga0207664_101816471 264
114 3300032004 Ga0307414_10208689 Ga0307414_102086891 264
115 3300044683 Ga0466965_0090109 Ga0466965_0090109_709_1539 264
116 3300045976 Ga0466967_0609884 Ga0466967_0609884_210_1052 265
117 3300046507 Ga0495606_0083170 Ga0495606_0083170_1076_1921 265
118 3300048903 Ga0496100_0009450 Ga0496100_0009450_4279_5124 265
119 3300048904 Ga0496101_0000021 Ga0496101_0000021_34029_34874 265
120 3300048910 Ga0496107_0011486 Ga0496107_0011486_4225_5070 265
121 3300048916 Ga0496113_0234782 Ga0496113_0234782_599_1444 265
122 3300048922 Ga0496119_0026660 Ga0496119_0026660_2184_3029 265
123 3300048924 Ga0496121_0000177 Ga0496121_0000177_125328_126173 265
124 3300049593 Ga0501077_0060270 Ga0501077_0060270_1052_1945 267
125 3300053080 Ga0500635_0001094 Ga0500635_0001094_869_1780 267
126 3300053131 Ga0500652_009427 Ga0500652_009427_1634_2545 267
127 3300005535 Ga0070684_100050062 Ga0070684_1000500623 269
128 3300006163 Ga0070715_10010496 Ga0070715_100104962 269
129 3300009098 Ga0105245_10060787 Ga0105245_100607872 269
130 3300025901 Ga0207688_10178121 Ga0207688_101781211 269
131 3300025915 Ga0207693_10164815 Ga0207693_101648152 269
132 3300025961 Ga0207712_10518163 Ga0207712_105181632 269
133 3300037312 Ga0395899_0149726 Ga0395899_0149726_464_1345 269
134 3300037418 Ga0395900_0272442 Ga0395900_0272442_336_1217 269
135 3300037466 Ga0395898_0349404 Ga0395898_0349404_318_1199 269
136 3300038443 Ga0395901_0068340 Ga0395901_0068340_100_981 269
137 3300046459 Ga0495629_0086930 Ga0495629_0086930_1251_2111 269
138 3300046475 Ga0495639_0065782 Ga0495639_0065782_118_978 269
139 3300046517 Ga0495630_0030023 Ga0495630_0030023_1564_2424 269
140 3300046526 Ga0495666_0091765 Ga0495666_0091765_150_1010 269
141 3300046674 Ga0495588_0079615 Ga0495588_0079615_294_1154 269
142 3300047673 Ga0495593_0010942 Ga0495593_0010942_3797_4657 269
143 3300048903 Ga0496100_0046837 Ga0496100_0046837_1778_2641 269
144 3300048904 Ga0496101_0105980 Ga0496101_0105980_820_1683 269
145 3300048905 Ga0496102_0050731 Ga0496102_0050731_1475_2338 269
146 3300048905 Ga0496102_0379083 Ga0496102_0379083_113_976 269
147 3300048907 Ga0496104_0080994 Ga0496104_0080994_412_1275 269
148 3300048911 Ga0496108_0021599 Ga0496108_0021599_1403_2266 269
149 3300048912 Ga0496109_0053112 Ga0496109_0053112_2748_3611 269
150 3300048913 Ga0496110_0034997 Ga0496110_0034997_1136_1999 269
151 3300048914 Ga0496111_0164329 Ga0496111_0164329_642_1505 269
152 3300048916 Ga0496113_0229290 Ga0496113_0229290_48_911 269
153 3300048917 Ga0496114_0041127 Ga0496114_0041127_2595_3458 269
154 3300048918 Ga0496115_0014339 Ga0496115_0014339_157_1020 269
155 3300006038 Ga0075365_10179843 Ga0075365_101798432 271
156 iso_pu_bacteria 2929212328 2929216251 271
157 3300014969 Ga0157376_10192746 Ga0157376_101927462 272
158 3300048909 Ga0496106_0100080 Ga0496106_0100080_165_1037 272
159 3300048917 Ga0496114_0220089 Ga0496114_0220089_101_973 272
160 3300059508 Ga0587088_015224 Ga0587088_015224_141_1022 272
161 3300005437 Ga0070710_10274469 Ga0070710_102744691 273
162 3300006175 Ga0070712_100263628 Ga0070712_1002636282 273
163 3300041413 Ga0439465_0000349 Ga0439465_0000349_6855_7763 273
164 3300005467 Ga0070706_100143748 Ga0070706_1001437482 274
165 3300005471 Ga0070698_100001707 Ga0070698_1000017073 274
166 3300025910 Ga0207684_10083146 Ga0207684_100831462 274
167 3300035117 Ga0373953_0103639 Ga0373953_0103639_190_1107 274
168 3300035172 Ga0373955_0173678 Ga0373955_0173678_20_937 274
169 3300035724 Ga0373933_0041664 Ga0373933_0041664_1535_2452 274
170 3300036401 Ga0373937_0058434 Ga0373937_0058434_717_1634 274
171 3300037068 Ga0373925_0021369 Ga0373925_0021369_1997_2914 274
172 3300037068 Ga0373925_0407596 Ga0373925_0407596_72_986 274
173 3300046462 Ga0495651_0007208 Ga0495651_0007208_1924_2841 274
174 3300046463 Ga0495653_0020117 Ga0495653_0020117_163_1080 274
175 3300046477 Ga0495664_0073805 Ga0495664_0073805_177_1094 274
176 3300046511 Ga0495608_0010194 Ga0495608_0010194_4033_4950 274
177 3300046529 Ga0495652_0003641 Ga0495652_0003641_14045_14962 274
178 3300046559 Ga0495667_0000908 Ga0495667_0000908_15704_16621 274
179 3300046663 Ga0495635_0011752 Ga0495635_0011752_3368_4285 274
180 3300046675 Ga0495657_0007099 Ga0495657_0007099_3864_4781 274
181 3300046809 Ga0495600_0016381 Ga0495600_0016381_2216_3133 274
182 3300047322 Ga0495680_0001586 Ga0495680_0001586_17192_18109 274
183 3300047444 Ga0495675_0069594 Ga0495675_0069594_833_1750 274
184 3300047471 Ga0495684_0040633 Ga0495684_0040633_700_1617 274
185 3300048088 Ga0495602_0036396 Ga0495602_0036396_2235_3152 274
186 3300049571 Ga0501034_0154413 Ga0501034_0154413_473_1369 274
187 3300005337 Ga0070682_100211224 Ga0070682_1002112242 275
188 3300006048 Ga0075363_100044130 Ga0075363_1000441302 275
189 3300048919 Ga0496116_0000166 Ga0496116_0000166_122644_123516 275
190 3300050490 nmdc:mga03n38_107121_c1 nmdc:mga03n38_107121_c1_322_1227 275
191 3300050491 nmdc:mga00v17_56229_c1 nmdc:mga00v17_56229_c1_440_1345 275
192 3300053119 Ga0500595_005721 Ga0500595_005721_690_1562 275
193 3300004803 Ga0058862_12428665 Ga0058862_124286652 276
194 3300005435 Ga0070714_100051812 Ga0070714_1000518123 276
195 3300005436 Ga0070713_100040216 Ga0070713_1000402163 276
196 3300005436 Ga0070713_100078053 Ga0070713_1000780532 276
197 3300005437 Ga0070710_10003412 Ga0070710_100034124 276
198 3300005439 Ga0070711_100001607 Ga0070711_10000160710 276
199 3300005445 Ga0070708_100005610 Ga0070708_1000056106 276
200 3300005467 Ga0070706_100003990 Ga0070706_10000399015 276
201 3300005467 Ga0070706_100020205 Ga0070706_1000202054 276
202 3300005468 Ga0070707_100000041 Ga0070707_10000004114 276
203 3300005471 Ga0070698_100000082 Ga0070698_10000008233 276
204 3300005471 Ga0070698_100088595 Ga0070698_1000885952 276
205 3300006028 Ga0070717_10034026 Ga0070717_100340263 276
206 3300006173 Ga0070716_100004017 Ga0070716_1000040174 276
207 3300006175 Ga0070712_100109699 Ga0070712_1001096992 276
208 3300007076 Ga0075435_100079477 Ga0075435_1000794772 276
209 3300025898 Ga0207692_10001870 Ga0207692_100018706 276
210 3300025906 Ga0207699_10002495 Ga0207699_100024954 276
211 3300025910 Ga0207684_10000339 Ga0207684_1000033921 276
212 3300025910 Ga0207684_10119551 Ga0207684_101195512 276
213 3300025916 Ga0207663_10139692 Ga0207663_101396922 276
214 3300025922 Ga0207646_10000061 Ga0207646_1000006147 276
215 3300025928 Ga0207700_10006098 Ga0207700_100060983 276
216 3300025928 Ga0207700_10025193 Ga0207700_100251933 276
217 3300025928 Ga0207700_10029504 Ga0207700_100295044 276
218 3300025929 Ga0207664_10032064 Ga0207664_100320642 276
219 3300025939 Ga0207665_10001670 Ga0207665_100016705 276
220 3300039437 Ga0436365_0643539 Ga0436365_0643539_91_981 276
221 3300048918 Ga0496115_0077120 Ga0496115_0077120_592_1464 276
222 3300048918 Ga0496115_0105139 Ga0496115_0105139_1150_2025 276
223 3300049572 Ga0501036_0423567 Ga0501036_0423567_104_1000 276
224 3300049578 Ga0501042_0127505 Ga0501042_0127505_299_1195 276
225 3300049582 Ga0501048_0139082 Ga0501048_0139082_150_1046 276
226 3300054114 Ga0501084_0077695 Ga0501084_0077695_911_1807 276
227 3300005471 Ga0070698_100001184 Ga0070698_1000011847 277
228 3300005548 Ga0070665_100307865 Ga0070665_1003078652 277
229 3300025898 Ga0207692_10022310 Ga0207692_100223103 277
230 3300026067 Ga0207678_10114208 Ga0207678_101142083 277
231 3300035692 Ga0373935_0116138 Ga0373935_0116138_123_1040 277
232 3300037853 Ga0436364_0788967 Ga0436364_0788967_2584_3462 277
233 3300044694 Ga0466963_0021480 Ga0466963_0021480_1540_2421 277
234 3300047471 Ga0495684_0126045 Ga0495684_0126045_559_1476 277
235 3300048915 Ga0496112_0051425 Ga0496112_0051425_2711_3601 277
236 3300053087 Ga0500643_006474 Ga0500643_006474_3056_3952 277
237 3300054114 Ga0501084_0234005 Ga0501084_0234005_51_959 277
238 3300026041 Ga0207639_10034426 Ga0207639_100344263 278
239 3300037312 Ga0395899_0074684 Ga0395899_0074684_1348_2226 278
240 3300037418 Ga0395900_0059527 Ga0395900_0059527_1819_2697 278
241 3300037471 Ga0395905_0041489 Ga0395905_0041489_1730_2608 278
242 3300038443 Ga0395901_0015280 Ga0395901_0015280_4925_5803 278
243 3300044658 Ga0466972_0007973 Ga0466972_0007973_2687_3601 278
244 3300047472 Ga0495686_0003330 Ga0495686_0003330_8530_9414 278
245 3300048913 Ga0496110_0292815 Ga0496110_0292815_361_1257 278
246 3300048928 Ga0496125_0126667 Ga0496125_0126667_519_1415 278
247 3300053730 Ga0500645_000035 Ga0500645_000035_48867_49763 278
248 iso_pu_bacteria 2738541274 2738704649 278
249 iso_pu_bacteria 8046352972 8046353996 278
250 3300005435 Ga0070714_100003345 Ga0070714_1000033458 279
251 3300005436 Ga0070713_100021003 Ga0070713_1000210032 279
252 3300005437 Ga0070710_10027440 Ga0070710_100274402 279
253 3300006028 Ga0070717_10018280 Ga0070717_100182804 279
254 3300006038 Ga0075365_10152450 Ga0075365_101524502 279
255 3300025898 Ga0207692_10019953 Ga0207692_100199532 279
256 3300025915 Ga0207693_10072192 Ga0207693_100721922 279
257 3300025916 Ga0207663_10159109 Ga0207663_101591092 279
258 3300025928 Ga0207700_10020021 Ga0207700_100200214 279
259 3300025929 Ga0207664_10002605 Ga0207664_100026059 279
260 3300034819 Ga0373958_0010115 Ga0373958_0010115_134_1018 279
261 3300046461 Ga0495641_0010636 Ga0495641_0010636_25_909 279
262 3300048907 Ga0496104_0082510 Ga0496104_0082510_1756_2640 279
263 3300048909 Ga0496106_0237974 Ga0496106_0237974_528_1412 279
264 3300048917 Ga0496114_0088783 Ga0496114_0088783_1057_1941 279
265 3300050492 nmdc:mga0yw44_20758_c1 nmdc:mga0yw44_20758_c1_2071_2976 279
266 3300005406 Ga0070703_10000001 Ga0070703_10000001120 280
267 3300005444 Ga0070694_100122060 Ga0070694_1001220602 280
268 3300005445 Ga0070708_100001542 Ga0070708_1000015422 280
269 3300005445 Ga0070708_100309692 Ga0070708_1003096921 280
270 3300005467 Ga0070706_100010233 Ga0070706_10001023310 280
271 3300005468 Ga0070707_100008503 Ga0070707_1000085033 280
272 3300005468 Ga0070707_100011480 Ga0070707_1000114808 280
273 3300005471 Ga0070698_100538532 Ga0070698_1005385322 280
274 3300005518 Ga0070699_100009389 Ga0070699_1000093894 280
275 3300005718 Ga0068866_10013060 Ga0068866_100130604 280
276 3300005844 Ga0068862_100246674 Ga0068862_1002466741 280
277 3300006881 Ga0068865_100030675 Ga0068865_1000306752 280
278 3300009098 Ga0105245_10571908 Ga0105245_105719082 280
279 3300009148 Ga0105243_10007191 Ga0105243_1000719110 280
280 3300013306 Ga0163162_10026392 Ga0163162_100263924 280
281 3300014326 Ga0157380_10261497 Ga0157380_102614971 280
282 3300025885 Ga0207653_10000004 Ga0207653_10000004121 280
283 3300025899 Ga0207642_10032954 Ga0207642_100329542 280
284 3300025910 Ga0207684_10000911 Ga0207684_1000091114 280
285 3300025910 Ga0207684_10212783 Ga0207684_102127832 280
286 3300025922 Ga0207646_10007478 Ga0207646_100074789 280
287 3300025923 Ga0207681_10415696 Ga0207681_104156962 280
288 3300025935 Ga0207709_10184937 Ga0207709_101849372 280
289 3300026023 Ga0207677_10236837 Ga0207677_102368372 280
290 3300046455 Ga0495603_0001901 Ga0495603_0001901_9270_10154 280
291 3300046501 Ga0495607_0074327 Ga0495607_0074327_230_1114 280
292 3300046518 Ga0495631_0100388 Ga0495631_0100388_85_969 280
293 3300046664 Ga0495659_0070679 Ga0495659_0070679_196_1080 280
294 3300048904 Ga0496101_0058904 Ga0496101_0058904_948_1832 280
295 3300005518 Ga0070699_100024677 Ga0070699_1000246773 281
296 3300005544 Ga0070686_100313683 Ga0070686_1003136832 281
297 3300005937 Ga0081455_10001614 Ga0081455_1000161414 281
298 3300028800 Ga0265338_10000868 Ga0265338_1000086842 281
299 3300035083 Ga0373926_0008701 Ga0373926_0008701_1675_2562 281
300 3300035692 Ga0373935_0012226 Ga0373935_0012226_1422_2309 281
301 3300035725 Ga0373947_0000014 Ga0373947_0000014_125287_126174 281
302 3300037466 Ga0395898_0185655 Ga0395898_0185655_778_1665 281
303 3300005329 Ga0070683_100141571 Ga0070683_1001415713 282
304 3300025944 Ga0207661_10124084 Ga0207661_101240842 282
305 3300002074 JGI24748J21848_1002478 JGI24748J21848_10024782 283
306 3300002075 JGI24738J21930_10003332 JGI24738J21930_100033323 283
307 3300002077 JGI24744J21845_10000059 JGI24744J21845_100000592 283
308 3300002244 JGI24742J22300_10000896 JGI24742J22300_100008963 283
309 3300005337 Ga0070682_100014158 Ga0070682_1000141585 283
310 3300005338 Ga0068868_100000529 Ga0068868_10000052912 283
311 3300005339 Ga0070660_100244164 Ga0070660_1002441642 283
312 3300005343 Ga0070687_100033142 Ga0070687_1000331422 283
313 3300005345 Ga0070692_10035737 Ga0070692_100357373 283
314 3300005347 Ga0070668_100005441 Ga0070668_1000054417 283
315 3300005353 Ga0070669_100023391 Ga0070669_1000233913 283
316 3300005355 Ga0070671_100228139 Ga0070671_1002281392 283
317 3300005356 Ga0070674_100003430 Ga0070674_1000034301 283
318 3300005366 Ga0070659_100040259 Ga0070659_1000402594 283
319 3300005367 Ga0070667_100002267 Ga0070667_10000226713 283
320 3300005437 Ga0070710_10000900 Ga0070710_1000090010 283
321 3300005438 Ga0070701_10003486 Ga0070701_100034866 283
322 3300005439 Ga0070711_100001095 Ga0070711_1000010954 283
323 3300005440 Ga0070705_100051171 Ga0070705_1000511712 283
324 3300005441 Ga0070700_100009233 Ga0070700_1000092333 283
325 3300005455 Ga0070663_100063252 Ga0070663_1000632522 283
326 3300005456 Ga0070678_100009361 Ga0070678_1000093614 283
327 3300005457 Ga0070662_100017040 Ga0070662_1000170402 283
328 3300005459 Ga0068867_100001323 Ga0068867_1000013235 283
329 3300005543 Ga0070672_100069003 Ga0070672_1000690033 283
330 3300005546 Ga0070696_100003305 Ga0070696_1000033057 283
331 3300005547 Ga0070693_100039640 Ga0070693_1000396403 283
332 3300005548 Ga0070665_100001745 Ga0070665_10000174527 283
333 3300005548 Ga0070665_100015595 Ga0070665_1000155958 283
334 3300005549 Ga0070704_100000706 Ga0070704_1000007064 283
335 3300005578 Ga0068854_100001286 Ga0068854_1000012862 283
336 3300005614 Ga0068856_100317942 Ga0068856_1003179422 283
337 3300005616 Ga0068852_100040065 Ga0068852_1000400653 283
338 3300005617 Ga0068859_100003134 Ga0068859_1000031345 283
339 3300005718 Ga0068866_10000376 Ga0068866_1000037618 283
340 3300005719 Ga0068861_100018600 Ga0068861_1000186003 283
341 3300005842 Ga0068858_100002465 Ga0068858_1000024653 283
342 3300005843 Ga0068860_100025928 Ga0068860_1000259284 283
343 3300005844 Ga0068862_100002116 Ga0068862_1000021163 283
344 3300006163 Ga0070715_10010773 Ga0070715_100107733 283
345 3300006173 Ga0070716_100002661 Ga0070716_1000026614 283
346 3300006175 Ga0070712_100001062 Ga0070712_10000106214 283
347 3300006237 Ga0097621_100015140 Ga0097621_1000151404 283
348 3300006871 Ga0075434_100003943 Ga0075434_1000039433 283
349 3300006881 Ga0068865_100000828 Ga0068865_1000008284 283
350 3300006931 Ga0097620_100003133 Ga0097620_10000313314 283
351 3300007076 Ga0075435_100007491 Ga0075435_1000074912 283
352 3300009093 Ga0105240_10420787 Ga0105240_104207872 283
353 3300009098 Ga0105245_10003220 Ga0105245_100032206 283
354 3300009101 Ga0105247_10004659 Ga0105247_100046598 283
355 3300009147 Ga0114129_10039891 Ga0114129_100398913 283
356 3300009148 Ga0105243_10003249 Ga0105243_1000324913 283
357 3300009174 Ga0105241_10019951 Ga0105241_100199514 283
358 3300009176 Ga0105242_10000620 Ga0105242_1000062015 283
359 3300009177 Ga0105248_10008918 Ga0105248_100089183 283
360 3300009545 Ga0105237_10034235 Ga0105237_100342352 283
361 3300009553 Ga0105249_10000767 Ga0105249_1000076719 283
362 3300010375 Ga0105239_10007818 Ga0105239_100078185 283
363 3300011119 Ga0105246_10390088 Ga0105246_103900882 283
364 3300013297 Ga0157378_10001690 Ga0157378_1000169014 283
365 3300013306 Ga0163162_10003614 Ga0163162_100036143 283
366 3300013307 Ga0157372_10026882 Ga0157372_100268822 283
367 3300013308 Ga0157375_10003452 Ga0157375_1000345211 283
368 3300014326 Ga0157380_10003813 Ga0157380_100038132 283
369 3300014968 Ga0157379_10037357 Ga0157379_100373574 283
370 3300014969 Ga0157376_10072953 Ga0157376_100729532 283
371 3300025898 Ga0207692_10022696 Ga0207692_100226963 283
372 3300025899 Ga0207642_10002962 Ga0207642_100029624 283
373 3300025901 Ga0207688_10000352 Ga0207688_1000035214 283
374 3300025903 Ga0207680_10022427 Ga0207680_100224272 283
375 3300025905 Ga0207685_10004410 Ga0207685_100044102 283
376 3300025907 Ga0207645_10179654 Ga0207645_101796542 283
377 3300025914 Ga0207671_10092022 Ga0207671_100920222 283
378 3300025915 Ga0207693_10001171 Ga0207693_100011719 283
379 3300025916 Ga0207663_10005265 Ga0207663_100052654 283
380 3300025923 Ga0207681_10034439 Ga0207681_100344393 283
381 3300025927 Ga0207687_10001147 Ga0207687_1000114715 283
382 3300025928 Ga0207700_10378642 Ga0207700_103786422 283
383 3300025929 Ga0207664_10024393 Ga0207664_100243931 283
384 3300025932 Ga0207690_10053908 Ga0207690_100539082 283
385 3300025933 Ga0207706_10001128 Ga0207706_1000112828 283
386 3300025935 Ga0207709_10007186 Ga0207709_100071864 283
387 3300025936 Ga0207670_10147758 Ga0207670_101477582 283
388 3300025938 Ga0207704_10000377 Ga0207704_1000037716 283
389 3300025939 Ga0207665_10005772 Ga0207665_100057725 283
390 3300025940 Ga0207691_10053456 Ga0207691_100534564 283
391 3300025941 Ga0207711_10100926 Ga0207711_101009262 283
392 3300025972 Ga0207668_10029780 Ga0207668_100297804 283
393 3300025972 Ga0207668_10081132 Ga0207668_100811322 283
394 3300025981 Ga0207640_10003409 Ga0207640_100034095 283
395 3300025986 Ga0207658_10014963 Ga0207658_100149634 283
396 3300026023 Ga0207677_10044279 Ga0207677_100442793 283
397 3300026035 Ga0207703_10014135 Ga0207703_100141354 283
398 3300026067 Ga0207678_10003778 Ga0207678_1000377814 283
399 3300026075 Ga0207708_10001592 Ga0207708_100015923 283
400 3300026089 Ga0207648_10001355 Ga0207648_1000135517 283
401 3300026118 Ga0207675_100006054 Ga0207675_10000605411 283
402 3300026121 Ga0207683_10000201 Ga0207683_1000020142 283
403 3300028379 Ga0268266_10142200 Ga0268266_101422002 283
404 3300028381 Ga0268264_10031711 Ga0268264_100317112 283
405 3300035083 Ga0373926_0050445 Ga0373926_0050445_450_1346 283
406 3300035691 Ga0373931_0084987 Ga0373931_0084987_13_915 283
407 3300046516 Ga0495628_0203841 Ga0495628_0203841_244_1140 283
408 3300046533 Ga0495640_0102017 Ga0495640_0102017_345_1241 283
409 3300046543 Ga0495645_0347442 Ga0495645_0347442_49_945 283
410 3300046678 Ga0495599_0094061 Ga0495599_0094061_100_996 283
411 3300046679 Ga0495623_0022640 Ga0495623_0022640_2984_3880 283
412 3300046689 Ga0495613_0333621 Ga0495613_0333621_58_954 283
413 3300048903 Ga0496100_0004799 Ga0496100_0004799_3520_4422 283
414 3300048904 Ga0496101_0015217 Ga0496101_0015217_461_1363 283
415 3300048905 Ga0496102_0001309 Ga0496102_0001309_14704_15606 283
416 3300048906 Ga0496103_0019054 Ga0496103_0019054_1002_1904 283
417 3300048910 Ga0496107_0000321 Ga0496107_0000321_11689_12591 283
418 3300048917 Ga0496114_0000495 Ga0496114_0000495_19189_20091 283
419 3300050507 nmdc:mga05p37_47560_c1 nmdc:mga05p37_47560_c1_1200_2096 283
420 3300050512 nmdc:mga0n895_17799_c1 nmdc:mga0n895_17799_c1_1637_2533 283
421 3300050513 nmdc:mga0rr50_3260_c1 nmdc:mga0rr50_3260_c1_1571_2467 283
422 3300050515 nmdc:mga0a205_2637_c1 nmdc:mga0a205_2637_c1_11542_12438 283
423 iso_pu_bacteria 2643221687 2644488272 283
424 iso_pu_bacteria 2902837492 2902841360 283
425 3300025944 Ga0207661_10370158 Ga0207661_103701582 284
426 3300048903 Ga0496100_0308196 Ga0496100_0308196_22_912 284
427 3300005440 Ga0070705_100275775 Ga0070705_1002757751 285
428 3300005546 Ga0070696_100003753 Ga0070696_10000375311 285
429 3300006048 Ga0075363_100002644 Ga0075363_1000026443 285
430 3300006051 Ga0075364_10040448 Ga0075364_100404483 285
431 3300006353 Ga0075370_10008783 Ga0075370_100087835 285
432 3300009176 Ga0105242_10396592 Ga0105242_103965922 285
433 3300009177 Ga0105248_10702917 Ga0105248_107029172 285
434 3300021388 Ga0213875_10000604 Ga0213875_100006044 285
435 3300028379 Ga0268266_10174708 Ga0268266_101747082 285
436 3300037853 Ga0436364_1435297 Ga0436364_1435297_25447_26349 285
437 3300044658 Ga0466972_0086532 Ga0466972_0086532_333_1241 285
438 3300044683 Ga0466965_0002177 Ga0466965_0002177_5650_6558 285
439 3300044735 Ga0466968_0001088 Ga0466968_0001088_3016_3924 285
440 3300044765 Ga0466970_0016640 Ga0466970_0016640_121_1029 285
441 3300044842 Ga0466957_0020512 Ga0466957_0020512_1693_2601 285
442 3300044901 Ga0466960_0042012 Ga0466960_0042012_189_1097 285
443 3300045049 Ga0466959_0098581 Ga0466959_0098581_582_1490 285
444 3300045976 Ga0466967_0030898 Ga0466967_0030898_1662_2561 285
445 3300045976 Ga0466967_0036069 Ga0466967_0036069_1034_1942 285
446 3300046460 Ga0495638_0002264 Ga0495638_0002264_5857_6768 285
447 3300046692 Ga0495671_0071222 Ga0495671_0071222_137_1048 285
448 3300050490 nmdc:mga03n38_7306_c1 nmdc:mga03n38_7306_c1_450_1352 285
449 3300050494 nmdc:mga06z11_20869_c1 nmdc:mga06z11_20869_c1_1077_1979 285
450 3300053104 Ga0500556_0001572 Ga0500556_0001572_2919_3830 285
451 iso_pu_bacteria 2902792274 2902795185 285
452 3300003792 Ga0055540_1002276 Ga0055540_10022767 286
453 3300005467 Ga0070706_100209148 Ga0070706_1002091482 286
454 3300005471 Ga0070698_100001142 Ga0070698_10000114211 286
455 3300006048 Ga0075363_100014116 Ga0075363_1000141163 286
456 3300006051 Ga0075364_10000184 Ga0075364_1000018413 286
457 3300006186 Ga0075369_10001695 Ga0075369_100016958 286
458 3300025303 Ga0209051_1000528 Ga0209051_100052835 286
459 3300049570 Ga0501033_0243681 Ga0501033_0243681_116_1015 286
460 3300049571 Ga0501034_0033607 Ga0501034_0033607_423_1322 286
461 3300049572 Ga0501036_0222418 Ga0501036_0222418_94_993 286
462 3300049575 Ga0501039_0120633 Ga0501039_0120633_1061_1960 286
463 3300049581 Ga0501047_0392040 Ga0501047_0392040_97_996 286
464 3300049583 Ga0501067_0004530 Ga0501067_0004530_3863_4762 286
465 3300049583 Ga0501067_0012811 Ga0501067_0012811_724_1623 286
466 3300049584 Ga0501068_0010913 Ga0501068_0010913_4079_4978 286
467 3300049584 Ga0501068_0133839 Ga0501068_0133839_75_974 286
468 3300049586 Ga0501070_0097237 Ga0501070_0097237_749_1648 286
469 3300049587 Ga0501071_0007468 Ga0501071_0007468_1695_2594 286
470 3300049588 Ga0501072_0064713 Ga0501072_0064713_742_1641 286
471 3300049589 Ga0501073_0045442 Ga0501073_0045442_885_1784 286
472 3300049589 Ga0501073_0046934 Ga0501073_0046934_691_1590 286
473 3300049590 Ga0501074_0004203 Ga0501074_0004203_770_1669 286
474 3300049590 Ga0501074_0034406 Ga0501074_0034406_2004_2903 286
475 3300049593 Ga0501077_0031697 Ga0501077_0031697_462_1361 286
476 3300049742 Ga0501080_0004291 Ga0501080_0004291_10665_11564 286
477 3300049744 Ga0501083_0016126 Ga0501083_0016126_1337_2236 286
478 3300049744 Ga0501083_0055094 Ga0501083_0055094_1274_2173 286
479 3300050491 nmdc:mga00v17_135666_c1 nmdc:mga00v17_135666_c1_358_1278 286
480 3300050492 nmdc:mga0yw44_250629_c1 nmdc:mga0yw44_250629_c1_142_1047 286
481 3300050516 nmdc:mga0sz30_29531_c1 nmdc:mga0sz30_29531_c1_350_1258 286
482 3300060353 Ga0501082_0022336 Ga0501082_0022336_3708_4607 286
483 3300060353 Ga0501082_0205960 Ga0501082_0205960_707_1606 286
484 iso_pu_bacteria 2902810491 2902811300 286
485 3300003792 Ga0055540_1001155 Ga0055540_10011558 287
486 3300006038 Ga0075365_10005332 Ga0075365_100053325 287
487 3300006048 Ga0075363_100000787 Ga0075363_1000007877 287
488 3300006051 Ga0075364_10006965 Ga0075364_100069654 287
489 3300006177 Ga0075362_10001354 Ga0075362_100013543 287
490 3300006178 Ga0075367_10001919 Ga0075367_100019195 287
491 3300006186 Ga0075369_10010682 Ga0075369_100106824 287
492 3300006186 Ga0075369_10047085 Ga0075369_100470852 287
493 3300006195 Ga0075366_10018409 Ga0075366_100184093 287
494 3300006353 Ga0075370_10127936 Ga0075370_101279362 287
495 3300013104 Ga0157370_10413230 Ga0157370_104132302 287
496 3300025303 Ga0209051_1001208 Ga0209051_100120816 287
497 3300025303 Ga0209051_1008439 Ga0209051_10084393 287
498 3300025303 Ga0209051_1028400 Ga0209051_10284002 287
499 3300026089 Ga0207648_10116894 Ga0207648_101168942 287
500 3300028379 Ga0268266_10272479 Ga0268266_102724792 287
501 3300041452 Ga0451793_1294871 Ga0451793_1294871_21_929 287
502 3300041456 Ga0451795_0883130 Ga0451795_0883130_441_1349 287
503 3300042436 Ga0439435_0011347 Ga0439435_0011347_57_965 287
504 3300050489 nmdc:mga03683_3552_c1 nmdc:mga03683_3552_c1_2015_2923 287
505 3300050491 nmdc:mga00v17_5888_c1 nmdc:mga00v17_5888_c1_4591_5499 287
506 3300050493 nmdc:mga0k408_17139_c1 nmdc:mga0k408_17139_c1_1073_1981 287
507 3300050494 nmdc:mga06z11_4051_c1 nmdc:mga06z11_4051_c1_1956_2864 287
508 3300050516 nmdc:mga0sz30_10406_c1 nmdc:mga0sz30_10406_c1_1891_2799 287
509 3300053153 Ga0500616_0011465 Ga0500616_0011465_4048_4956 287
510 3300005471 Ga0070698_100225844 Ga0070698_1002258442 288
511 3300005518 Ga0070699_100000528 Ga0070699_10000052833 288
512 3300005536 Ga0070697_100205425 Ga0070697_1002054252 288
513 3300005539 Ga0068853_100016775 Ga0068853_1000167754 288
514 3300025906 Ga0207699_10012397 Ga0207699_100123972 288
515 3300025910 Ga0207684_10170973 Ga0207684_101709732 288
516 3300025922 Ga0207646_10004855 Ga0207646_100048556 288
517 3300025928 Ga0207700_10181062 Ga0207700_101810622 288
518 3300025929 Ga0207664_10474410 Ga0207664_104744102 288
519 3300037853 Ga0436364_0609957 Ga0436364_0609957_57_971 288
520 iso_pu_bacteria 2939582691 2939583060 288
521 3300005468 Ga0070707_100030744 Ga0070707_1000307446 289
522 3300005468 Ga0070707_100209642 Ga0070707_1002096422 289
523 3300005530 Ga0070679_100100836 Ga0070679_1001008361 289
524 3300005548 Ga0070665_100389553 Ga0070665_1003895532 289
525 3300005841 Ga0068863_100308739 Ga0068863_1003087391 289
526 3300005842 Ga0068858_100445074 Ga0068858_1004450741 289
527 3300005983 Ga0081540_1000505 Ga0081540_10005055 289
528 3300009148 Ga0105243_10028694 Ga0105243_100286943 289
529 3300009177 Ga0105248_10044839 Ga0105248_100448394 289
530 3300009553 Ga0105249_10181192 Ga0105249_101811923 289
531 3300010375 Ga0105239_10007516 Ga0105239_100075162 289
532 3300013102 Ga0157371_10134550 Ga0157371_101345502 289
533 3300013308 Ga0157375_10786924 Ga0157375_107869242 289
534 3300025910 Ga0207684_10507067 Ga0207684_105070671 289
535 3300025915 Ga0207693_10424985 Ga0207693_104249852 289
536 3300025922 Ga0207646_10020298 Ga0207646_100202987 289
537 3300025928 Ga0207700_10179931 Ga0207700_101799312 289
538 3300025941 Ga0207711_10051435 Ga0207711_100514352 289
539 3300026075 Ga0207708_10006707 Ga0207708_100067076 289
540 3300026088 Ga0207641_10134177 Ga0207641_101341772 289
541 3300028381 Ga0268264_10209352 Ga0268264_102093522 289
542 3300028556 Ga0265337_1000027 Ga0265337_10000278 289
543 3300028558 Ga0265326_10001234 Ga0265326_100012346 289
544 3300028563 Ga0265319_1001055 Ga0265319_100105512 289
545 3300028573 Ga0265334_10000773 Ga0265334_100007738 289
546 3300028577 Ga0265318_10099600 Ga0265318_100996002 289
547 3300028653 Ga0265323_10082254 Ga0265323_100822541 289
548 3300028654 Ga0265322_10001284 Ga0265322_100012845 289
549 3300028666 Ga0265336_10002288 Ga0265336_100022885 289
550 3300028800 Ga0265338_10000227 Ga0265338_1000022784 289
551 3300028800 Ga0265338_10007886 Ga0265338_1000788612 289
552 3300029957 Ga0265324_10004386 Ga0265324_100043864 289
553 3300031238 Ga0265332_10001185 Ga0265332_100011858 289
554 3300031240 Ga0265320_10049797 Ga0265320_100497972 289
555 3300031247 Ga0265340_10005777 Ga0265340_100057773 289
556 3300031344 Ga0265316_10007705 Ga0265316_100077056 289
557 3300031595 Ga0265313_10010516 Ga0265313_100105165 289
558 3300031711 Ga0265314_10010105 Ga0265314_100101056 289
559 3300031712 Ga0265342_10012177 Ga0265342_100121773 289
560 3300035116 Ga0373945_0013583 Ga0373945_0013583_1535_2452 289
561 3300035118 Ga0373954_0006920 Ga0373954_0006920_59_976 289
562 3300035119 Ga0373956_0003259 Ga0373956_0003259_748_1665 289
563 3300035120 Ga0373957_0059689 Ga0373957_0059689_370_1287 289
564 3300035170 Ga0373943_0028168 Ga0373943_0028168_1403_2320 289
565 3300035692 Ga0373935_0039727 Ga0373935_0039727_1515_2432 289
566 3300035695 Ga0373927_0041032 Ga0373927_0041032_1636_2553 289
567 3300035724 Ga0373933_0033929 Ga0373933_0033929_1914_2831 289
568 3300035725 Ga0373947_0126368 Ga0373947_0126368_391_1308 289
569 3300037853 Ga0436364_1520571 Ga0436364_1520571_17002_17928 289
570 3300046455 Ga0495603_0024918 Ga0495603_0024918_144_1061 289
571 3300046459 Ga0495629_0012234 Ga0495629_0012234_47_964 289
572 3300046462 Ga0495651_0126444 Ga0495651_0126444_519_1436 289
573 3300046463 Ga0495653_0236867 Ga0495653_0236867_33_950 289
574 3300046473 Ga0495582_0021817 Ga0495582_0021817_2068_2985 289
575 3300046475 Ga0495639_0045890 Ga0495639_0045890_321_1238 289
576 3300046476 Ga0495662_0001666 Ga0495662_0001666_10013_10930 289
577 3300046506 Ga0495583_0086756 Ga0495583_0086756_345_1262 289
578 3300046517 Ga0495630_0009396 Ga0495630_0009396_2862_3779 289
579 3300046524 Ga0495648_0005458 Ga0495648_0005458_3667_4584 289
580 3300046526 Ga0495666_0022153 Ga0495666_0022153_659_1576 289
581 3300046530 Ga0495654_0096373 Ga0495654_0096373_310_1227 289
582 3300046531 Ga0495665_0013989 Ga0495665_0013989_3115_4032 289
583 3300046535 Ga0495586_0023326 Ga0495586_0023326_479_1396 289
584 3300046543 Ga0495645_0032170 Ga0495645_0032170_269_1186 289
585 3300046642 Ga0495634_0048446 Ga0495634_0048446_477_1394 289
586 3300046663 Ga0495635_0312367 Ga0495635_0312367_68_985 289
587 3300046681 Ga0495647_0020032 Ga0495647_0020032_823_1740 289
588 3300046683 Ga0495658_0211320 Ga0495658_0211320_164_1081 289
589 3300046809 Ga0495600_0009939 Ga0495600_0009939_3662_4579 289
590 3300047317 Ga0495604_0206667 Ga0495604_0206667_140_1057 289
591 3300047320 Ga0495672_0030900 Ga0495672_0030900_2286_3203 289
592 3300047321 Ga0495676_0040298 Ga0495676_0040298_134_1051 289
593 3300047322 Ga0495680_0029597 Ga0495680_0029597_63_980 289
594 3300047444 Ga0495675_0049564 Ga0495675_0049564_1399_2316 289
595 3300047469 Ga0495673_0001205 Ga0495673_0001205_7625_8542 289
596 3300047471 Ga0495684_0102820 Ga0495684_0102820_449_1366 289
597 3300047673 Ga0495593_0009218 Ga0495593_0009218_4637_5554 289
598 3300048903 Ga0496100_0002367 Ga0496100_0002367_172_1095 289
599 3300048904 Ga0496101_0025140 Ga0496101_0025140_1886_2809 289
600 3300048905 Ga0496102_0000001 Ga0496102_0000001_223139_224056 289
601 3300048906 Ga0496103_0000007 Ga0496103_0000007_131633_132550 289
602 3300048907 Ga0496104_0010504 Ga0496104_0010504_1091_2014 289
603 3300048908 Ga0496105_0023961 Ga0496105_0023961_1068_1991 289
604 3300048909 Ga0496106_0003195 Ga0496106_0003195_7648_8571 289
605 3300048910 Ga0496107_0003559 Ga0496107_0003559_1786_2709 289
606 3300048917 Ga0496114_0002288 Ga0496114_0002288_7237_8160 289
607 3300048918 Ga0496115_0003085 Ga0496115_0003085_2915_3838 289
608 3300048919 Ga0496116_0000018 Ga0496116_0000018_186241_187158 289
609 3300048920 Ga0496117_0000015 Ga0496117_0000015_358720_359637 289
610 3300048921 Ga0496118_0000012 Ga0496118_0000012_358720_359637 289
611 3300048923 Ga0496120_0006298 Ga0496120_0006298_2184_3101 289
612 3300048929 Ga0496126_0001113 Ga0496126_0001113_35353_36270 289
613 3300053077 Ga0495601_0016295 Ga0495601_0016295_2068_2985 289
614 3300053078 Ga0495612_0003214 Ga0495612_0003214_4362_5279 289
615 3300053085 Ga0495619_0044877 Ga0495619_0044877_1913_2830 289
616 3300053087 Ga0500643_001862 Ga0500643_001862_4702_5619 289
617 3300005436 Ga0070713_100004385 Ga0070713_1000043855 290
618 3300025928 Ga0207700_10078194 Ga0207700_100781943 290
619 3300025929 Ga0207664_10002329 Ga0207664_100023296 290
620 3300031901 Ga0307406_10073259 Ga0307406_100732592 290
621 3300041410 Ga0439461_0002575 Ga0439461_0002575_769_1692 290
622 3300041411 Ga0439466_0006609 Ga0439466_0006609_1741_2664 290
623 3300041413 Ga0439465_0009359 Ga0439465_0009359_1993_2916 290
624 3300041997 Ga0439431_0000859 Ga0439431_0000859_1763_2686 290
625 3300042004 Ga0439445_0004897 Ga0439445_0004897_1055_1978 290
626 3300042435 Ga0439434_0010181 Ga0439434_0010181_898_1821 290
627 3300048091 Ga0495626_0067444 Ga0495626_0067444_628_1539 290
628 3300053108 Ga0500562_017191 Ga0500562_017191_69_980 290
629 3300006038 Ga0075365_10015384 Ga0075365_100153842 292
630 3300050491 nmdc:mga00v17_17742_c2 nmdc:mga00v17_17742_c2_126_1052 292
631 3300025939 Ga0207665_10099187 Ga0207665_100991872 293
632 3300005331 Ga0070670_100102481 Ga0070670_1001024812 294
633 3300005355 Ga0070671_100013019 Ga0070671_1000130194 294
634 3300005618 Ga0068864_100083451 Ga0068864_1000834513 294
635 3300005841 Ga0068863_100001514 Ga0068863_10000151420 294
636 3300006048 Ga0075363_100053215 Ga0075363_1000532152 294
637 3300025931 Ga0207644_10005208 Ga0207644_100052085 294
638 3300026088 Ga0207641_10003507 Ga0207641_100035076 294
639 3300026095 Ga0207676_10154531 Ga0207676_101545312 294
640 3300048905 Ga0496102_0000590 Ga0496102_0000590_19259_20179 294
641 3300048907 Ga0496104_0040855 Ga0496104_0040855_2120_3040 294
642 3300048913 Ga0496110_0040938 Ga0496110_0040938_1703_2623 294
643 3300048914 Ga0496111_0051875 Ga0496111_0051875_184_1104 294
644 3300050490 nmdc:mga03n38_48851_c1 nmdc:mga03n38_48851_c1_627_1553 294
645 3300050496 nmdc:mga07m45_35430_c1 nmdc:mga07m45_35430_c1_413_1354 296
646 3300001977 JGI24746J21847_1000089 JGI24746J21847_10000891 297
647 3300001991 JGI24743J22301_10021890 JGI24743J22301_100218901 297
648 3300002073 JGI24745J21846_1007302 JGI24745J21846_10073022 297
649 3300002244 JGI24742J22300_10012450 JGI24742J22300_100124502 297
650 3300005338 Ga0068868_100072971 Ga0068868_1000729712 297
651 3300005339 Ga0070660_100146561 Ga0070660_1001465612 297
652 3300005341 Ga0070691_10077817 Ga0070691_100778172 297
653 3300005343 Ga0070687_100063030 Ga0070687_1000630302 297
654 3300005356 Ga0070674_100038775 Ga0070674_1000387753 297
655 3300005365 Ga0070688_100057587 Ga0070688_1000575872 297
656 3300005367 Ga0070667_100482840 Ga0070667_1004828401 297
657 3300005434 Ga0070709_10055022 Ga0070709_100550222 297
658 3300005437 Ga0070710_10001923 Ga0070710_100019233 297
659 3300005438 Ga0070701_10027888 Ga0070701_100278882 297
660 3300005441 Ga0070700_100053837 Ga0070700_1000538372 297
661 3300005444 Ga0070694_100256217 Ga0070694_1002562171 297
662 3300005456 Ga0070678_100074709 Ga0070678_1000747091 297
663 3300005457 Ga0070662_100188999 Ga0070662_1001889992 297
664 3300005459 Ga0068867_100070938 Ga0068867_1000709382 297
665 3300005466 Ga0070685_10178881 Ga0070685_101788812 297
666 3300005539 Ga0068853_100098184 Ga0068853_1000981842 297
667 3300005543 Ga0070672_100207881 Ga0070672_1002078812 297
668 3300005546 Ga0070696_100047606 Ga0070696_1000476062 297
669 3300005547 Ga0070693_100027531 Ga0070693_1000275313 297
670 3300005548 Ga0070665_100045725 Ga0070665_1000457252 297
671 3300005578 Ga0068854_100311600 Ga0068854_1003116001 297
672 3300005615 Ga0070702_100057182 Ga0070702_1000571821 297
673 3300005616 Ga0068852_100276451 Ga0068852_1002764512 297
674 3300005617 Ga0068859_100150089 Ga0068859_1001500892 297
675 3300005718 Ga0068866_10020001 Ga0068866_100200012 297
676 3300005719 Ga0068861_100048334 Ga0068861_1000483343 297
677 3300005842 Ga0068858_100311764 Ga0068858_1003117642 297
678 3300005843 Ga0068860_100307401 Ga0068860_1003074012 297
679 3300005844 Ga0068862_100291228 Ga0068862_1002912282 297
680 3300006163 Ga0070715_10008358 Ga0070715_100083582 297
681 3300006173 Ga0070716_100015247 Ga0070716_1000152472 297
682 3300006175 Ga0070712_100017689 Ga0070712_1000176895 297
683 3300006358 Ga0068871_100259103 Ga0068871_1002591032 297
684 3300006881 Ga0068865_100053468 Ga0068865_1000534682 297
685 3300006931 Ga0097620_100150072 Ga0097620_1001500722 297
686 3300009176 Ga0105242_10232610 Ga0105242_102326102 297
687 3300009545 Ga0105237_10666168 Ga0105237_106661681 297
688 3300009553 Ga0105249_10413630 Ga0105249_104136302 297
689 3300011119 Ga0105246_10049630 Ga0105246_100496301 297
690 3300013105 Ga0157369_10466858 Ga0157369_104668582 297
691 3300013296 Ga0157374_10041784 Ga0157374_100417843 297
692 3300013307 Ga0157372_10071040 Ga0157372_100710403 297
693 3300013308 Ga0157375_10320237 Ga0157375_103202372 297
694 3300014326 Ga0157380_10155253 Ga0157380_101552532 297
695 3300014745 Ga0157377_10007912 Ga0157377_100079124 297
696 3300014968 Ga0157379_10133436 Ga0157379_101334361 297
697 3300025901 Ga0207688_10014587 Ga0207688_100145874 297
698 3300025905 Ga0207685_10024446 Ga0207685_100244462 297
699 3300025915 Ga0207693_10001690 Ga0207693_100016904 297
700 3300025916 Ga0207663_10017122 Ga0207663_100171222 297
701 3300025918 Ga0207662_10050271 Ga0207662_100502712 297
702 3300025927 Ga0207687_10416720 Ga0207687_104167201 297
703 3300025933 Ga0207706_10019781 Ga0207706_100197812 297
704 3300025939 Ga0207665_10020830 Ga0207665_100208302 297
705 3300025940 Ga0207691_10040532 Ga0207691_100405324 297
706 3300025942 Ga0207689_10009916 Ga0207689_100099166 297
707 3300025961 Ga0207712_10062243 Ga0207712_100622433 297
708 3300026023 Ga0207677_10038154 Ga0207677_100381543 297
709 3300026067 Ga0207678_10016407 Ga0207678_100164076 297
710 3300026075 Ga0207708_10005234 Ga0207708_100052346 297
711 3300026078 Ga0207702_10338627 Ga0207702_103386272 297
712 3300026089 Ga0207648_10026700 Ga0207648_100267004 297
713 3300026118 Ga0207675_100015022 Ga0207675_1000150224 297
714 3300026121 Ga0207683_10027425 Ga0207683_100274254 297
715 3300028379 Ga0268266_10045864 Ga0268266_100458643 297
716 3300048906 Ga0496103_0266308 Ga0496103_0266308_81_1010 297
717 3300048907 Ga0496104_0134453 Ga0496104_0134453_1190_2119 297
718 3300048911 Ga0496108_0000645 Ga0496108_0000645_20512_21441 297
719 3300048912 Ga0496109_0016603 Ga0496109_0016603_2303_3232 297
720 3300048914 Ga0496111_0083805 Ga0496111_0083805_354_1283 297
721 3300048917 Ga0496114_0097635 Ga0496114_0097635_1315_2244 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

119

307

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fh6-assembly2.cif.gz_I crystal structure of the resting state maltose transporter from e. coli 0.8958 84 287
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8468 40 287
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.8449 40 285
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8437 40 285
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8408 41 287
ID Description Score Start End Superfamily
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9386 40 287 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9156 39 287 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.899 40 283 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.896 39 287 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.883 41 287 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0C7P2A3-F1-model_v4 ABC-type maltose transport systems, permease component 0.97 65 297 GO:0005886
GO:0055085
AF-A0A7C4PI02-F1-model_v4 Carbohydrate ABC transporter permease 0.9699 81 294 GO:0005886
GO:0055085
AF-A0A1V5IV80-F1-model_v4 L-arabinose transport system permease protein AraQ 0.9665 86 297 GO:0005886
GO:0055085
AF-A0A2S8PH27-F1-model_v4 ABC transporter permease 0.9657 89 295 GO:0005886
GO:0055085
AF-A0A661TPQ6-F1-model_v4 Carbohydrate ABC transporter permease 0.965 81 297 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
76.79 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map