F477368
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 721 | 364 | 711 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300025939|Ga0207665_10099187|Ga0207665_100991872 |
| Length | 312 |
| Sequence | MTKPQFSTLAAEPAPPVADRTAAPVPPGRRWRPRLRLPFSPWHLVLIPLSFILVVPLLWMLVTSLETEGEANRFPPVLIPERPRFENYSEAWAAAPFGHFFVNSALVTLVVLVSNLVVCSLAGYAFARIRFLGRGALFVTLMATLMVPFQVTMIPVFLIVKWFGDNVWAGLGIDHIGALMLPNLATAFGIFFLRQFFQTVPVELEEAARVDGTSRLGVLFKIVLPLSLPALSTLAALTVLTSWNDFLWPLIVITSQDQMTIPLGLSYFQGAHRVKWPLLMAANVMSLLPMLLVFIGAQRYFVQSVASTGLKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 3 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 4 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 5 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 6 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 7 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 8 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 9 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 14 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 181 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 182 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 183 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 184 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 186 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 200 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 201 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 202 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 203 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 206 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 220 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 221 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 222 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 223 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 224 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 225 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 226 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 227 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 228 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 229 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 230 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 231 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 232 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 233 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 234 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 235 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 236 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 237 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 238 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 239 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 240 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 241 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 311 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 312 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 313 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 314 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 315 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 316 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 317 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 318 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 337 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 338 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 339 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 349 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 352 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 354 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 355 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 356 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 357 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 358 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 359 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 360 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 364 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.34 |
| Metatranscriptomes | 0.28 |
| Isolates | 1.39 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.46 |
| Nodule | 0 |
| Rhizoplane | 7.77 |
| Rhizosphere | 80.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000089 | 3300001977 | Bacteria | 10008 |
| 2 | JGI24743J22301_10021890 | 3300001991 | Bacteria | 1223 |
| 3 | JGI24735J21928_10032869 | 3300002067 | Bacteria | 1535 |
| 4 | JGI24745J21846_1007302 | 3300002073 | Bacteria | 1235 |
| 5 | JGI24748J21848_1002478 | 3300002074 | Bacteria | 2083 |
| 6 | JGI24738J21930_10003332 | 3300002075 | Bacteria | 4074 |
| 7 | JGI24744J21845_10000059 | 3300002077 | Bacteria | 13116 |
| 8 | JGI24742J22300_10000896 | 3300002244 | Bacteria | 4563 |
| 9 | JGI24742J22300_10012450 | 3300002244 | Bacteria | 1418 |
| 10 | JGI25406J46586_10021790 | 3300003203 | Bacteria | 2565 |
| 11 | Ga0055540_1000941 | 3300003792 | Bacteria | 18922 |
| 12 | Ga0055540_1001155 | 3300003792 | Bacteria | 16426 |
| 13 | Ga0055540_1002276 | 3300003792 | Bacteria | 10354 |
| 14 | Ga0058862_12428665 | 3300004803 | Unclassified | 1415 |
| 15 | Ga0070683_100141571 | 3300005329 | Bacteria | 2279 |
| 16 | Ga0070670_100102481 | 3300005331 | Bacteria | 2465 |
| 17 | Ga0070682_100014158 | 3300005337 | Bacteria | 4606 |
| 18 | Ga0070682_100090665 | 3300005337 | Bacteria | 1999 |
| 19 | Ga0070682_100211224 | 3300005337 | Bacteria | 1375 |
| 20 | Ga0068868_100000529 | 3300005338 | Bacteria | 25593 |
| 21 | Ga0068868_100072971 | 3300005338 | Bacteria | 2739 |
| 22 | Ga0070660_100146561 | 3300005339 | Bacteria | 1896 |
| 23 | Ga0070660_100244164 | 3300005339 | Bacteria | 1463 |
| 24 | Ga0070691_10077817 | 3300005341 | Bacteria | 1619 |
| 25 | Ga0070687_100033142 | 3300005343 | Bacteria | 2547 |
| 26 | Ga0070687_100063030 | 3300005343 | Bacteria | 1964 |
| 27 | Ga0070692_10035737 | 3300005345 | Bacteria | 2517 |
| 28 | Ga0070668_100005441 | 3300005347 | Bacteria | 9451 |
| 29 | Ga0070669_100023391 | 3300005353 | Bacteria | 4424 |
| 30 | Ga0070671_100013019 | 3300005355 | Bacteria | 6704 |
| 31 | Ga0070671_100228139 | 3300005355 | Bacteria | 1580 |
| 32 | Ga0070674_100003430 | 3300005356 | Bacteria | 8897 |
| 33 | Ga0070674_100038775 | 3300005356 | Bacteria | 3213 |
| 34 | Ga0070688_100057587 | 3300005365 | Bacteria | 2443 |
| 35 | Ga0070659_100040259 | 3300005366 | Bacteria | 3651 |
| 36 | Ga0070667_100002267 | 3300005367 | Bacteria | 16931 |
| 37 | Ga0070667_100048331 | 3300005367 | Bacteria | 3581 |
| 38 | Ga0070667_100482840 | 3300005367 | Bacteria | 1134 |
| 39 | Ga0070703_10000001 | 3300005406 | Bacteria | 202194 |
| 40 | Ga0070709_10055022 | 3300005434 | Bacteria | 2511 |
| 41 | Ga0070714_100003345 | 3300005435 | Bacteria | 11961 |
| 42 | Ga0070714_100051812 | 3300005435 | Bacteria | 3500 |
| 43 | Ga0070713_100004385 | 3300005436 | Bacteria | 9479 |
| 44 | Ga0070713_100021003 | 3300005436 | Bacteria | 5013 |
| 45 | Ga0070713_100021199 | 3300005436 | Bacteria | 4993 |
| 46 | Ga0070713_100040216 | 3300005436 | Bacteria | 3800 |
| 47 | Ga0070713_100078053 | 3300005436 | Bacteria | 2818 |
| 48 | Ga0070710_10000900 | 3300005437 | Bacteria | 14236 |
| 49 | Ga0070710_10001923 | 3300005437 | Bacteria | 9836 |
| 50 | Ga0070710_10003412 | 3300005437 | Bacteria | 7527 |
| 51 | Ga0070710_10027440 | 3300005437 | Bacteria | 3036 |
| 52 | Ga0070710_10274469 | 3300005437 | Bacteria | 1092 |
| 53 | Ga0070701_10003486 | 3300005438 | Bacteria | 6233 |
| 54 | Ga0070701_10027888 | 3300005438 | Bacteria | 2771 |
| 55 | Ga0070711_100001095 | 3300005439 | Bacteria | 14465 |
| 56 | Ga0070711_100001607 | 3300005439 | Bacteria | 12467 |
| 57 | Ga0070711_100261435 | 3300005439 | Bacteria | 1362 |
| 58 | Ga0070705_100051171 | 3300005440 | Bacteria | 2407 |
| 59 | Ga0070705_100275775 | 3300005440 | Bacteria | 1193 |
| 60 | Ga0070700_100009233 | 3300005441 | Bacteria | 5406 |
| 61 | Ga0070700_100017215 | 3300005441 | Bacteria | 4128 |
| 62 | Ga0070700_100053837 | 3300005441 | Bacteria | 2513 |
| 63 | Ga0070694_100122060 | 3300005444 | Bacteria | 1871 |
| 64 | Ga0070694_100256217 | 3300005444 | Bacteria | 1326 |
| 65 | Ga0070708_100001542 | 3300005445 | Bacteria | 17625 |
| 66 | Ga0070708_100005610 | 3300005445 | Bacteria | 9950 |
| 67 | Ga0070708_100309692 | 3300005445 | Bacteria | 1487 |
| 68 | Ga0070663_100063252 | 3300005455 | Bacteria | 2671 |
| 69 | Ga0070678_100009361 | 3300005456 | Bacteria | 5929 |
| 70 | Ga0070678_100074709 | 3300005456 | Bacteria | 2548 |
| 71 | Ga0070678_100194916 | 3300005456 | Bacteria | 1668 |
| 72 | Ga0070662_100017040 | 3300005457 | Bacteria | 4889 |
| 73 | Ga0070662_100188999 | 3300005457 | Bacteria | 1627 |
| 74 | Ga0068867_100001323 | 3300005459 | Bacteria | 17157 |
| 75 | Ga0068867_100070938 | 3300005459 | Bacteria | 2605 |
| 76 | Ga0068867_100093721 | 3300005459 | Bacteria | 2283 |
| 77 | Ga0070685_10178881 | 3300005466 | Bacteria | 1364 |
| 78 | Ga0070706_100003990 | 3300005467 | Bacteria | 14367 |
| 79 | Ga0070706_100010233 | 3300005467 | Bacteria | 8717 |
| 80 | Ga0070706_100020205 | 3300005467 | Bacteria | 6137 |
| 81 | Ga0070706_100143748 | 3300005467 | Bacteria | 2227 |
| 82 | Ga0070706_100209148 | 3300005467 | Bacteria | 1822 |
| 83 | Ga0070707_100000041 | 3300005468 | Bacteria | 111077 |
| 84 | Ga0070707_100008503 | 3300005468 | Bacteria | 9535 |
| 85 | Ga0070707_100011480 | 3300005468 | Bacteria | 8262 |
| 86 | Ga0070707_100030744 | 3300005468 | Bacteria | 5115 |
| 87 | Ga0070707_100209642 | 3300005468 | Bacteria | 1899 |
| 88 | Ga0070698_100000082 | 3300005471 | Bacteria | 73573 |
| 89 | Ga0070698_100001142 | 3300005471 | Bacteria | 29387 |
| 90 | Ga0070698_100001184 | 3300005471 | Bacteria | 28906 |
| 91 | Ga0070698_100001707 | 3300005471 | Bacteria | 24503 |
| 92 | Ga0070698_100088595 | 3300005471 | Bacteria | 3080 |
| 93 | Ga0070698_100225844 | 3300005471 | Bacteria | 1806 |
| 94 | Ga0070698_100538532 | 3300005471 | Bacteria | 1107 |
| 95 | Ga0070699_100000528 | 3300005518 | Bacteria | 36100 |
| 96 | Ga0070699_100009389 | 3300005518 | Bacteria | 8473 |
| 97 | Ga0070699_100024677 | 3300005518 | Bacteria | 5183 |
| 98 | Ga0070679_100100836 | 3300005530 | Bacteria | 2873 |
| 99 | Ga0070684_100007016 | 3300005535 | Bacteria | 8754 |
| 100 | Ga0070684_100050062 | 3300005535 | Bacteria | 3628 |
| 101 | Ga0070697_100205425 | 3300005536 | Bacteria | 1675 |
| 102 | Ga0068853_100016775 | 3300005539 | Bacteria | 6034 |
| 103 | Ga0068853_100098184 | 3300005539 | Bacteria | 2586 |
| 104 | Ga0070672_100069003 | 3300005543 | Bacteria | 2805 |
| 105 | Ga0070672_100207881 | 3300005543 | Bacteria | 1639 |
| 106 | Ga0070686_100313683 | 3300005544 | Bacteria | 1167 |
| 107 | Ga0070696_100003305 | 3300005546 | Bacteria | 10765 |
| 108 | Ga0070696_100003753 | 3300005546 | Bacteria | 10149 |
| 109 | Ga0070696_100047606 | 3300005546 | Bacteria | 2975 |
| 110 | Ga0070693_100027531 | 3300005547 | Bacteria | 3082 |
| 111 | Ga0070693_100039640 | 3300005547 | Bacteria | 2640 |
| 112 | Ga0070665_100001745 | 3300005548 | Bacteria | 24881 |
| 113 | Ga0070665_100015595 | 3300005548 | Bacteria | 7634 |
| 114 | Ga0070665_100045725 | 3300005548 | Bacteria | 4396 |
| 115 | Ga0070665_100307865 | 3300005548 | Bacteria | 1587 |
| 116 | Ga0070665_100389553 | 3300005548 | Bacteria | 1401 |
| 117 | Ga0070704_100000706 | 3300005549 | Bacteria | 16275 |
| 118 | Ga0070704_100121270 | 3300005549 | Bacteria | 2009 |
| 119 | Ga0068855_100055086 | 3300005563 | Bacteria | 4672 |
| 120 | Ga0070664_100047870 | 3300005564 | Bacteria | 3614 |
| 121 | Ga0068857_100011640 | 3300005577 | Bacteria | 7652 |
| 122 | Ga0068854_100001286 | 3300005578 | Bacteria | 15104 |
| 123 | Ga0068854_100030428 | 3300005578 | Bacteria | 3745 |
| 124 | Ga0068854_100311600 | 3300005578 | Bacteria | 1277 |
| 125 | Ga0068856_100004148 | 3300005614 | Bacteria | 14481 |
| 126 | Ga0068856_100317942 | 3300005614 | Bacteria | 1574 |
| 127 | Ga0070702_100057182 | 3300005615 | Bacteria | 2255 |
| 128 | Ga0068852_100040065 | 3300005616 | Bacteria | 3950 |
| 129 | Ga0068852_100276451 | 3300005616 | Bacteria | 1617 |
| 130 | Ga0068859_100003134 | 3300005617 | Bacteria | 16809 |
| 131 | Ga0068859_100093089 | 3300005617 | Bacteria | 3065 |
| 132 | Ga0068859_100150089 | 3300005617 | Bacteria | 2406 |
| 133 | Ga0068864_100083451 | 3300005618 | Bacteria | 2806 |
| 134 | Ga0068864_100342077 | 3300005618 | Bacteria | 1410 |
| 135 | Ga0068866_10000376 | 3300005718 | Bacteria | 21007 |
| 136 | Ga0068866_10013060 | 3300005718 | Bacteria | 3633 |
| 137 | Ga0068866_10020001 | 3300005718 | Bacteria | 3059 |
| 138 | Ga0068861_100018600 | 3300005719 | Bacteria | 4951 |
| 139 | Ga0068861_100048334 | 3300005719 | Bacteria | 3215 |
| 140 | Ga0068863_100001514 | 3300005841 | Bacteria | 22958 |
| 141 | Ga0068863_100308739 | 3300005841 | Bacteria | 1535 |
| 142 | Ga0068858_100002465 | 3300005842 | Bacteria | 18668 |
| 143 | Ga0068858_100009962 | 3300005842 | Bacteria | 9028 |
| 144 | Ga0068858_100311764 | 3300005842 | Bacteria | 1502 |
| 145 | Ga0068858_100445074 | 3300005842 | Bacteria | 1248 |
| 146 | Ga0068860_100025928 | 3300005843 | Bacteria | 5656 |
| 147 | Ga0068860_100307401 | 3300005843 | Bacteria | 1554 |
| 148 | Ga0068862_100002116 | 3300005844 | Bacteria | 17897 |
| 149 | Ga0068862_100246674 | 3300005844 | Bacteria | 1626 |
| 150 | Ga0068862_100291228 | 3300005844 | Bacteria | 1499 |
| 151 | Ga0081455_10001614 | 3300005937 | Bacteria | 27559 |
| 152 | Ga0081540_1000505 | 3300005983 | Bacteria | 38435 |
| 153 | Ga0081539_10001504 | 3300005985 | Bacteria | 39371 |
| 154 | Ga0070717_10018280 | 3300006028 | Bacteria | 5470 |
| 155 | Ga0070717_10034026 | 3300006028 | Bacteria | 4116 |
| 156 | Ga0075365_10005332 | 3300006038 | Bacteria | 6922 |
| 157 | Ga0075365_10015384 | 3300006038 | Bacteria | 4627 |
| 158 | Ga0075365_10152450 | 3300006038 | Bacteria | 1608 |
| 159 | Ga0075365_10179843 | 3300006038 | Bacteria | 1478 |
| 160 | Ga0075363_100000787 | 3300006048 | Bacteria | 10932 |
| 161 | Ga0075363_100002644 | 3300006048 | Bacteria | 7388 |
| 162 | Ga0075363_100014116 | 3300006048 | Bacteria | 3893 |
| 163 | Ga0075363_100044130 | 3300006048 | Bacteria | 2361 |
| 164 | Ga0075363_100053215 | 3300006048 | Bacteria | 2163 |
| 165 | Ga0075364_10000184 | 3300006051 | Bacteria | 28604 |
| 166 | Ga0075364_10006965 | 3300006051 | Bacteria | 6679 |
| 167 | Ga0075364_10040448 | 3300006051 | Bacteria | 3024 |
| 168 | Ga0070715_10008358 | 3300006163 | Bacteria | 3605 |
| 169 | Ga0070715_10010496 | 3300006163 | Bacteria | 3303 |
| 170 | Ga0070715_10010773 | 3300006163 | Bacteria | 3270 |
| 171 | Ga0070716_100002661 | 3300006173 | Bacteria | 8264 |
| 172 | Ga0070716_100004017 | 3300006173 | Bacteria | 6984 |
| 173 | Ga0070716_100015247 | 3300006173 | Bacteria | 3945 |
| 174 | Ga0070712_100001062 | 3300006175 | Bacteria | 16596 |
| 175 | Ga0070712_100017689 | 3300006175 | Bacteria | 4618 |
| 176 | Ga0070712_100109699 | 3300006175 | Bacteria | 2057 |
| 177 | Ga0070712_100263628 | 3300006175 | Bacteria | 1381 |
| 178 | Ga0075362_10001354 | 3300006177 | Bacteria | 7756 |
| 179 | Ga0075367_10001919 | 3300006178 | Bacteria | 9229 |
| 180 | Ga0075369_10001695 | 3300006186 | Bacteria | 7622 |
| 181 | Ga0075369_10010682 | 3300006186 | Bacteria | 3596 |
| 182 | Ga0075369_10047085 | 3300006186 | Bacteria | 1859 |
| 183 | Ga0075366_10018409 | 3300006195 | Bacteria | 4031 |
| 184 | Ga0097621_100015140 | 3300006237 | Bacteria | 5795 |
| 185 | Ga0075370_10008783 | 3300006353 | Bacteria | 5215 |
| 186 | Ga0075370_10127936 | 3300006353 | Bacteria | 1481 |
| 187 | Ga0068871_100259103 | 3300006358 | Bacteria | 1517 |
| 188 | Ga0075428_100051463 | 3300006844 | Bacteria | 4516 |
| 189 | Ga0075434_100003943 | 3300006871 | Bacteria | 13290 |
| 190 | Ga0068865_100000828 | 3300006881 | Bacteria | 17443 |
| 191 | Ga0068865_100011634 | 3300006881 | Bacteria | 5514 |
| 192 | Ga0068865_100030675 | 3300006881 | Bacteria | 3578 |
| 193 | Ga0068865_100053468 | 3300006881 | Bacteria | 2802 |
| 194 | Ga0097620_100003133 | 3300006931 | Bacteria | 16809 |
| 195 | Ga0097620_100093087 | 3300006931 | Bacteria | 3065 |
| 196 | Ga0097620_100150072 | 3300006931 | Bacteria | 2406 |
| 197 | Ga0075435_100007491 | 3300007076 | Bacteria | 7786 |
| 198 | Ga0075435_100079477 | 3300007076 | Bacteria | 2692 |
| 199 | Ga0105240_10420787 | 3300009093 | Bacteria | 1501 |
| 200 | Ga0111539_10241974 | 3300009094 | Bacteria | 2101 |
| 201 | Ga0105245_10003220 | 3300009098 | Bacteria | 14625 |
| 202 | Ga0105245_10060787 | 3300009098 | Bacteria | 3403 |
| 203 | Ga0105245_10571908 | 3300009098 | Bacteria | 1154 |
| 204 | Ga0105247_10004659 | 3300009101 | Bacteria | 8741 |
| 205 | Ga0105247_10031108 | 3300009101 | Bacteria | 3238 |
| 206 | Ga0114129_10039891 | 3300009147 | Bacteria | 6623 |
| 207 | Ga0105243_10003249 | 3300009148 | Bacteria | 13257 |
| 208 | Ga0105243_10007191 | 3300009148 | Bacteria | 8556 |
| 209 | Ga0105243_10028694 | 3300009148 | Bacteria | 4273 |
| 210 | Ga0105241_10019951 | 3300009174 | Bacteria | 4948 |
| 211 | Ga0105242_10000620 | 3300009176 | Bacteria | 27832 |
| 212 | Ga0105242_10232610 | 3300009176 | Bacteria | 1652 |
| 213 | Ga0105242_10396592 | 3300009176 | Bacteria | 1287 |
| 214 | Ga0105242_10644314 | 3300009176 | Bacteria | 1029 |
| 215 | Ga0105248_10008918 | 3300009177 | Bacteria | 11025 |
| 216 | Ga0105248_10044839 | 3300009177 | Bacteria | 4960 |
| 217 | Ga0105248_10702917 | 3300009177 | Bacteria | 1141 |
| 218 | Ga0105237_10000178 | 3300009545 | Bacteria | 89960 |
| 219 | Ga0105237_10002564 | 3300009545 | Bacteria | 22427 |
| 220 | Ga0105237_10034235 | 3300009545 | Bacteria | 5144 |
| 221 | Ga0105237_10666168 | 3300009545 | Bacteria | 1047 |
| 222 | Ga0105249_10000767 | 3300009553 | Bacteria | 28791 |
| 223 | Ga0105249_10181192 | 3300009553 | Bacteria | 2050 |
| 224 | Ga0105249_10413630 | 3300009553 | Bacteria | 1381 |
| 225 | Ga0105249_10430988 | 3300009553 | Bacteria | 1354 |
| 226 | Ga0105239_10007516 | 3300010375 | Bacteria | 12498 |
| 227 | Ga0105239_10007818 | 3300010375 | Bacteria | 12230 |
| 228 | Ga0105239_10030663 | 3300010375 | Bacteria | 5914 |
| 229 | Ga0105246_10049630 | 3300011119 | Bacteria | 2875 |
| 230 | Ga0105246_10390088 | 3300011119 | Bacteria | 1153 |
| 231 | Ga0157371_10134550 | 3300013102 | Bacteria | 1760 |
| 232 | Ga0157370_10413230 | 3300013104 | Bacteria | 1242 |
| 233 | Ga0157369_10239525 | 3300013105 | Bacteria | 1895 |
| 234 | Ga0157369_10466858 | 3300013105 | Bacteria | 1307 |
| 235 | Ga0157374_10041784 | 3300013296 | Bacteria | 4227 |
| 236 | Ga0157374_10047571 | 3300013296 | Bacteria | 3977 |
| 237 | Ga0157378_10001690 | 3300013297 | Bacteria | 19860 |
| 238 | Ga0163162_10003614 | 3300013306 | Bacteria | 14814 |
| 239 | Ga0163162_10026392 | 3300013306 | Bacteria | 5740 |
| 240 | Ga0163162_10112849 | 3300013306 | Bacteria | 2817 |
| 241 | Ga0157372_10026882 | 3300013307 | Bacteria | 6264 |
| 242 | Ga0157372_10071040 | 3300013307 | Bacteria | 3919 |
| 243 | Ga0157375_10003452 | 3300013308 | Bacteria | 13692 |
| 244 | Ga0157375_10320237 | 3300013308 | Bacteria | 1715 |
| 245 | Ga0157375_10786924 | 3300013308 | Bacteria | 1101 |
| 246 | Ga0163163_10124419 | 3300014325 | Bacteria | 2615 |
| 247 | Ga0157380_10003813 | 3300014326 | Bacteria | 10374 |
| 248 | Ga0157380_10155253 | 3300014326 | Bacteria | 1983 |
| 249 | Ga0157380_10261497 | 3300014326 | Bacteria | 1572 |
| 250 | Ga0157377_10007912 | 3300014745 | Bacteria | 5159 |
| 251 | Ga0157379_10037357 | 3300014968 | Bacteria | 4330 |
| 252 | Ga0157379_10133436 | 3300014968 | Bacteria | 2236 |
| 253 | Ga0157376_10072953 | 3300014969 | Bacteria | 2921 |
| 254 | Ga0157376_10192746 | 3300014969 | Bacteria | 1870 |
| 255 | Ga0213875_10000604 | 3300021388 | Bacteria | 29093 |
| 256 | Ga0209673_1008102 | 3300025273 | Bacteria | 4724 |
| 257 | Ga0209051_1000528 | 3300025303 | Bacteria | 47444 |
| 258 | Ga0209051_1001208 | 3300025303 | Bacteria | 23322 |
| 259 | Ga0209051_1006114 | 3300025303 | Bacteria | 6849 |
| 260 | Ga0209051_1008439 | 3300025303 | Bacteria | 5451 |
| 261 | Ga0209051_1028400 | 3300025303 | Bacteria | 2210 |
| 262 | Ga0207653_10000004 | 3300025885 | Bacteria | 263142 |
| 263 | Ga0207692_10001870 | 3300025898 | Bacteria | 7987 |
| 264 | Ga0207692_10019953 | 3300025898 | Bacteria | 3040 |
| 265 | Ga0207692_10022310 | 3300025898 | Bacteria | 2911 |
| 266 | Ga0207692_10022696 | 3300025898 | Bacteria | 2892 |
| 267 | Ga0207642_10002962 | 3300025899 | Bacteria | 5313 |
| 268 | Ga0207642_10032954 | 3300025899 | Bacteria | 2187 |
| 269 | Ga0207710_10043734 | 3300025900 | Bacteria | 1993 |
| 270 | Ga0207688_10000352 | 3300025901 | Bacteria | 21384 |
| 271 | Ga0207688_10014587 | 3300025901 | Bacteria | 4269 |
| 272 | Ga0207688_10045040 | 3300025901 | Bacteria | 2460 |
| 273 | Ga0207688_10178121 | 3300025901 | Bacteria | 1267 |
| 274 | Ga0207680_10022427 | 3300025903 | Bacteria | 3433 |
| 275 | Ga0207685_10004410 | 3300025905 | Bacteria | 3573 |
| 276 | Ga0207685_10024446 | 3300025905 | Bacteria | 2071 |
| 277 | Ga0207699_10002495 | 3300025906 | Bacteria | 8691 |
| 278 | Ga0207699_10012397 | 3300025906 | Bacteria | 4336 |
| 279 | Ga0207645_10179654 | 3300025907 | Bacteria | 1388 |
| 280 | Ga0207684_10000339 | 3300025910 | Bacteria | 65102 |
| 281 | Ga0207684_10000911 | 3300025910 | Bacteria | 33666 |
| 282 | Ga0207684_10083146 | 3300025910 | Bacteria | 2726 |
| 283 | Ga0207684_10119551 | 3300025910 | Bacteria | 2258 |
| 284 | Ga0207684_10170973 | 3300025910 | Bacteria | 1873 |
| 285 | Ga0207684_10212783 | 3300025910 | Bacteria | 1668 |
| 286 | Ga0207684_10507067 | 3300025910 | Bacteria | 1034 |
| 287 | Ga0207671_10008270 | 3300025914 | Bacteria | 8850 |
| 288 | Ga0207671_10019320 | 3300025914 | Bacteria | 5211 |
| 289 | Ga0207671_10092022 | 3300025914 | Bacteria | 2286 |
| 290 | Ga0207693_10001171 | 3300025915 | Bacteria | 23404 |
| 291 | Ga0207693_10001690 | 3300025915 | Bacteria | 19437 |
| 292 | Ga0207693_10072192 | 3300025915 | Bacteria | 2703 |
| 293 | Ga0207693_10164815 | 3300025915 | Bacteria | 1744 |
| 294 | Ga0207693_10424985 | 3300025915 | Bacteria | 1039 |
| 295 | Ga0207663_10005265 | 3300025916 | Bacteria | 6513 |
| 296 | Ga0207663_10017122 | 3300025916 | Bacteria | 4032 |
| 297 | Ga0207663_10139692 | 3300025916 | Bacteria | 1686 |
| 298 | Ga0207663_10159109 | 3300025916 | Bacteria | 1592 |
| 299 | Ga0207662_10050271 | 3300025918 | Bacteria | 2476 |
| 300 | Ga0207646_10000061 | 3300025922 | Bacteria | 151425 |
| 301 | Ga0207646_10004855 | 3300025922 | Bacteria | 14404 |
| 302 | Ga0207646_10007478 | 3300025922 | Bacteria | 11089 |
| 303 | Ga0207646_10020298 | 3300025922 | Bacteria | 6158 |
| 304 | Ga0207681_10034439 | 3300025923 | Bacteria | 3330 |
| 305 | Ga0207681_10415696 | 3300025923 | Bacteria | 1089 |
| 306 | Ga0207687_10001147 | 3300025927 | Bacteria | 18035 |
| 307 | Ga0207687_10176759 | 3300025927 | Bacteria | 1651 |
| 308 | Ga0207687_10416720 | 3300025927 | Bacteria | 1108 |
| 309 | Ga0207700_10006098 | 3300025928 | Bacteria | 7263 |
| 310 | Ga0207700_10020021 | 3300025928 | Bacteria | 4534 |
| 311 | Ga0207700_10025193 | 3300025928 | Bacteria | 4128 |
| 312 | Ga0207700_10029504 | 3300025928 | Bacteria | 3871 |
| 313 | Ga0207700_10078194 | 3300025928 | Bacteria | 2572 |
| 314 | Ga0207700_10179931 | 3300025928 | Bacteria | 1770 |
| 315 | Ga0207700_10181062 | 3300025928 | Bacteria | 1764 |
| 316 | Ga0207700_10378642 | 3300025928 | Bacteria | 1237 |
| 317 | Ga0207664_10002329 | 3300025929 | Bacteria | 12548 |
| 318 | Ga0207664_10002605 | 3300025929 | Bacteria | 11947 |
| 319 | Ga0207664_10024393 | 3300025929 | Bacteria | 4544 |
| 320 | Ga0207664_10032064 | 3300025929 | Bacteria | 4025 |
| 321 | Ga0207664_10181647 | 3300025929 | Bacteria | 1806 |
| 322 | Ga0207664_10474410 | 3300025929 | Bacteria | 1119 |
| 323 | Ga0207644_10005208 | 3300025931 | Bacteria | 8493 |
| 324 | Ga0207690_10053908 | 3300025932 | Bacteria | 2701 |
| 325 | Ga0207706_10001128 | 3300025933 | Bacteria | 27189 |
| 326 | Ga0207706_10019781 | 3300025933 | Bacteria | 6054 |
| 327 | Ga0207709_10007186 | 3300025935 | Bacteria | 6215 |
| 328 | Ga0207709_10184937 | 3300025935 | Bacteria | 1475 |
| 329 | Ga0207709_10547072 | 3300025935 | Bacteria | 910 |
| 330 | Ga0207670_10147758 | 3300025936 | Bacteria | 1740 |
| 331 | Ga0207704_10000377 | 3300025938 | Bacteria | 20506 |
| 332 | Ga0207704_10185174 | 3300025938 | Bacteria | 1509 |
| 333 | Ga0207665_10001670 | 3300025939 | Bacteria | 14929 |
| 334 | Ga0207665_10005772 | 3300025939 | Bacteria | 8231 |
| 335 | Ga0207665_10020830 | 3300025939 | Bacteria | 4311 |
| 336 | Ga0207665_10099187 | 3300025939 | Bacteria | 2031 |
| 337 | Ga0207691_10040532 | 3300025940 | Bacteria | 4302 |
| 338 | Ga0207691_10053456 | 3300025940 | Bacteria | 3687 |
| 339 | Ga0207711_10051435 | 3300025941 | Bacteria | 3528 |
| 340 | Ga0207711_10100926 | 3300025941 | Bacteria | 2553 |
| 341 | Ga0207689_10009916 | 3300025942 | Bacteria | 8213 |
| 342 | Ga0207661_10003465 | 3300025944 | Bacteria | 10957 |
| 343 | Ga0207661_10124084 | 3300025944 | Bacteria | 2203 |
| 344 | Ga0207661_10370158 | 3300025944 | Bacteria | 1295 |
| 345 | Ga0207712_10062243 | 3300025961 | Bacteria | 2652 |
| 346 | Ga0207712_10518163 | 3300025961 | Bacteria | 1021 |
| 347 | Ga0207668_10029780 | 3300025972 | Bacteria | 3581 |
| 348 | Ga0207668_10081132 | 3300025972 | Bacteria | 2352 |
| 349 | Ga0207640_10003409 | 3300025981 | Bacteria | 8561 |
| 350 | Ga0207658_10014963 | 3300025986 | Bacteria | 5319 |
| 351 | Ga0207658_10034788 | 3300025986 | Bacteria | 3603 |
| 352 | Ga0207677_10038154 | 3300026023 | Bacteria | 3147 |
| 353 | Ga0207677_10044279 | 3300026023 | Bacteria | 2964 |
| 354 | Ga0207677_10210639 | 3300026023 | Bacteria | 1552 |
| 355 | Ga0207677_10236837 | 3300026023 | Bacteria | 1474 |
| 356 | Ga0207703_10014135 | 3300026035 | Bacteria | 6223 |
| 357 | Ga0207703_10055546 | 3300026035 | Bacteria | 3222 |
| 358 | Ga0207639_10034426 | 3300026041 | Bacteria | 3744 |
| 359 | Ga0207639_10224493 | 3300026041 | Bacteria | 1624 |
| 360 | Ga0207678_10003778 | 3300026067 | Bacteria | 13614 |
| 361 | Ga0207678_10016407 | 3300026067 | Bacteria | 6503 |
| 362 | Ga0207678_10114208 | 3300026067 | Bacteria | 2304 |
| 363 | Ga0207678_10414553 | 3300026067 | Bacteria | 1167 |
| 364 | Ga0207708_10001592 | 3300026075 | Bacteria | 16942 |
| 365 | Ga0207708_10005234 | 3300026075 | Bacteria | 9557 |
| 366 | Ga0207708_10006707 | 3300026075 | Bacteria | 8516 |
| 367 | Ga0207708_10009373 | 3300026075 | Bacteria | 7248 |
| 368 | Ga0207702_10002286 | 3300026078 | Bacteria | 18386 |
| 369 | Ga0207702_10338627 | 3300026078 | Bacteria | 1437 |
| 370 | Ga0207641_10003507 | 3300026088 | Bacteria | 13886 |
| 371 | Ga0207641_10134177 | 3300026088 | Bacteria | 2226 |
| 372 | Ga0207648_10001355 | 3300026089 | Bacteria | 27091 |
| 373 | Ga0207648_10026700 | 3300026089 | Bacteria | 5129 |
| 374 | Ga0207648_10116894 | 3300026089 | Bacteria | 2344 |
| 375 | Ga0207676_10154531 | 3300026095 | Bacteria | 1980 |
| 376 | Ga0207674_10019592 | 3300026116 | Bacteria | 7326 |
| 377 | Ga0207675_100006054 | 3300026118 | Bacteria | 11511 |
| 378 | Ga0207675_100015022 | 3300026118 | Bacteria | 7224 |
| 379 | Ga0207683_10000201 | 3300026121 | Bacteria | 51559 |
| 380 | Ga0207683_10027425 | 3300026121 | Bacteria | 4922 |
| 381 | Ga0207428_10127037 | 3300027907 | Bacteria | 1952 |
| 382 | Ga0268266_10045864 | 3300028379 | Bacteria | 3741 |
| 383 | Ga0268266_10142200 | 3300028379 | Bacteria | 2154 |
| 384 | Ga0268266_10174708 | 3300028379 | Bacteria | 1952 |
| 385 | Ga0268266_10272479 | 3300028379 | Bacteria | 1572 |
| 386 | Ga0268264_10031711 | 3300028381 | Bacteria | 4333 |
| 387 | Ga0268264_10209352 | 3300028381 | Bacteria | 1789 |
| 388 | Ga0265337_1000027 | 3300028556 | Bacteria | 68392 |
| 389 | Ga0265326_10001234 | 3300028558 | Bacteria | 9119 |
| 390 | Ga0265319_1001055 | 3300028563 | Bacteria | 17217 |
| 391 | Ga0265334_10000773 | 3300028573 | Bacteria | 16014 |
| 392 | Ga0265318_10099600 | 3300028577 | Bacteria | 1069 |
| 393 | Ga0265323_10082254 | 3300028653 | Bacteria | 1086 |
| 394 | Ga0265322_10001284 | 3300028654 | Bacteria | 8433 |
| 395 | Ga0265336_10002288 | 3300028666 | Bacteria | 8003 |
| 396 | Ga0265336_10019643 | 3300028666 | Bacteria | 2178 |
| 397 | Ga0265338_10000227 | 3300028800 | Bacteria | 104795 |
| 398 | Ga0265338_10000868 | 3300028800 | Bacteria | 51299 |
| 399 | Ga0265338_10007886 | 3300028800 | Bacteria | 13062 |
| 400 | Ga0265324_10004386 | 3300029957 | Bacteria | 6400 |
| 401 | Ga0265332_10001185 | 3300031238 | Bacteria | 15099 |
| 402 | Ga0265320_10049797 | 3300031240 | Bacteria | 2038 |
| 403 | Ga0265340_10005777 | 3300031247 | Bacteria | 6842 |
| 404 | Ga0265316_10007705 | 3300031344 | Bacteria | 10091 |
| 405 | Ga0265313_10010516 | 3300031595 | Bacteria | 5839 |
| 406 | Ga0265314_10010105 | 3300031711 | Bacteria | 7910 |
| 407 | Ga0265342_10012177 | 3300031712 | Bacteria | 5834 |
| 408 | Ga0307406_10073259 | 3300031901 | Bacteria | 2251 |
| 409 | Ga0307414_10208689 | 3300032004 | Bacteria | 1595 |
| 410 | Ga0373958_0010115 | 3300034819 | Bacteria | 1567 |
| 411 | Ga0373926_0008701 | 3300035083 | Bacteria | 3378 |
| 412 | Ga0373926_0050445 | 3300035083 | Bacteria | 1500 |
| 413 | Ga0373945_0013583 | 3300035116 | Bacteria | 2719 |
| 414 | Ga0373953_0103639 | 3300035117 | Bacteria | 1199 |
| 415 | Ga0373954_0006920 | 3300035118 | Bacteria | 4951 |
| 416 | Ga0373956_0003259 | 3300035119 | Bacteria | 6548 |
| 417 | Ga0373957_0059689 | 3300035120 | Bacteria | 1475 |
| 418 | Ga0373957_0159239 | 3300035120 | Bacteria | 930 |
| 419 | Ga0373943_0001737 | 3300035170 | Bacteria | 9877 |
| 420 | Ga0373943_0028168 | 3300035170 | Bacteria | 2645 |
| 421 | Ga0373955_0037233 | 3300035172 | Bacteria | 2586 |
| 422 | Ga0373955_0079802 | 3300035172 | Bacteria | 1847 |
| 423 | Ga0373955_0173678 | 3300035172 | Bacteria | 1276 |
| 424 | Ga0373931_0084987 | 3300035691 | Bacteria | 1753 |
| 425 | Ga0373935_0012226 | 3300035692 | Bacteria | 5161 |
| 426 | Ga0373935_0039727 | 3300035692 | Bacteria | 2950 |
| 427 | Ga0373935_0116138 | 3300035692 | Bacteria | 1782 |
| 428 | Ga0373935_0145256 | 3300035692 | Bacteria | 1605 |
| 429 | Ga0373927_0017008 | 3300035695 | Bacteria | 4792 |
| 430 | Ga0373927_0041032 | 3300035695 | Bacteria | 3001 |
| 431 | Ga0373933_0033929 | 3300035724 | Bacteria | 2971 |
| 432 | Ga0373933_0041664 | 3300035724 | Bacteria | 2711 |
| 433 | Ga0373933_0080402 | 3300035724 | Bacteria | 1998 |
| 434 | Ga0373933_0173809 | 3300035724 | Bacteria | 1372 |
| 435 | Ga0373947_0000014 | 3300035725 | Bacteria | 135749 |
| 436 | Ga0373947_0126368 | 3300035725 | Bacteria | 1628 |
| 437 | Ga0373937_0058434 | 3300036401 | Bacteria | 3543 |
| 438 | Ga0373925_0021369 | 3300037068 | Bacteria | 4714 |
| 439 | Ga0373925_0134256 | 3300037068 | Bacteria | 1932 |
| 440 | Ga0373925_0407596 | 3300037068 | Bacteria | 1109 |
| 441 | Ga0395899_0074684 | 3300037312 | Bacteria | 2476 |
| 442 | Ga0395899_0149726 | 3300037312 | Bacteria | 1655 |
| 443 | Ga0395900_0031704 | 3300037418 | Bacteria | 5432 |
| 444 | Ga0395900_0059527 | 3300037418 | Bacteria | 3932 |
| 445 | Ga0395900_0272442 | 3300037418 | Bacteria | 1687 |
| 446 | Ga0395900_0601770 | 3300037418 | Bacteria | 1040 |
| 447 | Ga0395898_0046052 | 3300037466 | Bacteria | 4285 |
| 448 | Ga0395898_0185655 | 3300037466 | Bacteria | 1987 |
| 449 | Ga0395898_0349404 | 3300037466 | Bacteria | 1410 |
| 450 | Ga0395905_0041489 | 3300037471 | Bacteria | 4318 |
| 451 | Ga0436364_0609957 | 3300037853 | Bacteria | 1113 |
| 452 | Ga0436364_0788967 | 3300037853 | Bacteria | 3633 |
| 453 | Ga0436364_1435297 | 3300037853 | Bacteria | 74939 |
| 454 | Ga0436364_1520571 | 3300037853 | Bacteria | 46168 |
| 455 | Ga0395901_0015280 | 3300038443 | Bacteria | 7811 |
| 456 | Ga0395901_0068340 | 3300038443 | Bacteria | 3701 |
| 457 | Ga0436365_0643539 | 3300039437 | Unclassified | 2221 |
| 458 | Ga0439461_0002575 | 3300041410 | Bacteria | 2914 |
| 459 | Ga0439466_0006609 | 3300041411 | Bacteria | 4402 |
| 460 | Ga0439465_0000349 | 3300041413 | Bacteria | 13257 |
| 461 | Ga0439465_0009359 | 3300041413 | Bacteria | 3085 |
| 462 | Ga0451793_1294871 | 3300041452 | Bacteria | 1816 |
| 463 | Ga0451795_0883130 | 3300041456 | Bacteria | 1862 |
| 464 | Ga0451837_0131201 | 3300041494 | Bacteria | 1431 |
| 465 | Ga0439431_0000859 | 3300041997 | Bacteria | 6579 |
| 466 | Ga0439445_0004897 | 3300042004 | Bacteria | 3043 |
| 467 | Ga0439434_0010181 | 3300042435 | Bacteria | 2771 |
| 468 | Ga0439435_0011347 | 3300042436 | Bacteria | 2137 |
| 469 | Ga0466972_0007973 | 3300044658 | Bacteria | 5309 |
| 470 | Ga0466972_0086532 | 3300044658 | Bacteria | 1489 |
| 471 | Ga0466965_0002177 | 3300044683 | Bacteria | 8246 |
| 472 | Ga0466965_0090109 | 3300044683 | Bacteria | 1559 |
| 473 | Ga0466963_0021480 | 3300044694 | Bacteria | 4073 |
| 474 | Ga0466963_0150088 | 3300044694 | Bacteria | 1618 |
| 475 | Ga0466968_0001088 | 3300044735 | Bacteria | 9619 |
| 476 | Ga0466970_0016640 | 3300044765 | Bacteria | 3794 |
| 477 | Ga0466957_0020512 | 3300044842 | Bacteria | 3888 |
| 478 | Ga0466957_0108098 | 3300044842 | Bacteria | 1761 |
| 479 | Ga0466960_0042012 | 3300044901 | Bacteria | 2168 |
| 480 | Ga0466959_0098581 | 3300045049 | Bacteria | 2093 |
| 481 | Ga0466967_0030898 | 3300045976 | Bacteria | 4501 |
| 482 | Ga0466967_0036069 | 3300045976 | Bacteria | 4218 |
| 483 | Ga0466967_0325726 | 3300045976 | Bacteria | 1483 |
| 484 | Ga0466967_0609884 | 3300045976 | Bacteria | 1078 |
| 485 | Ga0495603_0001901 | 3300046455 | Bacteria | 12324 |
| 486 | Ga0495603_0024918 | 3300046455 | Bacteria | 3618 |
| 487 | Ga0495629_0012234 | 3300046459 | Bacteria | 6215 |
| 488 | Ga0495629_0023150 | 3300046459 | Bacteria | 4426 |
| 489 | Ga0495629_0086930 | 3300046459 | Bacteria | 2181 |
| 490 | Ga0495638_0002264 | 3300046460 | Bacteria | 15935 |
| 491 | Ga0495641_0010636 | 3300046461 | Bacteria | 5310 |
| 492 | Ga0495651_0007208 | 3300046462 | Bacteria | 8501 |
| 493 | Ga0495651_0126444 | 3300046462 | Bacteria | 1871 |
| 494 | Ga0495653_0004538 | 3300046463 | Bacteria | 11222 |
| 495 | Ga0495653_0020117 | 3300046463 | Bacteria | 5410 |
| 496 | Ga0495653_0236867 | 3300046463 | Bacteria | 1218 |
| 497 | Ga0495582_0021817 | 3300046473 | Bacteria | 3503 |
| 498 | Ga0495639_0045890 | 3300046475 | Bacteria | 1977 |
| 499 | Ga0495639_0060341 | 3300046475 | Bacteria | 1737 |
| 500 | Ga0495639_0065782 | 3300046475 | Bacteria | 1668 |
| 501 | Ga0495662_0001666 | 3300046476 | Bacteria | 11070 |
| 502 | Ga0495664_0073805 | 3300046477 | Bacteria | 2040 |
| 503 | Ga0495594_0020272 | 3300046499 | Bacteria | 3540 |
| 504 | Ga0495607_0074327 | 3300046501 | Bacteria | 1887 |
| 505 | Ga0495583_0086756 | 3300046506 | Bacteria | 1353 |
| 506 | Ga0495606_0083170 | 3300046507 | Bacteria | 1985 |
| 507 | Ga0495608_0002859 | 3300046511 | Bacteria | 12373 |
| 508 | Ga0495608_0010194 | 3300046511 | Bacteria | 6558 |
| 509 | Ga0495628_0203841 | 3300046516 | Bacteria | 1489 |
| 510 | Ga0495630_0009396 | 3300046517 | Bacteria | 7025 |
| 511 | Ga0495630_0030023 | 3300046517 | Bacteria | 4042 |
| 512 | Ga0495630_0099023 | 3300046517 | Bacteria | 2205 |
| 513 | Ga0495631_0100388 | 3300046518 | Bacteria | 1246 |
| 514 | Ga0495648_0005458 | 3300046524 | Bacteria | 10554 |
| 515 | Ga0495666_0022153 | 3300046526 | Bacteria | 3146 |
| 516 | Ga0495666_0033626 | 3300046526 | Bacteria | 2504 |
| 517 | Ga0495666_0091765 | 3300046526 | Bacteria | 1433 |
| 518 | Ga0495652_0003641 | 3300046529 | Bacteria | 15088 |
| 519 | Ga0495652_0171569 | 3300046529 | Bacteria | 1674 |
| 520 | Ga0495654_0096373 | 3300046530 | Bacteria | 1367 |
| 521 | Ga0495665_0013989 | 3300046531 | Bacteria | 4333 |
| 522 | Ga0495665_0168840 | 3300046531 | Bacteria | 1139 |
| 523 | Ga0495640_0074613 | 3300046533 | Bacteria | 2267 |
| 524 | Ga0495640_0102017 | 3300046533 | Bacteria | 1883 |
| 525 | Ga0495586_0023326 | 3300046535 | Bacteria | 3304 |
| 526 | Ga0495645_0032170 | 3300046543 | Bacteria | 3825 |
| 527 | Ga0495645_0347442 | 3300046543 | Bacteria | 956 |
| 528 | Ga0495667_0000908 | 3300046559 | Bacteria | 19115 |
| 529 | Ga0495667_0001764 | 3300046559 | Bacteria | 14367 |
| 530 | Ga0495634_0048446 | 3300046642 | Bacteria | 2861 |
| 531 | Ga0495634_0093038 | 3300046642 | Bacteria | 1955 |
| 532 | Ga0495635_0011752 | 3300046663 | Bacteria | 6139 |
| 533 | Ga0495635_0025895 | 3300046663 | Bacteria | 4085 |
| 534 | Ga0495635_0312367 | 3300046663 | Bacteria | 1053 |
| 535 | Ga0495659_0070679 | 3300046664 | Bacteria | 1307 |
| 536 | Ga0495588_0079615 | 3300046674 | Bacteria | 1710 |
| 537 | Ga0495588_0106290 | 3300046674 | Bacteria | 1477 |
| 538 | Ga0495657_0002947 | 3300046675 | Bacteria | 14105 |
| 539 | Ga0495657_0007099 | 3300046675 | Bacteria | 8687 |
| 540 | Ga0495599_0094061 | 3300046678 | Bacteria | 1869 |
| 541 | Ga0495623_0022640 | 3300046679 | Bacteria | 4057 |
| 542 | Ga0495647_0020032 | 3300046681 | Bacteria | 2398 |
| 543 | Ga0495658_0103799 | 3300046683 | Bacteria | 1700 |
| 544 | Ga0495658_0211320 | 3300046683 | Bacteria | 1212 |
| 545 | Ga0495613_0035592 | 3300046689 | Bacteria | 3694 |
| 546 | Ga0495613_0333621 | 3300046689 | Bacteria | 1045 |
| 547 | Ga0495671_0071222 | 3300046692 | Bacteria | 1708 |
| 548 | Ga0495589_0158741 | 3300046794 | Bacteria | 1078 |
| 549 | Ga0495600_0009939 | 3300046809 | Bacteria | 5894 |
| 550 | Ga0495600_0016381 | 3300046809 | Bacteria | 4703 |
| 551 | Ga0495581_0006220 | 3300047315 | Bacteria | 6924 |
| 552 | Ga0495604_0202885 | 3300047317 | Bacteria | 1374 |
| 553 | Ga0495604_0206667 | 3300047317 | Bacteria | 1358 |
| 554 | Ga0495674_0013586 | 3300047319 | Bacteria | 7649 |
| 555 | Ga0495672_0030900 | 3300047320 | Bacteria | 3350 |
| 556 | Ga0495676_0040298 | 3300047321 | Bacteria | 3856 |
| 557 | Ga0495676_0255463 | 3300047321 | Bacteria | 1194 |
| 558 | Ga0495680_0001586 | 3300047322 | Bacteria | 24314 |
| 559 | Ga0495680_0009868 | 3300047322 | Bacteria | 8558 |
| 560 | Ga0495680_0029597 | 3300047322 | Bacteria | 4483 |
| 561 | Ga0495675_0049564 | 3300047444 | Bacteria | 2669 |
| 562 | Ga0495675_0069594 | 3300047444 | Bacteria | 2222 |
| 563 | Ga0495673_0001205 | 3300047469 | Bacteria | 21534 |
| 564 | Ga0495684_0009471 | 3300047471 | Bacteria | 7516 |
| 565 | Ga0495684_0040633 | 3300047471 | Bacteria | 3565 |
| 566 | Ga0495684_0102820 | 3300047471 | Bacteria | 2159 |
| 567 | Ga0495684_0126045 | 3300047471 | Bacteria | 1926 |
| 568 | Ga0495686_0003330 | 3300047472 | Bacteria | 14025 |
| 569 | Ga0495593_0009218 | 3300047673 | Bacteria | 5722 |
| 570 | Ga0495593_0010942 | 3300047673 | Bacteria | 5225 |
| 571 | Ga0495602_0036396 | 3300048088 | Bacteria | 4581 |
| 572 | Ga0495602_0320239 | 3300048088 | Bacteria | 1128 |
| 573 | Ga0495614_0004289 | 3300048089 | Bacteria | 6425 |
| 574 | Ga0495626_0067444 | 3300048091 | Bacteria | 1616 |
| 575 | Ga0496100_0002367 | 3300048903 | Bacteria | 9542 |
| 576 | Ga0496100_0004799 | 3300048903 | Bacteria | 7220 |
| 577 | Ga0496100_0009450 | 3300048903 | Bacteria | 5482 |
| 578 | Ga0496100_0046837 | 3300048903 | Bacteria | 2783 |
| 579 | Ga0496100_0308196 | 3300048903 | Bacteria | 1186 |
| 580 | Ga0496101_0000021 | 3300048904 | Bacteria | 217090 |
| 581 | Ga0496101_0015217 | 3300048904 | Bacteria | 5178 |
| 582 | Ga0496101_0025140 | 3300048904 | Bacteria | 4128 |
| 583 | Ga0496101_0058904 | 3300048904 | Bacteria | 2783 |
| 584 | Ga0496101_0105980 | 3300048904 | Bacteria | 2110 |
| 585 | Ga0496102_0000001 | 3300048905 | Bacteria | 873433 |
| 586 | Ga0496102_0000590 | 3300048905 | Bacteria | 38332 |
| 587 | Ga0496102_0001309 | 3300048905 | Bacteria | 22360 |
| 588 | Ga0496102_0050731 | 3300048905 | Bacteria | 3779 |
| 589 | Ga0496102_0379083 | 3300048905 | Bacteria | 1331 |
| 590 | Ga0496103_0000007 | 3300048906 | Bacteria | 354915 |
| 591 | Ga0496103_0019054 | 3300048906 | Bacteria | 4120 |
| 592 | Ga0496103_0266308 | 3300048906 | Bacteria | 1102 |
| 593 | Ga0496104_0010504 | 3300048907 | Bacteria | 8271 |
| 594 | Ga0496104_0040855 | 3300048907 | Bacteria | 4348 |
| 595 | Ga0496104_0080994 | 3300048907 | Bacteria | 3095 |
| 596 | Ga0496104_0082510 | 3300048907 | Bacteria | 3065 |
| 597 | Ga0496104_0134453 | 3300048907 | Bacteria | 2375 |
| 598 | Ga0496105_0023961 | 3300048908 | Bacteria | 4957 |
| 599 | Ga0496106_0003195 | 3300048909 | Bacteria | 12259 |
| 600 | Ga0496106_0100080 | 3300048909 | Bacteria | 2248 |
| 601 | Ga0496106_0237974 | 3300048909 | Bacteria | 1454 |
| 602 | Ga0496107_0000321 | 3300048910 | Bacteria | 25887 |
| 603 | Ga0496107_0003559 | 3300048910 | Bacteria | 10431 |
| 604 | Ga0496107_0011486 | 3300048910 | Bacteria | 6170 |
| 605 | Ga0496107_0073063 | 3300048910 | Bacteria | 2494 |
| 606 | Ga0496108_0000645 | 3300048911 | Bacteria | 27126 |
| 607 | Ga0496108_0021599 | 3300048911 | Bacteria | 5289 |
| 608 | Ga0496109_0016603 | 3300048912 | Bacteria | 6438 |
| 609 | Ga0496109_0053112 | 3300048912 | Bacteria | 3694 |
| 610 | Ga0496110_0034997 | 3300048913 | Bacteria | 4354 |
| 611 | Ga0496110_0040938 | 3300048913 | Bacteria | 4041 |
| 612 | Ga0496110_0292815 | 3300048913 | Bacteria | 1483 |
| 613 | Ga0496111_0051875 | 3300048914 | Bacteria | 2962 |
| 614 | Ga0496111_0083805 | 3300048914 | Bacteria | 2330 |
| 615 | Ga0496111_0164329 | 3300048914 | Bacteria | 1648 |
| 616 | Ga0496112_0051425 | 3300048915 | Bacteria | 4042 |
| 617 | Ga0496113_0229290 | 3300048916 | Bacteria | 1481 |
| 618 | Ga0496113_0234782 | 3300048916 | Bacteria | 1463 |
| 619 | Ga0496114_0000495 | 3300048917 | Bacteria | 28787 |
| 620 | Ga0496114_0002288 | 3300048917 | Bacteria | 14597 |
| 621 | Ga0496114_0041127 | 3300048917 | Bacteria | 3830 |
| 622 | Ga0496114_0088783 | 3300048917 | Bacteria | 2622 |
| 623 | Ga0496114_0097635 | 3300048917 | Bacteria | 2503 |
| 624 | Ga0496114_0220089 | 3300048917 | Bacteria | 1666 |
| 625 | Ga0496115_0003085 | 3300048918 | Bacteria | 11965 |
| 626 | Ga0496115_0014339 | 3300048918 | Bacteria | 6000 |
| 627 | Ga0496115_0077120 | 3300048918 | Bacteria | 2710 |
| 628 | Ga0496115_0105139 | 3300048918 | Bacteria | 2317 |
| 629 | Ga0496116_0000018 | 3300048919 | Bacteria | 545877 |
| 630 | Ga0496116_0000166 | 3300048919 | Bacteria | 133474 |
| 631 | Ga0496117_0000015 | 3300048920 | Bacteria | 583316 |
| 632 | Ga0496118_0000012 | 3300048921 | Bacteria | 583316 |
| 633 | Ga0496119_0026660 | 3300048922 | Bacteria | 3998 |
| 634 | Ga0496120_0006298 | 3300048923 | Bacteria | 9148 |
| 635 | Ga0496121_0000177 | 3300048924 | Bacteria | 141456 |
| 636 | Ga0496125_0126667 | 3300048928 | Bacteria | 1808 |
| 637 | Ga0496126_0001113 | 3300048929 | Bacteria | 45012 |
| 638 | Ga0501033_0243681 | 3300049570 | Bacteria | 1275 |
| 639 | Ga0501034_0033607 | 3300049571 | Bacteria | 5201 |
| 640 | Ga0501034_0154413 | 3300049571 | Bacteria | 2270 |
| 641 | Ga0501036_0222418 | 3300049572 | Bacteria | 1585 |
| 642 | Ga0501036_0423567 | 3300049572 | Bacteria | 1110 |
| 643 | Ga0501039_0120633 | 3300049575 | Bacteria | 2055 |
| 644 | Ga0501042_0127505 | 3300049578 | Bacteria | 1833 |
| 645 | Ga0501047_0349300 | 3300049581 | Bacteria | 1316 |
| 646 | Ga0501047_0392040 | 3300049581 | Bacteria | 1222 |
| 647 | Ga0501048_0139082 | 3300049582 | Bacteria | 1717 |
| 648 | Ga0501067_0004530 | 3300049583 | Bacteria | 7678 |
| 649 | Ga0501067_0012811 | 3300049583 | Bacteria | 4644 |
| 650 | Ga0501068_0010913 | 3300049584 | Bacteria | 5113 |
| 651 | Ga0501068_0133839 | 3300049584 | Bacteria | 1551 |
| 652 | Ga0501070_0097237 | 3300049586 | Bacteria | 2435 |
| 653 | Ga0501071_0007468 | 3300049587 | Bacteria | 7182 |
| 654 | Ga0501072_0064713 | 3300049588 | Bacteria | 2883 |
| 655 | Ga0501073_0045442 | 3300049589 | Bacteria | 3092 |
| 656 | Ga0501073_0046934 | 3300049589 | Bacteria | 3036 |
| 657 | Ga0501074_0004203 | 3300049590 | Bacteria | 10289 |
| 658 | Ga0501074_0034406 | 3300049590 | Bacteria | 3672 |
| 659 | Ga0501077_0031697 | 3300049593 | Bacteria | 3363 |
| 660 | Ga0501077_0060270 | 3300049593 | Bacteria | 2409 |
| 661 | Ga0501257_006903 | 3300049686 | Bacteria | 2527 |
| 662 | Ga0501080_0004291 | 3300049742 | Bacteria | 12654 |
| 663 | Ga0501083_0016126 | 3300049744 | Bacteria | 5233 |
| 664 | Ga0501083_0055094 | 3300049744 | Bacteria | 2667 |
| 665 | nmdc:mga03683_3552_c1 | 3300050489 | Bacteria | 5050 |
| 666 | nmdc:mga03n38_107121_c1 | 3300050490 | Bacteria | 1356 |
| 667 | nmdc:mga03n38_21081_c1 | 3300050490 | Bacteria | 2617 |
| 668 | nmdc:mga03n38_48851_c1 | 3300050490 | Bacteria | 1879 |
| 669 | nmdc:mga03n38_7306_c1 | 3300050490 | Bacteria | 3903 |
| 670 | nmdc:mga00v17_135666_c1 | 3300050491 | Bacteria | 1575 |
| 671 | nmdc:mga00v17_17742_c2 | 3300050491 | Bacteria | 3508 |
| 672 | nmdc:mga00v17_56229_c1 | 3300050491 | Bacteria | 2405 |
| 673 | nmdc:mga00v17_5888_c1 | 3300050491 | Bacteria | 6476 |
| 674 | nmdc:mga0yw44_20758_c1 | 3300050492 | Bacteria | 3652 |
| 675 | nmdc:mga0yw44_250629_c1 | 3300050492 | Bacteria | 1178 |
| 676 | nmdc:mga0yw44_361372_c1 | 3300050492 | Bacteria | 978 |
| 677 | nmdc:mga0k408_17139_c1 | 3300050493 | Bacteria | 4031 |
| 678 | nmdc:mga06z11_20869_c1 | 3300050494 | Bacteria | 3034 |
| 679 | nmdc:mga06z11_300570_c1 | 3300050494 | Bacteria | 954 |
| 680 | nmdc:mga06z11_4051_c1 | 3300050494 | Bacteria | 5725 |
| 681 | nmdc:mga07m45_345017_c1 | 3300050496 | Bacteria | 865 |
| 682 | nmdc:mga07m45_35430_c1 | 3300050496 | Bacteria | 2775 |
| 683 | nmdc:mga05p37_47560_c1 | 3300050507 | Bacteria | 5275 |
| 684 | nmdc:mga0n895_17799_c1 | 3300050512 | Bacteria | 6560 |
| 685 | nmdc:mga0n895_706032_c1 | 3300050512 | Bacteria | 1004 |
| 686 | nmdc:mga0rr50_3260_c1 | 3300050513 | Bacteria | 9300 |
| 687 | nmdc:mga0a205_2637_c1 | 3300050515 | Bacteria | 15841 |
| 688 | nmdc:mga0sz30_10406_c1 | 3300050516 | Bacteria | 3564 |
| 689 | nmdc:mga0sz30_29531_c1 | 3300050516 | Bacteria | 2261 |
| 690 | nmdc:mga0sz30_3201_c1 | 3300050516 | Bacteria | 5873 |
| 691 | nmdc:mga0sz30_56394_c1 | 3300050516 | Bacteria | 1454 |
| 692 | Ga0495601_0016295 | 3300053077 | Bacteria | 4503 |
| 693 | Ga0495601_0070868 | 3300053077 | Bacteria | 2225 |
| 694 | Ga0495612_0003214 | 3300053078 | Bacteria | 6774 |
| 695 | Ga0500635_0001094 | 3300053080 | Bacteria | 6484 |
| 696 | Ga0495619_0044877 | 3300053085 | Bacteria | 2902 |
| 697 | Ga0495619_0223465 | 3300053085 | Bacteria | 1304 |
| 698 | Ga0500643_001154 | 3300053087 | Bacteria | 15747 |
| 699 | Ga0500643_001862 | 3300053087 | Bacteria | 11500 |
| 700 | Ga0500643_006474 | 3300053087 | Bacteria | 4886 |
| 701 | Ga0500556_0001572 | 3300053104 | Bacteria | 9240 |
| 702 | Ga0500562_017191 | 3300053108 | Bacteria | 1863 |
| 703 | Ga0500595_005721 | 3300053119 | Bacteria | 5384 |
| 704 | Ga0500652_009427 | 3300053131 | Bacteria | 3302 |
| 705 | Ga0500616_0011465 | 3300053153 | Bacteria | 5232 |
| 706 | Ga0500645_000035 | 3300053730 | Bacteria | 113679 |
| 707 | Ga0501084_0077695 | 3300054114 | Bacteria | 2783 |
| 708 | Ga0501084_0234005 | 3300054114 | Bacteria | 1551 |
| 709 | Ga0587088_015224 | 3300059508 | Bacteria | 1209 |
| 710 | Ga0501082_0022336 | 3300060353 | Bacteria | 5450 |
| 711 | Ga0501082_0205960 | 3300060353 | Bacteria | 1711 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 3002998708 | 3003003444 | 239 |
| 2 | iso_pu_bacteria | 8053945823 | 8053951101 | 240 |
| 3 | 3300028666 | Ga0265336_10019643 | Ga0265336_100196432 | 242 |
| 4 | 3300037418 | Ga0395900_0031704 | Ga0395900_0031704_948_1709 | 242 |
| 5 | 3300037466 | Ga0395898_0046052 | Ga0395898_0046052_3314_4075 | 242 |
| 6 | 3300045976 | Ga0466967_0325726 | Ga0466967_0325726_604_1398 | 242 |
| 7 | 3300046794 | Ga0495589_0158741 | Ga0495589_0158741_24_785 | 242 |
| 8 | 3300049581 | Ga0501047_0349300 | Ga0501047_0349300_243_1037 | 242 |
| 9 | 3300005367 | Ga0070667_100048331 | Ga0070667_1000483313 | 243 |
| 10 | 3300025986 | Ga0207658_10034788 | Ga0207658_100347883 | 243 |
| 11 | 3300003203 | JGI25406J46586_10021790 | JGI25406J46586_100217902 | 244 |
| 12 | 3300005985 | Ga0081539_10001504 | Ga0081539_1000150418 | 244 |
| 13 | 3300025935 | Ga0207709_10547072 | Ga0207709_105470721 | 244 |
| 14 | 3300009101 | Ga0105247_10031108 | Ga0105247_100311084 | 246 |
| 15 | 3300013105 | Ga0157369_10239525 | Ga0157369_102395252 | 246 |
| 16 | 3300037418 | Ga0395900_0601770 | Ga0395900_0601770_91_975 | 248 |
| 17 | 3300044694 | Ga0466963_0150088 | Ga0466963_0150088_446_1330 | 248 |
| 18 | 3300044842 | Ga0466957_0108098 | Ga0466957_0108098_864_1742 | 248 |
| 19 | 3300048910 | Ga0496107_0073063 | Ga0496107_0073063_1644_2426 | 248 |
| 20 | 3300050492 | nmdc:mga0yw44_361372_c1 | nmdc:mga0yw44_361372_c1_110_871 | 249 |
| 21 | 3300050494 | nmdc:mga06z11_300570_c1 | nmdc:mga06z11_300570_c1_15_776 | 249 |
| 22 | 3300050496 | nmdc:mga07m45_345017_c1 | nmdc:mga07m45_345017_c1_85_846 | 249 |
| 23 | 3300002067 | JGI24735J21928_10032869 | JGI24735J21928_100328692 | 252 |
| 24 | 3300009545 | Ga0105237_10000178 | Ga0105237_1000017823 | 252 |
| 25 | 3300025914 | Ga0207671_10008270 | Ga0207671_100082706 | 252 |
| 26 | 3300041494 | Ga0451837_0131201 | Ga0451837_0131201_247_1041 | 252 |
| 27 | 3300050516 | nmdc:mga0sz30_56394_c1 | nmdc:mga0sz30_56394_c1_679_1440 | 252 |
| 28 | 3300005563 | Ga0068855_100055086 | Ga0068855_1000550862 | 253 |
| 29 | 3300009545 | Ga0105237_10002564 | Ga0105237_100025649 | 253 |
| 30 | 3300010375 | Ga0105239_10030663 | Ga0105239_100306635 | 253 |
| 31 | 3300025914 | Ga0207671_10019320 | Ga0207671_100193202 | 253 |
| 32 | 3300003792 | Ga0055540_1000941 | Ga0055540_10009415 | 256 |
| 33 | 3300025273 | Ga0209673_1008102 | Ga0209673_10081024 | 256 |
| 34 | 3300025303 | Ga0209051_1006114 | Ga0209051_10061144 | 256 |
| 35 | 3300050490 | nmdc:mga03n38_21081_c1 | nmdc:mga03n38_21081_c1_739_1545 | 256 |
| 36 | 3300050516 | nmdc:mga0sz30_3201_c1 | nmdc:mga0sz30_3201_c1_2040_2945 | 256 |
| 37 | 3300009553 | Ga0105249_10430988 | Ga0105249_104309882 | 258 |
| 38 | 3300053087 | Ga0500643_001154 | Ga0500643_001154_10801_11715 | 258 |
| 39 | 3300005337 | Ga0070682_100090665 | Ga0070682_1000906652 | 260 |
| 40 | 3300005459 | Ga0068867_100093721 | Ga0068867_1000937213 | 260 |
| 41 | 3300005578 | Ga0068854_100030428 | Ga0068854_1000304283 | 260 |
| 42 | 3300005614 | Ga0068856_100004148 | Ga0068856_10000414816 | 260 |
| 43 | 3300005617 | Ga0068859_100093089 | Ga0068859_1000930893 | 260 |
| 44 | 3300005842 | Ga0068858_100009962 | Ga0068858_1000099625 | 260 |
| 45 | 3300006931 | Ga0097620_100093087 | Ga0097620_1000930873 | 260 |
| 46 | 3300009176 | Ga0105242_10644314 | Ga0105242_106443142 | 260 |
| 47 | 3300013296 | Ga0157374_10047571 | Ga0157374_100475714 | 260 |
| 48 | 3300025900 | Ga0207710_10043734 | Ga0207710_100437342 | 260 |
| 49 | 3300026035 | Ga0207703_10055546 | Ga0207703_100555462 | 260 |
| 50 | 3300026041 | Ga0207639_10224493 | Ga0207639_102244932 | 260 |
| 51 | 3300026078 | Ga0207702_10002286 | Ga0207702_1000228618 | 260 |
| 52 | 3300035170 | Ga0373943_0001737 | Ga0373943_0001737_273_1091 | 260 |
| 53 | 3300035172 | Ga0373955_0037233 | Ga0373955_0037233_1668_2486 | 260 |
| 54 | 3300035692 | Ga0373935_0145256 | Ga0373935_0145256_720_1538 | 260 |
| 55 | 3300035695 | Ga0373927_0017008 | Ga0373927_0017008_1135_1953 | 260 |
| 56 | 3300035724 | Ga0373933_0173809 | Ga0373933_0173809_184_1002 | 260 |
| 57 | 3300037068 | Ga0373925_0134256 | Ga0373925_0134256_926_1744 | 260 |
| 58 | 3300046459 | Ga0495629_0023150 | Ga0495629_0023150_1073_1891 | 260 |
| 59 | 3300046463 | Ga0495653_0004538 | Ga0495653_0004538_5966_6784 | 260 |
| 60 | 3300046475 | Ga0495639_0060341 | Ga0495639_0060341_90_908 | 260 |
| 61 | 3300046499 | Ga0495594_0020272 | Ga0495594_0020272_2202_3020 | 260 |
| 62 | 3300046511 | Ga0495608_0002859 | Ga0495608_0002859_11367_12185 | 260 |
| 63 | 3300046517 | Ga0495630_0099023 | Ga0495630_0099023_1197_2015 | 260 |
| 64 | 3300046526 | Ga0495666_0033626 | Ga0495666_0033626_1384_2202 | 260 |
| 65 | 3300046531 | Ga0495665_0168840 | Ga0495665_0168840_132_950 | 260 |
| 66 | 3300046533 | Ga0495640_0074613 | Ga0495640_0074613_888_1706 | 260 |
| 67 | 3300046559 | Ga0495667_0001764 | Ga0495667_0001764_5111_5929 | 260 |
| 68 | 3300046642 | Ga0495634_0093038 | Ga0495634_0093038_189_1007 | 260 |
| 69 | 3300046663 | Ga0495635_0025895 | Ga0495635_0025895_1669_2487 | 260 |
| 70 | 3300046674 | Ga0495588_0106290 | Ga0495588_0106290_229_1047 | 260 |
| 71 | 3300046675 | Ga0495657_0002947 | Ga0495657_0002947_4603_5421 | 260 |
| 72 | 3300046683 | Ga0495658_0103799 | Ga0495658_0103799_820_1638 | 260 |
| 73 | 3300046689 | Ga0495613_0035592 | Ga0495613_0035592_1861_2679 | 260 |
| 74 | 3300047315 | Ga0495581_0006220 | Ga0495581_0006220_5639_6457 | 260 |
| 75 | 3300047317 | Ga0495604_0202885 | Ga0495604_0202885_514_1332 | 260 |
| 76 | 3300047319 | Ga0495674_0013586 | Ga0495674_0013586_1257_2075 | 260 |
| 77 | 3300047321 | Ga0495676_0255463 | Ga0495676_0255463_43_861 | 260 |
| 78 | 3300047322 | Ga0495680_0009868 | Ga0495680_0009868_6072_6890 | 260 |
| 79 | 3300047471 | Ga0495684_0009471 | Ga0495684_0009471_4949_5767 | 260 |
| 80 | 3300048088 | Ga0495602_0320239 | Ga0495602_0320239_288_1106 | 260 |
| 81 | 3300048089 | Ga0495614_0004289 | Ga0495614_0004289_5558_6376 | 260 |
| 82 | 3300053077 | Ga0495601_0070868 | Ga0495601_0070868_1357_2175 | 260 |
| 83 | 3300053085 | Ga0495619_0223465 | Ga0495619_0223465_276_1094 | 260 |
| 84 | 3300005439 | Ga0070711_100261435 | Ga0070711_1002614352 | 261 |
| 85 | 3300005441 | Ga0070700_100017215 | Ga0070700_1000172153 | 261 |
| 86 | 3300005535 | Ga0070684_100007016 | Ga0070684_1000070165 | 261 |
| 87 | 3300005549 | Ga0070704_100121270 | Ga0070704_1001212702 | 261 |
| 88 | 3300005564 | Ga0070664_100047870 | Ga0070664_1000478703 | 261 |
| 89 | 3300005577 | Ga0068857_100011640 | Ga0068857_1000116406 | 261 |
| 90 | 3300005618 | Ga0068864_100342077 | Ga0068864_1003420771 | 261 |
| 91 | 3300006844 | Ga0075428_100051463 | Ga0075428_1000514633 | 261 |
| 92 | 3300006881 | Ga0068865_100011634 | Ga0068865_1000116342 | 261 |
| 93 | 3300009094 | Ga0111539_10241974 | Ga0111539_102419742 | 261 |
| 94 | 3300014325 | Ga0163163_10124419 | Ga0163163_101244192 | 261 |
| 95 | 3300025901 | Ga0207688_10045040 | Ga0207688_100450402 | 261 |
| 96 | 3300025927 | Ga0207687_10176759 | Ga0207687_101767592 | 261 |
| 97 | 3300025938 | Ga0207704_10185174 | Ga0207704_101851742 | 261 |
| 98 | 3300025944 | Ga0207661_10003465 | Ga0207661_100034658 | 261 |
| 99 | 3300026023 | Ga0207677_10210639 | Ga0207677_102106392 | 261 |
| 100 | 3300026067 | Ga0207678_10414553 | Ga0207678_104145532 | 261 |
| 101 | 3300026075 | Ga0207708_10009373 | Ga0207708_100093733 | 261 |
| 102 | 3300026116 | Ga0207674_10019592 | Ga0207674_100195924 | 261 |
| 103 | 3300027907 | Ga0207428_10127037 | Ga0207428_101270372 | 261 |
| 104 | 3300035120 | Ga0373957_0159239 | Ga0373957_0159239_24_845 | 261 |
| 105 | 3300035172 | Ga0373955_0079802 | Ga0373955_0079802_808_1629 | 261 |
| 106 | 3300035724 | Ga0373933_0080402 | Ga0373933_0080402_447_1268 | 261 |
| 107 | 3300046529 | Ga0495652_0171569 | Ga0495652_0171569_811_1632 | 261 |
| 108 | 3300049686 | Ga0501257_006903 | Ga0501257_006903_814_1698 | 261 |
| 109 | 3300050512 | nmdc:mga0n895_706032_c1 | nmdc:mga0n895_706032_c1_173_994 | 261 |
| 110 | 3300005456 | Ga0070678_100194916 | Ga0070678_1001949162 | 263 |
| 111 | 3300013306 | Ga0163162_10112849 | Ga0163162_101128492 | 263 |
| 112 | 3300005436 | Ga0070713_100021199 | Ga0070713_1000211994 | 264 |
| 113 | 3300025929 | Ga0207664_10181647 | Ga0207664_101816471 | 264 |
| 114 | 3300032004 | Ga0307414_10208689 | Ga0307414_102086891 | 264 |
| 115 | 3300044683 | Ga0466965_0090109 | Ga0466965_0090109_709_1539 | 264 |
| 116 | 3300045976 | Ga0466967_0609884 | Ga0466967_0609884_210_1052 | 265 |
| 117 | 3300046507 | Ga0495606_0083170 | Ga0495606_0083170_1076_1921 | 265 |
| 118 | 3300048903 | Ga0496100_0009450 | Ga0496100_0009450_4279_5124 | 265 |
| 119 | 3300048904 | Ga0496101_0000021 | Ga0496101_0000021_34029_34874 | 265 |
| 120 | 3300048910 | Ga0496107_0011486 | Ga0496107_0011486_4225_5070 | 265 |
| 121 | 3300048916 | Ga0496113_0234782 | Ga0496113_0234782_599_1444 | 265 |
| 122 | 3300048922 | Ga0496119_0026660 | Ga0496119_0026660_2184_3029 | 265 |
| 123 | 3300048924 | Ga0496121_0000177 | Ga0496121_0000177_125328_126173 | 265 |
| 124 | 3300049593 | Ga0501077_0060270 | Ga0501077_0060270_1052_1945 | 267 |
| 125 | 3300053080 | Ga0500635_0001094 | Ga0500635_0001094_869_1780 | 267 |
| 126 | 3300053131 | Ga0500652_009427 | Ga0500652_009427_1634_2545 | 267 |
| 127 | 3300005535 | Ga0070684_100050062 | Ga0070684_1000500623 | 269 |
| 128 | 3300006163 | Ga0070715_10010496 | Ga0070715_100104962 | 269 |
| 129 | 3300009098 | Ga0105245_10060787 | Ga0105245_100607872 | 269 |
| 130 | 3300025901 | Ga0207688_10178121 | Ga0207688_101781211 | 269 |
| 131 | 3300025915 | Ga0207693_10164815 | Ga0207693_101648152 | 269 |
| 132 | 3300025961 | Ga0207712_10518163 | Ga0207712_105181632 | 269 |
| 133 | 3300037312 | Ga0395899_0149726 | Ga0395899_0149726_464_1345 | 269 |
| 134 | 3300037418 | Ga0395900_0272442 | Ga0395900_0272442_336_1217 | 269 |
| 135 | 3300037466 | Ga0395898_0349404 | Ga0395898_0349404_318_1199 | 269 |
| 136 | 3300038443 | Ga0395901_0068340 | Ga0395901_0068340_100_981 | 269 |
| 137 | 3300046459 | Ga0495629_0086930 | Ga0495629_0086930_1251_2111 | 269 |
| 138 | 3300046475 | Ga0495639_0065782 | Ga0495639_0065782_118_978 | 269 |
| 139 | 3300046517 | Ga0495630_0030023 | Ga0495630_0030023_1564_2424 | 269 |
| 140 | 3300046526 | Ga0495666_0091765 | Ga0495666_0091765_150_1010 | 269 |
| 141 | 3300046674 | Ga0495588_0079615 | Ga0495588_0079615_294_1154 | 269 |
| 142 | 3300047673 | Ga0495593_0010942 | Ga0495593_0010942_3797_4657 | 269 |
| 143 | 3300048903 | Ga0496100_0046837 | Ga0496100_0046837_1778_2641 | 269 |
| 144 | 3300048904 | Ga0496101_0105980 | Ga0496101_0105980_820_1683 | 269 |
| 145 | 3300048905 | Ga0496102_0050731 | Ga0496102_0050731_1475_2338 | 269 |
| 146 | 3300048905 | Ga0496102_0379083 | Ga0496102_0379083_113_976 | 269 |
| 147 | 3300048907 | Ga0496104_0080994 | Ga0496104_0080994_412_1275 | 269 |
| 148 | 3300048911 | Ga0496108_0021599 | Ga0496108_0021599_1403_2266 | 269 |
| 149 | 3300048912 | Ga0496109_0053112 | Ga0496109_0053112_2748_3611 | 269 |
| 150 | 3300048913 | Ga0496110_0034997 | Ga0496110_0034997_1136_1999 | 269 |
| 151 | 3300048914 | Ga0496111_0164329 | Ga0496111_0164329_642_1505 | 269 |
| 152 | 3300048916 | Ga0496113_0229290 | Ga0496113_0229290_48_911 | 269 |
| 153 | 3300048917 | Ga0496114_0041127 | Ga0496114_0041127_2595_3458 | 269 |
| 154 | 3300048918 | Ga0496115_0014339 | Ga0496115_0014339_157_1020 | 269 |
| 155 | 3300006038 | Ga0075365_10179843 | Ga0075365_101798432 | 271 |
| 156 | iso_pu_bacteria | 2929212328 | 2929216251 | 271 |
| 157 | 3300014969 | Ga0157376_10192746 | Ga0157376_101927462 | 272 |
| 158 | 3300048909 | Ga0496106_0100080 | Ga0496106_0100080_165_1037 | 272 |
| 159 | 3300048917 | Ga0496114_0220089 | Ga0496114_0220089_101_973 | 272 |
| 160 | 3300059508 | Ga0587088_015224 | Ga0587088_015224_141_1022 | 272 |
| 161 | 3300005437 | Ga0070710_10274469 | Ga0070710_102744691 | 273 |
| 162 | 3300006175 | Ga0070712_100263628 | Ga0070712_1002636282 | 273 |
| 163 | 3300041413 | Ga0439465_0000349 | Ga0439465_0000349_6855_7763 | 273 |
| 164 | 3300005467 | Ga0070706_100143748 | Ga0070706_1001437482 | 274 |
| 165 | 3300005471 | Ga0070698_100001707 | Ga0070698_1000017073 | 274 |
| 166 | 3300025910 | Ga0207684_10083146 | Ga0207684_100831462 | 274 |
| 167 | 3300035117 | Ga0373953_0103639 | Ga0373953_0103639_190_1107 | 274 |
| 168 | 3300035172 | Ga0373955_0173678 | Ga0373955_0173678_20_937 | 274 |
| 169 | 3300035724 | Ga0373933_0041664 | Ga0373933_0041664_1535_2452 | 274 |
| 170 | 3300036401 | Ga0373937_0058434 | Ga0373937_0058434_717_1634 | 274 |
| 171 | 3300037068 | Ga0373925_0021369 | Ga0373925_0021369_1997_2914 | 274 |
| 172 | 3300037068 | Ga0373925_0407596 | Ga0373925_0407596_72_986 | 274 |
| 173 | 3300046462 | Ga0495651_0007208 | Ga0495651_0007208_1924_2841 | 274 |
| 174 | 3300046463 | Ga0495653_0020117 | Ga0495653_0020117_163_1080 | 274 |
| 175 | 3300046477 | Ga0495664_0073805 | Ga0495664_0073805_177_1094 | 274 |
| 176 | 3300046511 | Ga0495608_0010194 | Ga0495608_0010194_4033_4950 | 274 |
| 177 | 3300046529 | Ga0495652_0003641 | Ga0495652_0003641_14045_14962 | 274 |
| 178 | 3300046559 | Ga0495667_0000908 | Ga0495667_0000908_15704_16621 | 274 |
| 179 | 3300046663 | Ga0495635_0011752 | Ga0495635_0011752_3368_4285 | 274 |
| 180 | 3300046675 | Ga0495657_0007099 | Ga0495657_0007099_3864_4781 | 274 |
| 181 | 3300046809 | Ga0495600_0016381 | Ga0495600_0016381_2216_3133 | 274 |
| 182 | 3300047322 | Ga0495680_0001586 | Ga0495680_0001586_17192_18109 | 274 |
| 183 | 3300047444 | Ga0495675_0069594 | Ga0495675_0069594_833_1750 | 274 |
| 184 | 3300047471 | Ga0495684_0040633 | Ga0495684_0040633_700_1617 | 274 |
| 185 | 3300048088 | Ga0495602_0036396 | Ga0495602_0036396_2235_3152 | 274 |
| 186 | 3300049571 | Ga0501034_0154413 | Ga0501034_0154413_473_1369 | 274 |
| 187 | 3300005337 | Ga0070682_100211224 | Ga0070682_1002112242 | 275 |
| 188 | 3300006048 | Ga0075363_100044130 | Ga0075363_1000441302 | 275 |
| 189 | 3300048919 | Ga0496116_0000166 | Ga0496116_0000166_122644_123516 | 275 |
| 190 | 3300050490 | nmdc:mga03n38_107121_c1 | nmdc:mga03n38_107121_c1_322_1227 | 275 |
| 191 | 3300050491 | nmdc:mga00v17_56229_c1 | nmdc:mga00v17_56229_c1_440_1345 | 275 |
| 192 | 3300053119 | Ga0500595_005721 | Ga0500595_005721_690_1562 | 275 |
| 193 | 3300004803 | Ga0058862_12428665 | Ga0058862_124286652 | 276 |
| 194 | 3300005435 | Ga0070714_100051812 | Ga0070714_1000518123 | 276 |
| 195 | 3300005436 | Ga0070713_100040216 | Ga0070713_1000402163 | 276 |
| 196 | 3300005436 | Ga0070713_100078053 | Ga0070713_1000780532 | 276 |
| 197 | 3300005437 | Ga0070710_10003412 | Ga0070710_100034124 | 276 |
| 198 | 3300005439 | Ga0070711_100001607 | Ga0070711_10000160710 | 276 |
| 199 | 3300005445 | Ga0070708_100005610 | Ga0070708_1000056106 | 276 |
| 200 | 3300005467 | Ga0070706_100003990 | Ga0070706_10000399015 | 276 |
| 201 | 3300005467 | Ga0070706_100020205 | Ga0070706_1000202054 | 276 |
| 202 | 3300005468 | Ga0070707_100000041 | Ga0070707_10000004114 | 276 |
| 203 | 3300005471 | Ga0070698_100000082 | Ga0070698_10000008233 | 276 |
| 204 | 3300005471 | Ga0070698_100088595 | Ga0070698_1000885952 | 276 |
| 205 | 3300006028 | Ga0070717_10034026 | Ga0070717_100340263 | 276 |
| 206 | 3300006173 | Ga0070716_100004017 | Ga0070716_1000040174 | 276 |
| 207 | 3300006175 | Ga0070712_100109699 | Ga0070712_1001096992 | 276 |
| 208 | 3300007076 | Ga0075435_100079477 | Ga0075435_1000794772 | 276 |
| 209 | 3300025898 | Ga0207692_10001870 | Ga0207692_100018706 | 276 |
| 210 | 3300025906 | Ga0207699_10002495 | Ga0207699_100024954 | 276 |
| 211 | 3300025910 | Ga0207684_10000339 | Ga0207684_1000033921 | 276 |
| 212 | 3300025910 | Ga0207684_10119551 | Ga0207684_101195512 | 276 |
| 213 | 3300025916 | Ga0207663_10139692 | Ga0207663_101396922 | 276 |
| 214 | 3300025922 | Ga0207646_10000061 | Ga0207646_1000006147 | 276 |
| 215 | 3300025928 | Ga0207700_10006098 | Ga0207700_100060983 | 276 |
| 216 | 3300025928 | Ga0207700_10025193 | Ga0207700_100251933 | 276 |
| 217 | 3300025928 | Ga0207700_10029504 | Ga0207700_100295044 | 276 |
| 218 | 3300025929 | Ga0207664_10032064 | Ga0207664_100320642 | 276 |
| 219 | 3300025939 | Ga0207665_10001670 | Ga0207665_100016705 | 276 |
| 220 | 3300039437 | Ga0436365_0643539 | Ga0436365_0643539_91_981 | 276 |
| 221 | 3300048918 | Ga0496115_0077120 | Ga0496115_0077120_592_1464 | 276 |
| 222 | 3300048918 | Ga0496115_0105139 | Ga0496115_0105139_1150_2025 | 276 |
| 223 | 3300049572 | Ga0501036_0423567 | Ga0501036_0423567_104_1000 | 276 |
| 224 | 3300049578 | Ga0501042_0127505 | Ga0501042_0127505_299_1195 | 276 |
| 225 | 3300049582 | Ga0501048_0139082 | Ga0501048_0139082_150_1046 | 276 |
| 226 | 3300054114 | Ga0501084_0077695 | Ga0501084_0077695_911_1807 | 276 |
| 227 | 3300005471 | Ga0070698_100001184 | Ga0070698_1000011847 | 277 |
| 228 | 3300005548 | Ga0070665_100307865 | Ga0070665_1003078652 | 277 |
| 229 | 3300025898 | Ga0207692_10022310 | Ga0207692_100223103 | 277 |
| 230 | 3300026067 | Ga0207678_10114208 | Ga0207678_101142083 | 277 |
| 231 | 3300035692 | Ga0373935_0116138 | Ga0373935_0116138_123_1040 | 277 |
| 232 | 3300037853 | Ga0436364_0788967 | Ga0436364_0788967_2584_3462 | 277 |
| 233 | 3300044694 | Ga0466963_0021480 | Ga0466963_0021480_1540_2421 | 277 |
| 234 | 3300047471 | Ga0495684_0126045 | Ga0495684_0126045_559_1476 | 277 |
| 235 | 3300048915 | Ga0496112_0051425 | Ga0496112_0051425_2711_3601 | 277 |
| 236 | 3300053087 | Ga0500643_006474 | Ga0500643_006474_3056_3952 | 277 |
| 237 | 3300054114 | Ga0501084_0234005 | Ga0501084_0234005_51_959 | 277 |
| 238 | 3300026041 | Ga0207639_10034426 | Ga0207639_100344263 | 278 |
| 239 | 3300037312 | Ga0395899_0074684 | Ga0395899_0074684_1348_2226 | 278 |
| 240 | 3300037418 | Ga0395900_0059527 | Ga0395900_0059527_1819_2697 | 278 |
| 241 | 3300037471 | Ga0395905_0041489 | Ga0395905_0041489_1730_2608 | 278 |
| 242 | 3300038443 | Ga0395901_0015280 | Ga0395901_0015280_4925_5803 | 278 |
| 243 | 3300044658 | Ga0466972_0007973 | Ga0466972_0007973_2687_3601 | 278 |
| 244 | 3300047472 | Ga0495686_0003330 | Ga0495686_0003330_8530_9414 | 278 |
| 245 | 3300048913 | Ga0496110_0292815 | Ga0496110_0292815_361_1257 | 278 |
| 246 | 3300048928 | Ga0496125_0126667 | Ga0496125_0126667_519_1415 | 278 |
| 247 | 3300053730 | Ga0500645_000035 | Ga0500645_000035_48867_49763 | 278 |
| 248 | iso_pu_bacteria | 2738541274 | 2738704649 | 278 |
| 249 | iso_pu_bacteria | 8046352972 | 8046353996 | 278 |
| 250 | 3300005435 | Ga0070714_100003345 | Ga0070714_1000033458 | 279 |
| 251 | 3300005436 | Ga0070713_100021003 | Ga0070713_1000210032 | 279 |
| 252 | 3300005437 | Ga0070710_10027440 | Ga0070710_100274402 | 279 |
| 253 | 3300006028 | Ga0070717_10018280 | Ga0070717_100182804 | 279 |
| 254 | 3300006038 | Ga0075365_10152450 | Ga0075365_101524502 | 279 |
| 255 | 3300025898 | Ga0207692_10019953 | Ga0207692_100199532 | 279 |
| 256 | 3300025915 | Ga0207693_10072192 | Ga0207693_100721922 | 279 |
| 257 | 3300025916 | Ga0207663_10159109 | Ga0207663_101591092 | 279 |
| 258 | 3300025928 | Ga0207700_10020021 | Ga0207700_100200214 | 279 |
| 259 | 3300025929 | Ga0207664_10002605 | Ga0207664_100026059 | 279 |
| 260 | 3300034819 | Ga0373958_0010115 | Ga0373958_0010115_134_1018 | 279 |
| 261 | 3300046461 | Ga0495641_0010636 | Ga0495641_0010636_25_909 | 279 |
| 262 | 3300048907 | Ga0496104_0082510 | Ga0496104_0082510_1756_2640 | 279 |
| 263 | 3300048909 | Ga0496106_0237974 | Ga0496106_0237974_528_1412 | 279 |
| 264 | 3300048917 | Ga0496114_0088783 | Ga0496114_0088783_1057_1941 | 279 |
| 265 | 3300050492 | nmdc:mga0yw44_20758_c1 | nmdc:mga0yw44_20758_c1_2071_2976 | 279 |
| 266 | 3300005406 | Ga0070703_10000001 | Ga0070703_10000001120 | 280 |
| 267 | 3300005444 | Ga0070694_100122060 | Ga0070694_1001220602 | 280 |
| 268 | 3300005445 | Ga0070708_100001542 | Ga0070708_1000015422 | 280 |
| 269 | 3300005445 | Ga0070708_100309692 | Ga0070708_1003096921 | 280 |
| 270 | 3300005467 | Ga0070706_100010233 | Ga0070706_10001023310 | 280 |
| 271 | 3300005468 | Ga0070707_100008503 | Ga0070707_1000085033 | 280 |
| 272 | 3300005468 | Ga0070707_100011480 | Ga0070707_1000114808 | 280 |
| 273 | 3300005471 | Ga0070698_100538532 | Ga0070698_1005385322 | 280 |
| 274 | 3300005518 | Ga0070699_100009389 | Ga0070699_1000093894 | 280 |
| 275 | 3300005718 | Ga0068866_10013060 | Ga0068866_100130604 | 280 |
| 276 | 3300005844 | Ga0068862_100246674 | Ga0068862_1002466741 | 280 |
| 277 | 3300006881 | Ga0068865_100030675 | Ga0068865_1000306752 | 280 |
| 278 | 3300009098 | Ga0105245_10571908 | Ga0105245_105719082 | 280 |
| 279 | 3300009148 | Ga0105243_10007191 | Ga0105243_1000719110 | 280 |
| 280 | 3300013306 | Ga0163162_10026392 | Ga0163162_100263924 | 280 |
| 281 | 3300014326 | Ga0157380_10261497 | Ga0157380_102614971 | 280 |
| 282 | 3300025885 | Ga0207653_10000004 | Ga0207653_10000004121 | 280 |
| 283 | 3300025899 | Ga0207642_10032954 | Ga0207642_100329542 | 280 |
| 284 | 3300025910 | Ga0207684_10000911 | Ga0207684_1000091114 | 280 |
| 285 | 3300025910 | Ga0207684_10212783 | Ga0207684_102127832 | 280 |
| 286 | 3300025922 | Ga0207646_10007478 | Ga0207646_100074789 | 280 |
| 287 | 3300025923 | Ga0207681_10415696 | Ga0207681_104156962 | 280 |
| 288 | 3300025935 | Ga0207709_10184937 | Ga0207709_101849372 | 280 |
| 289 | 3300026023 | Ga0207677_10236837 | Ga0207677_102368372 | 280 |
| 290 | 3300046455 | Ga0495603_0001901 | Ga0495603_0001901_9270_10154 | 280 |
| 291 | 3300046501 | Ga0495607_0074327 | Ga0495607_0074327_230_1114 | 280 |
| 292 | 3300046518 | Ga0495631_0100388 | Ga0495631_0100388_85_969 | 280 |
| 293 | 3300046664 | Ga0495659_0070679 | Ga0495659_0070679_196_1080 | 280 |
| 294 | 3300048904 | Ga0496101_0058904 | Ga0496101_0058904_948_1832 | 280 |
| 295 | 3300005518 | Ga0070699_100024677 | Ga0070699_1000246773 | 281 |
| 296 | 3300005544 | Ga0070686_100313683 | Ga0070686_1003136832 | 281 |
| 297 | 3300005937 | Ga0081455_10001614 | Ga0081455_1000161414 | 281 |
| 298 | 3300028800 | Ga0265338_10000868 | Ga0265338_1000086842 | 281 |
| 299 | 3300035083 | Ga0373926_0008701 | Ga0373926_0008701_1675_2562 | 281 |
| 300 | 3300035692 | Ga0373935_0012226 | Ga0373935_0012226_1422_2309 | 281 |
| 301 | 3300035725 | Ga0373947_0000014 | Ga0373947_0000014_125287_126174 | 281 |
| 302 | 3300037466 | Ga0395898_0185655 | Ga0395898_0185655_778_1665 | 281 |
| 303 | 3300005329 | Ga0070683_100141571 | Ga0070683_1001415713 | 282 |
| 304 | 3300025944 | Ga0207661_10124084 | Ga0207661_101240842 | 282 |
| 305 | 3300002074 | JGI24748J21848_1002478 | JGI24748J21848_10024782 | 283 |
| 306 | 3300002075 | JGI24738J21930_10003332 | JGI24738J21930_100033323 | 283 |
| 307 | 3300002077 | JGI24744J21845_10000059 | JGI24744J21845_100000592 | 283 |
| 308 | 3300002244 | JGI24742J22300_10000896 | JGI24742J22300_100008963 | 283 |
| 309 | 3300005337 | Ga0070682_100014158 | Ga0070682_1000141585 | 283 |
| 310 | 3300005338 | Ga0068868_100000529 | Ga0068868_10000052912 | 283 |
| 311 | 3300005339 | Ga0070660_100244164 | Ga0070660_1002441642 | 283 |
| 312 | 3300005343 | Ga0070687_100033142 | Ga0070687_1000331422 | 283 |
| 313 | 3300005345 | Ga0070692_10035737 | Ga0070692_100357373 | 283 |
| 314 | 3300005347 | Ga0070668_100005441 | Ga0070668_1000054417 | 283 |
| 315 | 3300005353 | Ga0070669_100023391 | Ga0070669_1000233913 | 283 |
| 316 | 3300005355 | Ga0070671_100228139 | Ga0070671_1002281392 | 283 |
| 317 | 3300005356 | Ga0070674_100003430 | Ga0070674_1000034301 | 283 |
| 318 | 3300005366 | Ga0070659_100040259 | Ga0070659_1000402594 | 283 |
| 319 | 3300005367 | Ga0070667_100002267 | Ga0070667_10000226713 | 283 |
| 320 | 3300005437 | Ga0070710_10000900 | Ga0070710_1000090010 | 283 |
| 321 | 3300005438 | Ga0070701_10003486 | Ga0070701_100034866 | 283 |
| 322 | 3300005439 | Ga0070711_100001095 | Ga0070711_1000010954 | 283 |
| 323 | 3300005440 | Ga0070705_100051171 | Ga0070705_1000511712 | 283 |
| 324 | 3300005441 | Ga0070700_100009233 | Ga0070700_1000092333 | 283 |
| 325 | 3300005455 | Ga0070663_100063252 | Ga0070663_1000632522 | 283 |
| 326 | 3300005456 | Ga0070678_100009361 | Ga0070678_1000093614 | 283 |
| 327 | 3300005457 | Ga0070662_100017040 | Ga0070662_1000170402 | 283 |
| 328 | 3300005459 | Ga0068867_100001323 | Ga0068867_1000013235 | 283 |
| 329 | 3300005543 | Ga0070672_100069003 | Ga0070672_1000690033 | 283 |
| 330 | 3300005546 | Ga0070696_100003305 | Ga0070696_1000033057 | 283 |
| 331 | 3300005547 | Ga0070693_100039640 | Ga0070693_1000396403 | 283 |
| 332 | 3300005548 | Ga0070665_100001745 | Ga0070665_10000174527 | 283 |
| 333 | 3300005548 | Ga0070665_100015595 | Ga0070665_1000155958 | 283 |
| 334 | 3300005549 | Ga0070704_100000706 | Ga0070704_1000007064 | 283 |
| 335 | 3300005578 | Ga0068854_100001286 | Ga0068854_1000012862 | 283 |
| 336 | 3300005614 | Ga0068856_100317942 | Ga0068856_1003179422 | 283 |
| 337 | 3300005616 | Ga0068852_100040065 | Ga0068852_1000400653 | 283 |
| 338 | 3300005617 | Ga0068859_100003134 | Ga0068859_1000031345 | 283 |
| 339 | 3300005718 | Ga0068866_10000376 | Ga0068866_1000037618 | 283 |
| 340 | 3300005719 | Ga0068861_100018600 | Ga0068861_1000186003 | 283 |
| 341 | 3300005842 | Ga0068858_100002465 | Ga0068858_1000024653 | 283 |
| 342 | 3300005843 | Ga0068860_100025928 | Ga0068860_1000259284 | 283 |
| 343 | 3300005844 | Ga0068862_100002116 | Ga0068862_1000021163 | 283 |
| 344 | 3300006163 | Ga0070715_10010773 | Ga0070715_100107733 | 283 |
| 345 | 3300006173 | Ga0070716_100002661 | Ga0070716_1000026614 | 283 |
| 346 | 3300006175 | Ga0070712_100001062 | Ga0070712_10000106214 | 283 |
| 347 | 3300006237 | Ga0097621_100015140 | Ga0097621_1000151404 | 283 |
| 348 | 3300006871 | Ga0075434_100003943 | Ga0075434_1000039433 | 283 |
| 349 | 3300006881 | Ga0068865_100000828 | Ga0068865_1000008284 | 283 |
| 350 | 3300006931 | Ga0097620_100003133 | Ga0097620_10000313314 | 283 |
| 351 | 3300007076 | Ga0075435_100007491 | Ga0075435_1000074912 | 283 |
| 352 | 3300009093 | Ga0105240_10420787 | Ga0105240_104207872 | 283 |
| 353 | 3300009098 | Ga0105245_10003220 | Ga0105245_100032206 | 283 |
| 354 | 3300009101 | Ga0105247_10004659 | Ga0105247_100046598 | 283 |
| 355 | 3300009147 | Ga0114129_10039891 | Ga0114129_100398913 | 283 |
| 356 | 3300009148 | Ga0105243_10003249 | Ga0105243_1000324913 | 283 |
| 357 | 3300009174 | Ga0105241_10019951 | Ga0105241_100199514 | 283 |
| 358 | 3300009176 | Ga0105242_10000620 | Ga0105242_1000062015 | 283 |
| 359 | 3300009177 | Ga0105248_10008918 | Ga0105248_100089183 | 283 |
| 360 | 3300009545 | Ga0105237_10034235 | Ga0105237_100342352 | 283 |
| 361 | 3300009553 | Ga0105249_10000767 | Ga0105249_1000076719 | 283 |
| 362 | 3300010375 | Ga0105239_10007818 | Ga0105239_100078185 | 283 |
| 363 | 3300011119 | Ga0105246_10390088 | Ga0105246_103900882 | 283 |
| 364 | 3300013297 | Ga0157378_10001690 | Ga0157378_1000169014 | 283 |
| 365 | 3300013306 | Ga0163162_10003614 | Ga0163162_100036143 | 283 |
| 366 | 3300013307 | Ga0157372_10026882 | Ga0157372_100268822 | 283 |
| 367 | 3300013308 | Ga0157375_10003452 | Ga0157375_1000345211 | 283 |
| 368 | 3300014326 | Ga0157380_10003813 | Ga0157380_100038132 | 283 |
| 369 | 3300014968 | Ga0157379_10037357 | Ga0157379_100373574 | 283 |
| 370 | 3300014969 | Ga0157376_10072953 | Ga0157376_100729532 | 283 |
| 371 | 3300025898 | Ga0207692_10022696 | Ga0207692_100226963 | 283 |
| 372 | 3300025899 | Ga0207642_10002962 | Ga0207642_100029624 | 283 |
| 373 | 3300025901 | Ga0207688_10000352 | Ga0207688_1000035214 | 283 |
| 374 | 3300025903 | Ga0207680_10022427 | Ga0207680_100224272 | 283 |
| 375 | 3300025905 | Ga0207685_10004410 | Ga0207685_100044102 | 283 |
| 376 | 3300025907 | Ga0207645_10179654 | Ga0207645_101796542 | 283 |
| 377 | 3300025914 | Ga0207671_10092022 | Ga0207671_100920222 | 283 |
| 378 | 3300025915 | Ga0207693_10001171 | Ga0207693_100011719 | 283 |
| 379 | 3300025916 | Ga0207663_10005265 | Ga0207663_100052654 | 283 |
| 380 | 3300025923 | Ga0207681_10034439 | Ga0207681_100344393 | 283 |
| 381 | 3300025927 | Ga0207687_10001147 | Ga0207687_1000114715 | 283 |
| 382 | 3300025928 | Ga0207700_10378642 | Ga0207700_103786422 | 283 |
| 383 | 3300025929 | Ga0207664_10024393 | Ga0207664_100243931 | 283 |
| 384 | 3300025932 | Ga0207690_10053908 | Ga0207690_100539082 | 283 |
| 385 | 3300025933 | Ga0207706_10001128 | Ga0207706_1000112828 | 283 |
| 386 | 3300025935 | Ga0207709_10007186 | Ga0207709_100071864 | 283 |
| 387 | 3300025936 | Ga0207670_10147758 | Ga0207670_101477582 | 283 |
| 388 | 3300025938 | Ga0207704_10000377 | Ga0207704_1000037716 | 283 |
| 389 | 3300025939 | Ga0207665_10005772 | Ga0207665_100057725 | 283 |
| 390 | 3300025940 | Ga0207691_10053456 | Ga0207691_100534564 | 283 |
| 391 | 3300025941 | Ga0207711_10100926 | Ga0207711_101009262 | 283 |
| 392 | 3300025972 | Ga0207668_10029780 | Ga0207668_100297804 | 283 |
| 393 | 3300025972 | Ga0207668_10081132 | Ga0207668_100811322 | 283 |
| 394 | 3300025981 | Ga0207640_10003409 | Ga0207640_100034095 | 283 |
| 395 | 3300025986 | Ga0207658_10014963 | Ga0207658_100149634 | 283 |
| 396 | 3300026023 | Ga0207677_10044279 | Ga0207677_100442793 | 283 |
| 397 | 3300026035 | Ga0207703_10014135 | Ga0207703_100141354 | 283 |
| 398 | 3300026067 | Ga0207678_10003778 | Ga0207678_1000377814 | 283 |
| 399 | 3300026075 | Ga0207708_10001592 | Ga0207708_100015923 | 283 |
| 400 | 3300026089 | Ga0207648_10001355 | Ga0207648_1000135517 | 283 |
| 401 | 3300026118 | Ga0207675_100006054 | Ga0207675_10000605411 | 283 |
| 402 | 3300026121 | Ga0207683_10000201 | Ga0207683_1000020142 | 283 |
| 403 | 3300028379 | Ga0268266_10142200 | Ga0268266_101422002 | 283 |
| 404 | 3300028381 | Ga0268264_10031711 | Ga0268264_100317112 | 283 |
| 405 | 3300035083 | Ga0373926_0050445 | Ga0373926_0050445_450_1346 | 283 |
| 406 | 3300035691 | Ga0373931_0084987 | Ga0373931_0084987_13_915 | 283 |
| 407 | 3300046516 | Ga0495628_0203841 | Ga0495628_0203841_244_1140 | 283 |
| 408 | 3300046533 | Ga0495640_0102017 | Ga0495640_0102017_345_1241 | 283 |
| 409 | 3300046543 | Ga0495645_0347442 | Ga0495645_0347442_49_945 | 283 |
| 410 | 3300046678 | Ga0495599_0094061 | Ga0495599_0094061_100_996 | 283 |
| 411 | 3300046679 | Ga0495623_0022640 | Ga0495623_0022640_2984_3880 | 283 |
| 412 | 3300046689 | Ga0495613_0333621 | Ga0495613_0333621_58_954 | 283 |
| 413 | 3300048903 | Ga0496100_0004799 | Ga0496100_0004799_3520_4422 | 283 |
| 414 | 3300048904 | Ga0496101_0015217 | Ga0496101_0015217_461_1363 | 283 |
| 415 | 3300048905 | Ga0496102_0001309 | Ga0496102_0001309_14704_15606 | 283 |
| 416 | 3300048906 | Ga0496103_0019054 | Ga0496103_0019054_1002_1904 | 283 |
| 417 | 3300048910 | Ga0496107_0000321 | Ga0496107_0000321_11689_12591 | 283 |
| 418 | 3300048917 | Ga0496114_0000495 | Ga0496114_0000495_19189_20091 | 283 |
| 419 | 3300050507 | nmdc:mga05p37_47560_c1 | nmdc:mga05p37_47560_c1_1200_2096 | 283 |
| 420 | 3300050512 | nmdc:mga0n895_17799_c1 | nmdc:mga0n895_17799_c1_1637_2533 | 283 |
| 421 | 3300050513 | nmdc:mga0rr50_3260_c1 | nmdc:mga0rr50_3260_c1_1571_2467 | 283 |
| 422 | 3300050515 | nmdc:mga0a205_2637_c1 | nmdc:mga0a205_2637_c1_11542_12438 | 283 |
| 423 | iso_pu_bacteria | 2643221687 | 2644488272 | 283 |
| 424 | iso_pu_bacteria | 2902837492 | 2902841360 | 283 |
| 425 | 3300025944 | Ga0207661_10370158 | Ga0207661_103701582 | 284 |
| 426 | 3300048903 | Ga0496100_0308196 | Ga0496100_0308196_22_912 | 284 |
| 427 | 3300005440 | Ga0070705_100275775 | Ga0070705_1002757751 | 285 |
| 428 | 3300005546 | Ga0070696_100003753 | Ga0070696_10000375311 | 285 |
| 429 | 3300006048 | Ga0075363_100002644 | Ga0075363_1000026443 | 285 |
| 430 | 3300006051 | Ga0075364_10040448 | Ga0075364_100404483 | 285 |
| 431 | 3300006353 | Ga0075370_10008783 | Ga0075370_100087835 | 285 |
| 432 | 3300009176 | Ga0105242_10396592 | Ga0105242_103965922 | 285 |
| 433 | 3300009177 | Ga0105248_10702917 | Ga0105248_107029172 | 285 |
| 434 | 3300021388 | Ga0213875_10000604 | Ga0213875_100006044 | 285 |
| 435 | 3300028379 | Ga0268266_10174708 | Ga0268266_101747082 | 285 |
| 436 | 3300037853 | Ga0436364_1435297 | Ga0436364_1435297_25447_26349 | 285 |
| 437 | 3300044658 | Ga0466972_0086532 | Ga0466972_0086532_333_1241 | 285 |
| 438 | 3300044683 | Ga0466965_0002177 | Ga0466965_0002177_5650_6558 | 285 |
| 439 | 3300044735 | Ga0466968_0001088 | Ga0466968_0001088_3016_3924 | 285 |
| 440 | 3300044765 | Ga0466970_0016640 | Ga0466970_0016640_121_1029 | 285 |
| 441 | 3300044842 | Ga0466957_0020512 | Ga0466957_0020512_1693_2601 | 285 |
| 442 | 3300044901 | Ga0466960_0042012 | Ga0466960_0042012_189_1097 | 285 |
| 443 | 3300045049 | Ga0466959_0098581 | Ga0466959_0098581_582_1490 | 285 |
| 444 | 3300045976 | Ga0466967_0030898 | Ga0466967_0030898_1662_2561 | 285 |
| 445 | 3300045976 | Ga0466967_0036069 | Ga0466967_0036069_1034_1942 | 285 |
| 446 | 3300046460 | Ga0495638_0002264 | Ga0495638_0002264_5857_6768 | 285 |
| 447 | 3300046692 | Ga0495671_0071222 | Ga0495671_0071222_137_1048 | 285 |
| 448 | 3300050490 | nmdc:mga03n38_7306_c1 | nmdc:mga03n38_7306_c1_450_1352 | 285 |
| 449 | 3300050494 | nmdc:mga06z11_20869_c1 | nmdc:mga06z11_20869_c1_1077_1979 | 285 |
| 450 | 3300053104 | Ga0500556_0001572 | Ga0500556_0001572_2919_3830 | 285 |
| 451 | iso_pu_bacteria | 2902792274 | 2902795185 | 285 |
| 452 | 3300003792 | Ga0055540_1002276 | Ga0055540_10022767 | 286 |
| 453 | 3300005467 | Ga0070706_100209148 | Ga0070706_1002091482 | 286 |
| 454 | 3300005471 | Ga0070698_100001142 | Ga0070698_10000114211 | 286 |
| 455 | 3300006048 | Ga0075363_100014116 | Ga0075363_1000141163 | 286 |
| 456 | 3300006051 | Ga0075364_10000184 | Ga0075364_1000018413 | 286 |
| 457 | 3300006186 | Ga0075369_10001695 | Ga0075369_100016958 | 286 |
| 458 | 3300025303 | Ga0209051_1000528 | Ga0209051_100052835 | 286 |
| 459 | 3300049570 | Ga0501033_0243681 | Ga0501033_0243681_116_1015 | 286 |
| 460 | 3300049571 | Ga0501034_0033607 | Ga0501034_0033607_423_1322 | 286 |
| 461 | 3300049572 | Ga0501036_0222418 | Ga0501036_0222418_94_993 | 286 |
| 462 | 3300049575 | Ga0501039_0120633 | Ga0501039_0120633_1061_1960 | 286 |
| 463 | 3300049581 | Ga0501047_0392040 | Ga0501047_0392040_97_996 | 286 |
| 464 | 3300049583 | Ga0501067_0004530 | Ga0501067_0004530_3863_4762 | 286 |
| 465 | 3300049583 | Ga0501067_0012811 | Ga0501067_0012811_724_1623 | 286 |
| 466 | 3300049584 | Ga0501068_0010913 | Ga0501068_0010913_4079_4978 | 286 |
| 467 | 3300049584 | Ga0501068_0133839 | Ga0501068_0133839_75_974 | 286 |
| 468 | 3300049586 | Ga0501070_0097237 | Ga0501070_0097237_749_1648 | 286 |
| 469 | 3300049587 | Ga0501071_0007468 | Ga0501071_0007468_1695_2594 | 286 |
| 470 | 3300049588 | Ga0501072_0064713 | Ga0501072_0064713_742_1641 | 286 |
| 471 | 3300049589 | Ga0501073_0045442 | Ga0501073_0045442_885_1784 | 286 |
| 472 | 3300049589 | Ga0501073_0046934 | Ga0501073_0046934_691_1590 | 286 |
| 473 | 3300049590 | Ga0501074_0004203 | Ga0501074_0004203_770_1669 | 286 |
| 474 | 3300049590 | Ga0501074_0034406 | Ga0501074_0034406_2004_2903 | 286 |
| 475 | 3300049593 | Ga0501077_0031697 | Ga0501077_0031697_462_1361 | 286 |
| 476 | 3300049742 | Ga0501080_0004291 | Ga0501080_0004291_10665_11564 | 286 |
| 477 | 3300049744 | Ga0501083_0016126 | Ga0501083_0016126_1337_2236 | 286 |
| 478 | 3300049744 | Ga0501083_0055094 | Ga0501083_0055094_1274_2173 | 286 |
| 479 | 3300050491 | nmdc:mga00v17_135666_c1 | nmdc:mga00v17_135666_c1_358_1278 | 286 |
| 480 | 3300050492 | nmdc:mga0yw44_250629_c1 | nmdc:mga0yw44_250629_c1_142_1047 | 286 |
| 481 | 3300050516 | nmdc:mga0sz30_29531_c1 | nmdc:mga0sz30_29531_c1_350_1258 | 286 |
| 482 | 3300060353 | Ga0501082_0022336 | Ga0501082_0022336_3708_4607 | 286 |
| 483 | 3300060353 | Ga0501082_0205960 | Ga0501082_0205960_707_1606 | 286 |
| 484 | iso_pu_bacteria | 2902810491 | 2902811300 | 286 |
| 485 | 3300003792 | Ga0055540_1001155 | Ga0055540_10011558 | 287 |
| 486 | 3300006038 | Ga0075365_10005332 | Ga0075365_100053325 | 287 |
| 487 | 3300006048 | Ga0075363_100000787 | Ga0075363_1000007877 | 287 |
| 488 | 3300006051 | Ga0075364_10006965 | Ga0075364_100069654 | 287 |
| 489 | 3300006177 | Ga0075362_10001354 | Ga0075362_100013543 | 287 |
| 490 | 3300006178 | Ga0075367_10001919 | Ga0075367_100019195 | 287 |
| 491 | 3300006186 | Ga0075369_10010682 | Ga0075369_100106824 | 287 |
| 492 | 3300006186 | Ga0075369_10047085 | Ga0075369_100470852 | 287 |
| 493 | 3300006195 | Ga0075366_10018409 | Ga0075366_100184093 | 287 |
| 494 | 3300006353 | Ga0075370_10127936 | Ga0075370_101279362 | 287 |
| 495 | 3300013104 | Ga0157370_10413230 | Ga0157370_104132302 | 287 |
| 496 | 3300025303 | Ga0209051_1001208 | Ga0209051_100120816 | 287 |
| 497 | 3300025303 | Ga0209051_1008439 | Ga0209051_10084393 | 287 |
| 498 | 3300025303 | Ga0209051_1028400 | Ga0209051_10284002 | 287 |
| 499 | 3300026089 | Ga0207648_10116894 | Ga0207648_101168942 | 287 |
| 500 | 3300028379 | Ga0268266_10272479 | Ga0268266_102724792 | 287 |
| 501 | 3300041452 | Ga0451793_1294871 | Ga0451793_1294871_21_929 | 287 |
| 502 | 3300041456 | Ga0451795_0883130 | Ga0451795_0883130_441_1349 | 287 |
| 503 | 3300042436 | Ga0439435_0011347 | Ga0439435_0011347_57_965 | 287 |
| 504 | 3300050489 | nmdc:mga03683_3552_c1 | nmdc:mga03683_3552_c1_2015_2923 | 287 |
| 505 | 3300050491 | nmdc:mga00v17_5888_c1 | nmdc:mga00v17_5888_c1_4591_5499 | 287 |
| 506 | 3300050493 | nmdc:mga0k408_17139_c1 | nmdc:mga0k408_17139_c1_1073_1981 | 287 |
| 507 | 3300050494 | nmdc:mga06z11_4051_c1 | nmdc:mga06z11_4051_c1_1956_2864 | 287 |
| 508 | 3300050516 | nmdc:mga0sz30_10406_c1 | nmdc:mga0sz30_10406_c1_1891_2799 | 287 |
| 509 | 3300053153 | Ga0500616_0011465 | Ga0500616_0011465_4048_4956 | 287 |
| 510 | 3300005471 | Ga0070698_100225844 | Ga0070698_1002258442 | 288 |
| 511 | 3300005518 | Ga0070699_100000528 | Ga0070699_10000052833 | 288 |
| 512 | 3300005536 | Ga0070697_100205425 | Ga0070697_1002054252 | 288 |
| 513 | 3300005539 | Ga0068853_100016775 | Ga0068853_1000167754 | 288 |
| 514 | 3300025906 | Ga0207699_10012397 | Ga0207699_100123972 | 288 |
| 515 | 3300025910 | Ga0207684_10170973 | Ga0207684_101709732 | 288 |
| 516 | 3300025922 | Ga0207646_10004855 | Ga0207646_100048556 | 288 |
| 517 | 3300025928 | Ga0207700_10181062 | Ga0207700_101810622 | 288 |
| 518 | 3300025929 | Ga0207664_10474410 | Ga0207664_104744102 | 288 |
| 519 | 3300037853 | Ga0436364_0609957 | Ga0436364_0609957_57_971 | 288 |
| 520 | iso_pu_bacteria | 2939582691 | 2939583060 | 288 |
| 521 | 3300005468 | Ga0070707_100030744 | Ga0070707_1000307446 | 289 |
| 522 | 3300005468 | Ga0070707_100209642 | Ga0070707_1002096422 | 289 |
| 523 | 3300005530 | Ga0070679_100100836 | Ga0070679_1001008361 | 289 |
| 524 | 3300005548 | Ga0070665_100389553 | Ga0070665_1003895532 | 289 |
| 525 | 3300005841 | Ga0068863_100308739 | Ga0068863_1003087391 | 289 |
| 526 | 3300005842 | Ga0068858_100445074 | Ga0068858_1004450741 | 289 |
| 527 | 3300005983 | Ga0081540_1000505 | Ga0081540_10005055 | 289 |
| 528 | 3300009148 | Ga0105243_10028694 | Ga0105243_100286943 | 289 |
| 529 | 3300009177 | Ga0105248_10044839 | Ga0105248_100448394 | 289 |
| 530 | 3300009553 | Ga0105249_10181192 | Ga0105249_101811923 | 289 |
| 531 | 3300010375 | Ga0105239_10007516 | Ga0105239_100075162 | 289 |
| 532 | 3300013102 | Ga0157371_10134550 | Ga0157371_101345502 | 289 |
| 533 | 3300013308 | Ga0157375_10786924 | Ga0157375_107869242 | 289 |
| 534 | 3300025910 | Ga0207684_10507067 | Ga0207684_105070671 | 289 |
| 535 | 3300025915 | Ga0207693_10424985 | Ga0207693_104249852 | 289 |
| 536 | 3300025922 | Ga0207646_10020298 | Ga0207646_100202987 | 289 |
| 537 | 3300025928 | Ga0207700_10179931 | Ga0207700_101799312 | 289 |
| 538 | 3300025941 | Ga0207711_10051435 | Ga0207711_100514352 | 289 |
| 539 | 3300026075 | Ga0207708_10006707 | Ga0207708_100067076 | 289 |
| 540 | 3300026088 | Ga0207641_10134177 | Ga0207641_101341772 | 289 |
| 541 | 3300028381 | Ga0268264_10209352 | Ga0268264_102093522 | 289 |
| 542 | 3300028556 | Ga0265337_1000027 | Ga0265337_10000278 | 289 |
| 543 | 3300028558 | Ga0265326_10001234 | Ga0265326_100012346 | 289 |
| 544 | 3300028563 | Ga0265319_1001055 | Ga0265319_100105512 | 289 |
| 545 | 3300028573 | Ga0265334_10000773 | Ga0265334_100007738 | 289 |
| 546 | 3300028577 | Ga0265318_10099600 | Ga0265318_100996002 | 289 |
| 547 | 3300028653 | Ga0265323_10082254 | Ga0265323_100822541 | 289 |
| 548 | 3300028654 | Ga0265322_10001284 | Ga0265322_100012845 | 289 |
| 549 | 3300028666 | Ga0265336_10002288 | Ga0265336_100022885 | 289 |
| 550 | 3300028800 | Ga0265338_10000227 | Ga0265338_1000022784 | 289 |
| 551 | 3300028800 | Ga0265338_10007886 | Ga0265338_1000788612 | 289 |
| 552 | 3300029957 | Ga0265324_10004386 | Ga0265324_100043864 | 289 |
| 553 | 3300031238 | Ga0265332_10001185 | Ga0265332_100011858 | 289 |
| 554 | 3300031240 | Ga0265320_10049797 | Ga0265320_100497972 | 289 |
| 555 | 3300031247 | Ga0265340_10005777 | Ga0265340_100057773 | 289 |
| 556 | 3300031344 | Ga0265316_10007705 | Ga0265316_100077056 | 289 |
| 557 | 3300031595 | Ga0265313_10010516 | Ga0265313_100105165 | 289 |
| 558 | 3300031711 | Ga0265314_10010105 | Ga0265314_100101056 | 289 |
| 559 | 3300031712 | Ga0265342_10012177 | Ga0265342_100121773 | 289 |
| 560 | 3300035116 | Ga0373945_0013583 | Ga0373945_0013583_1535_2452 | 289 |
| 561 | 3300035118 | Ga0373954_0006920 | Ga0373954_0006920_59_976 | 289 |
| 562 | 3300035119 | Ga0373956_0003259 | Ga0373956_0003259_748_1665 | 289 |
| 563 | 3300035120 | Ga0373957_0059689 | Ga0373957_0059689_370_1287 | 289 |
| 564 | 3300035170 | Ga0373943_0028168 | Ga0373943_0028168_1403_2320 | 289 |
| 565 | 3300035692 | Ga0373935_0039727 | Ga0373935_0039727_1515_2432 | 289 |
| 566 | 3300035695 | Ga0373927_0041032 | Ga0373927_0041032_1636_2553 | 289 |
| 567 | 3300035724 | Ga0373933_0033929 | Ga0373933_0033929_1914_2831 | 289 |
| 568 | 3300035725 | Ga0373947_0126368 | Ga0373947_0126368_391_1308 | 289 |
| 569 | 3300037853 | Ga0436364_1520571 | Ga0436364_1520571_17002_17928 | 289 |
| 570 | 3300046455 | Ga0495603_0024918 | Ga0495603_0024918_144_1061 | 289 |
| 571 | 3300046459 | Ga0495629_0012234 | Ga0495629_0012234_47_964 | 289 |
| 572 | 3300046462 | Ga0495651_0126444 | Ga0495651_0126444_519_1436 | 289 |
| 573 | 3300046463 | Ga0495653_0236867 | Ga0495653_0236867_33_950 | 289 |
| 574 | 3300046473 | Ga0495582_0021817 | Ga0495582_0021817_2068_2985 | 289 |
| 575 | 3300046475 | Ga0495639_0045890 | Ga0495639_0045890_321_1238 | 289 |
| 576 | 3300046476 | Ga0495662_0001666 | Ga0495662_0001666_10013_10930 | 289 |
| 577 | 3300046506 | Ga0495583_0086756 | Ga0495583_0086756_345_1262 | 289 |
| 578 | 3300046517 | Ga0495630_0009396 | Ga0495630_0009396_2862_3779 | 289 |
| 579 | 3300046524 | Ga0495648_0005458 | Ga0495648_0005458_3667_4584 | 289 |
| 580 | 3300046526 | Ga0495666_0022153 | Ga0495666_0022153_659_1576 | 289 |
| 581 | 3300046530 | Ga0495654_0096373 | Ga0495654_0096373_310_1227 | 289 |
| 582 | 3300046531 | Ga0495665_0013989 | Ga0495665_0013989_3115_4032 | 289 |
| 583 | 3300046535 | Ga0495586_0023326 | Ga0495586_0023326_479_1396 | 289 |
| 584 | 3300046543 | Ga0495645_0032170 | Ga0495645_0032170_269_1186 | 289 |
| 585 | 3300046642 | Ga0495634_0048446 | Ga0495634_0048446_477_1394 | 289 |
| 586 | 3300046663 | Ga0495635_0312367 | Ga0495635_0312367_68_985 | 289 |
| 587 | 3300046681 | Ga0495647_0020032 | Ga0495647_0020032_823_1740 | 289 |
| 588 | 3300046683 | Ga0495658_0211320 | Ga0495658_0211320_164_1081 | 289 |
| 589 | 3300046809 | Ga0495600_0009939 | Ga0495600_0009939_3662_4579 | 289 |
| 590 | 3300047317 | Ga0495604_0206667 | Ga0495604_0206667_140_1057 | 289 |
| 591 | 3300047320 | Ga0495672_0030900 | Ga0495672_0030900_2286_3203 | 289 |
| 592 | 3300047321 | Ga0495676_0040298 | Ga0495676_0040298_134_1051 | 289 |
| 593 | 3300047322 | Ga0495680_0029597 | Ga0495680_0029597_63_980 | 289 |
| 594 | 3300047444 | Ga0495675_0049564 | Ga0495675_0049564_1399_2316 | 289 |
| 595 | 3300047469 | Ga0495673_0001205 | Ga0495673_0001205_7625_8542 | 289 |
| 596 | 3300047471 | Ga0495684_0102820 | Ga0495684_0102820_449_1366 | 289 |
| 597 | 3300047673 | Ga0495593_0009218 | Ga0495593_0009218_4637_5554 | 289 |
| 598 | 3300048903 | Ga0496100_0002367 | Ga0496100_0002367_172_1095 | 289 |
| 599 | 3300048904 | Ga0496101_0025140 | Ga0496101_0025140_1886_2809 | 289 |
| 600 | 3300048905 | Ga0496102_0000001 | Ga0496102_0000001_223139_224056 | 289 |
| 601 | 3300048906 | Ga0496103_0000007 | Ga0496103_0000007_131633_132550 | 289 |
| 602 | 3300048907 | Ga0496104_0010504 | Ga0496104_0010504_1091_2014 | 289 |
| 603 | 3300048908 | Ga0496105_0023961 | Ga0496105_0023961_1068_1991 | 289 |
| 604 | 3300048909 | Ga0496106_0003195 | Ga0496106_0003195_7648_8571 | 289 |
| 605 | 3300048910 | Ga0496107_0003559 | Ga0496107_0003559_1786_2709 | 289 |
| 606 | 3300048917 | Ga0496114_0002288 | Ga0496114_0002288_7237_8160 | 289 |
| 607 | 3300048918 | Ga0496115_0003085 | Ga0496115_0003085_2915_3838 | 289 |
| 608 | 3300048919 | Ga0496116_0000018 | Ga0496116_0000018_186241_187158 | 289 |
| 609 | 3300048920 | Ga0496117_0000015 | Ga0496117_0000015_358720_359637 | 289 |
| 610 | 3300048921 | Ga0496118_0000012 | Ga0496118_0000012_358720_359637 | 289 |
| 611 | 3300048923 | Ga0496120_0006298 | Ga0496120_0006298_2184_3101 | 289 |
| 612 | 3300048929 | Ga0496126_0001113 | Ga0496126_0001113_35353_36270 | 289 |
| 613 | 3300053077 | Ga0495601_0016295 | Ga0495601_0016295_2068_2985 | 289 |
| 614 | 3300053078 | Ga0495612_0003214 | Ga0495612_0003214_4362_5279 | 289 |
| 615 | 3300053085 | Ga0495619_0044877 | Ga0495619_0044877_1913_2830 | 289 |
| 616 | 3300053087 | Ga0500643_001862 | Ga0500643_001862_4702_5619 | 289 |
| 617 | 3300005436 | Ga0070713_100004385 | Ga0070713_1000043855 | 290 |
| 618 | 3300025928 | Ga0207700_10078194 | Ga0207700_100781943 | 290 |
| 619 | 3300025929 | Ga0207664_10002329 | Ga0207664_100023296 | 290 |
| 620 | 3300031901 | Ga0307406_10073259 | Ga0307406_100732592 | 290 |
| 621 | 3300041410 | Ga0439461_0002575 | Ga0439461_0002575_769_1692 | 290 |
| 622 | 3300041411 | Ga0439466_0006609 | Ga0439466_0006609_1741_2664 | 290 |
| 623 | 3300041413 | Ga0439465_0009359 | Ga0439465_0009359_1993_2916 | 290 |
| 624 | 3300041997 | Ga0439431_0000859 | Ga0439431_0000859_1763_2686 | 290 |
| 625 | 3300042004 | Ga0439445_0004897 | Ga0439445_0004897_1055_1978 | 290 |
| 626 | 3300042435 | Ga0439434_0010181 | Ga0439434_0010181_898_1821 | 290 |
| 627 | 3300048091 | Ga0495626_0067444 | Ga0495626_0067444_628_1539 | 290 |
| 628 | 3300053108 | Ga0500562_017191 | Ga0500562_017191_69_980 | 290 |
| 629 | 3300006038 | Ga0075365_10015384 | Ga0075365_100153842 | 292 |
| 630 | 3300050491 | nmdc:mga00v17_17742_c2 | nmdc:mga00v17_17742_c2_126_1052 | 292 |
| 631 | 3300025939 | Ga0207665_10099187 | Ga0207665_100991872 | 293 |
| 632 | 3300005331 | Ga0070670_100102481 | Ga0070670_1001024812 | 294 |
| 633 | 3300005355 | Ga0070671_100013019 | Ga0070671_1000130194 | 294 |
| 634 | 3300005618 | Ga0068864_100083451 | Ga0068864_1000834513 | 294 |
| 635 | 3300005841 | Ga0068863_100001514 | Ga0068863_10000151420 | 294 |
| 636 | 3300006048 | Ga0075363_100053215 | Ga0075363_1000532152 | 294 |
| 637 | 3300025931 | Ga0207644_10005208 | Ga0207644_100052085 | 294 |
| 638 | 3300026088 | Ga0207641_10003507 | Ga0207641_100035076 | 294 |
| 639 | 3300026095 | Ga0207676_10154531 | Ga0207676_101545312 | 294 |
| 640 | 3300048905 | Ga0496102_0000590 | Ga0496102_0000590_19259_20179 | 294 |
| 641 | 3300048907 | Ga0496104_0040855 | Ga0496104_0040855_2120_3040 | 294 |
| 642 | 3300048913 | Ga0496110_0040938 | Ga0496110_0040938_1703_2623 | 294 |
| 643 | 3300048914 | Ga0496111_0051875 | Ga0496111_0051875_184_1104 | 294 |
| 644 | 3300050490 | nmdc:mga03n38_48851_c1 | nmdc:mga03n38_48851_c1_627_1553 | 294 |
| 645 | 3300050496 | nmdc:mga07m45_35430_c1 | nmdc:mga07m45_35430_c1_413_1354 | 296 |
| 646 | 3300001977 | JGI24746J21847_1000089 | JGI24746J21847_10000891 | 297 |
| 647 | 3300001991 | JGI24743J22301_10021890 | JGI24743J22301_100218901 | 297 |
| 648 | 3300002073 | JGI24745J21846_1007302 | JGI24745J21846_10073022 | 297 |
| 649 | 3300002244 | JGI24742J22300_10012450 | JGI24742J22300_100124502 | 297 |
| 650 | 3300005338 | Ga0068868_100072971 | Ga0068868_1000729712 | 297 |
| 651 | 3300005339 | Ga0070660_100146561 | Ga0070660_1001465612 | 297 |
| 652 | 3300005341 | Ga0070691_10077817 | Ga0070691_100778172 | 297 |
| 653 | 3300005343 | Ga0070687_100063030 | Ga0070687_1000630302 | 297 |
| 654 | 3300005356 | Ga0070674_100038775 | Ga0070674_1000387753 | 297 |
| 655 | 3300005365 | Ga0070688_100057587 | Ga0070688_1000575872 | 297 |
| 656 | 3300005367 | Ga0070667_100482840 | Ga0070667_1004828401 | 297 |
| 657 | 3300005434 | Ga0070709_10055022 | Ga0070709_100550222 | 297 |
| 658 | 3300005437 | Ga0070710_10001923 | Ga0070710_100019233 | 297 |
| 659 | 3300005438 | Ga0070701_10027888 | Ga0070701_100278882 | 297 |
| 660 | 3300005441 | Ga0070700_100053837 | Ga0070700_1000538372 | 297 |
| 661 | 3300005444 | Ga0070694_100256217 | Ga0070694_1002562171 | 297 |
| 662 | 3300005456 | Ga0070678_100074709 | Ga0070678_1000747091 | 297 |
| 663 | 3300005457 | Ga0070662_100188999 | Ga0070662_1001889992 | 297 |
| 664 | 3300005459 | Ga0068867_100070938 | Ga0068867_1000709382 | 297 |
| 665 | 3300005466 | Ga0070685_10178881 | Ga0070685_101788812 | 297 |
| 666 | 3300005539 | Ga0068853_100098184 | Ga0068853_1000981842 | 297 |
| 667 | 3300005543 | Ga0070672_100207881 | Ga0070672_1002078812 | 297 |
| 668 | 3300005546 | Ga0070696_100047606 | Ga0070696_1000476062 | 297 |
| 669 | 3300005547 | Ga0070693_100027531 | Ga0070693_1000275313 | 297 |
| 670 | 3300005548 | Ga0070665_100045725 | Ga0070665_1000457252 | 297 |
| 671 | 3300005578 | Ga0068854_100311600 | Ga0068854_1003116001 | 297 |
| 672 | 3300005615 | Ga0070702_100057182 | Ga0070702_1000571821 | 297 |
| 673 | 3300005616 | Ga0068852_100276451 | Ga0068852_1002764512 | 297 |
| 674 | 3300005617 | Ga0068859_100150089 | Ga0068859_1001500892 | 297 |
| 675 | 3300005718 | Ga0068866_10020001 | Ga0068866_100200012 | 297 |
| 676 | 3300005719 | Ga0068861_100048334 | Ga0068861_1000483343 | 297 |
| 677 | 3300005842 | Ga0068858_100311764 | Ga0068858_1003117642 | 297 |
| 678 | 3300005843 | Ga0068860_100307401 | Ga0068860_1003074012 | 297 |
| 679 | 3300005844 | Ga0068862_100291228 | Ga0068862_1002912282 | 297 |
| 680 | 3300006163 | Ga0070715_10008358 | Ga0070715_100083582 | 297 |
| 681 | 3300006173 | Ga0070716_100015247 | Ga0070716_1000152472 | 297 |
| 682 | 3300006175 | Ga0070712_100017689 | Ga0070712_1000176895 | 297 |
| 683 | 3300006358 | Ga0068871_100259103 | Ga0068871_1002591032 | 297 |
| 684 | 3300006881 | Ga0068865_100053468 | Ga0068865_1000534682 | 297 |
| 685 | 3300006931 | Ga0097620_100150072 | Ga0097620_1001500722 | 297 |
| 686 | 3300009176 | Ga0105242_10232610 | Ga0105242_102326102 | 297 |
| 687 | 3300009545 | Ga0105237_10666168 | Ga0105237_106661681 | 297 |
| 688 | 3300009553 | Ga0105249_10413630 | Ga0105249_104136302 | 297 |
| 689 | 3300011119 | Ga0105246_10049630 | Ga0105246_100496301 | 297 |
| 690 | 3300013105 | Ga0157369_10466858 | Ga0157369_104668582 | 297 |
| 691 | 3300013296 | Ga0157374_10041784 | Ga0157374_100417843 | 297 |
| 692 | 3300013307 | Ga0157372_10071040 | Ga0157372_100710403 | 297 |
| 693 | 3300013308 | Ga0157375_10320237 | Ga0157375_103202372 | 297 |
| 694 | 3300014326 | Ga0157380_10155253 | Ga0157380_101552532 | 297 |
| 695 | 3300014745 | Ga0157377_10007912 | Ga0157377_100079124 | 297 |
| 696 | 3300014968 | Ga0157379_10133436 | Ga0157379_101334361 | 297 |
| 697 | 3300025901 | Ga0207688_10014587 | Ga0207688_100145874 | 297 |
| 698 | 3300025905 | Ga0207685_10024446 | Ga0207685_100244462 | 297 |
| 699 | 3300025915 | Ga0207693_10001690 | Ga0207693_100016904 | 297 |
| 700 | 3300025916 | Ga0207663_10017122 | Ga0207663_100171222 | 297 |
| 701 | 3300025918 | Ga0207662_10050271 | Ga0207662_100502712 | 297 |
| 702 | 3300025927 | Ga0207687_10416720 | Ga0207687_104167201 | 297 |
| 703 | 3300025933 | Ga0207706_10019781 | Ga0207706_100197812 | 297 |
| 704 | 3300025939 | Ga0207665_10020830 | Ga0207665_100208302 | 297 |
| 705 | 3300025940 | Ga0207691_10040532 | Ga0207691_100405324 | 297 |
| 706 | 3300025942 | Ga0207689_10009916 | Ga0207689_100099166 | 297 |
| 707 | 3300025961 | Ga0207712_10062243 | Ga0207712_100622433 | 297 |
| 708 | 3300026023 | Ga0207677_10038154 | Ga0207677_100381543 | 297 |
| 709 | 3300026067 | Ga0207678_10016407 | Ga0207678_100164076 | 297 |
| 710 | 3300026075 | Ga0207708_10005234 | Ga0207708_100052346 | 297 |
| 711 | 3300026078 | Ga0207702_10338627 | Ga0207702_103386272 | 297 |
| 712 | 3300026089 | Ga0207648_10026700 | Ga0207648_100267004 | 297 |
| 713 | 3300026118 | Ga0207675_100015022 | Ga0207675_1000150224 | 297 |
| 714 | 3300026121 | Ga0207683_10027425 | Ga0207683_100274254 | 297 |
| 715 | 3300028379 | Ga0268266_10045864 | Ga0268266_100458643 | 297 |
| 716 | 3300048906 | Ga0496103_0266308 | Ga0496103_0266308_81_1010 | 297 |
| 717 | 3300048907 | Ga0496104_0134453 | Ga0496104_0134453_1190_2119 | 297 |
| 718 | 3300048911 | Ga0496108_0000645 | Ga0496108_0000645_20512_21441 | 297 |
| 719 | 3300048912 | Ga0496109_0016603 | Ga0496109_0016603_2303_3232 | 297 |
| 720 | 3300048914 | Ga0496111_0083805 | Ga0496111_0083805_354_1283 | 297 |
| 721 | 3300048917 | Ga0496114_0097635 | Ga0496114_0097635_1315_2244 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
119
307
0.91
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3fh6-assembly2.cif.gz_I | crystal structure of the resting state maltose transporter from e. coli | 0.8958 | 84 | 287 |
| 4jbw-assembly2.cif.gz_I | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.8468 | 40 | 287 |
| 2r6g-assembly1.cif.gz_G | the crystal structure of the e. coli maltose transporter | 0.8449 | 40 | 285 |
| 3rlf-assembly1.cif.gz_G | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.8437 | 40 | 285 |
| 4tqu-assembly1.cif.gz_N | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.8408 | 41 | 287 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L7N652_1_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9386 | 40 | 287 | 1.10.3720.10 |
| af_O53483_6_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9156 | 39 | 287 | 1.10.3720.10 |
| af_P77716_1_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.899 | 40 | 283 | 1.10.3720.10 |
| af_P10906_2_274_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.896 | 39 | 287 | 1.10.3720.10 |
| af_I6Y1U3_2_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.883 | 41 | 287 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0C7P2A3-F1-model_v4 | ABC-type maltose transport systems, permease component | 0.97 | 65 | 297 |
GO:0005886
GO:0055085 |
| AF-A0A7C4PI02-F1-model_v4 | Carbohydrate ABC transporter permease | 0.9699 | 81 | 294 |
GO:0005886
GO:0055085 |
| AF-A0A1V5IV80-F1-model_v4 | L-arabinose transport system permease protein AraQ | 0.9665 | 86 | 297 |
GO:0005886
GO:0055085 |
| AF-A0A2S8PH27-F1-model_v4 | ABC transporter permease | 0.9657 | 89 | 295 |
GO:0005886
GO:0055085 |
| AF-A0A661TPQ6-F1-model_v4 | Carbohydrate ABC transporter permease | 0.965 | 81 | 297 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar