F477376

General Info

Members Datasets Scaffolds Average Seq Length
721 486 1440 200

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0171773|Ga0373935_0171773_521_1129
Length 202
Sequence MSDSASPHTGRRVTFVRFLPLIILLLLLGGFGLALQQQYSGKDTSVLPSALIGKNAPDLALQPLNGAVAGGKQVPALTTAAIKGKLTLVNVFASWCIPCRQEHPVIMGLSQDDRLTVVGINYKDKTDAALAFLGELGNPFKAIGVDPAGAFAIDWGVYGIPETFLVSPDGVIVYKHVGPFDDNAVKNELYPAIEKALVGAKG

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
12 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
17 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
20 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
29 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
30 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
33 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
34 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
35 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
38 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
41 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
46 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
53 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
55 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
56 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
58 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
71 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
73 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
77 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
78 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
79 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
80 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
81 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
87 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
88 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
89 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
90 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
91 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
92 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
93 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
94 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
95 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
96 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
97 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
98 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
99 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
102 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
107 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
108 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
109 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
110 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
111 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
112 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
113 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
116 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
117 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
123 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
124 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
127 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
128 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
139 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
140 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
143 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
148 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
151 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
155 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
156 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
162 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
163 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
164 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
171 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
172 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
173 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
179 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
180 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
181 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
182 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
183 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
184 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
185 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
186 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
187 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
188 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
189 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
190 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
191 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
192 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
193 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
194 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
195 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
196 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
197 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
198 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
201 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
202 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
203 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
204 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
205 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
206 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
207 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
208 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
209 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
210 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
211 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
212 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
213 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
214 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
215 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
216 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
217 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
218 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
219 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
220 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
221 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
222 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
223 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
224 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
225 2519899620 Rhizobium sp. Pop5 Isolate Nodule
226 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
227 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
228 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
229 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
230 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
231 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
232 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
233 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
234 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
235 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
236 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
237 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
238 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
239 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
240 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
241 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
242 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
243 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
244 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
245 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
246 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
247 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
248 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
249 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
250 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
251 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
252 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
253 2643221557 Ensifer sp. Root558 Isolate Unclassified
254 2643221558 Rhizobium sp. Root149 Isolate Unclassified
255 2643221582 Rhizobium sp. Root651 Isolate Unclassified
256 2643221599 Rhizobium sp. Root708 Isolate Unclassified
257 2643221618 Ensifer sp. Root231 Isolate Unclassified
258 2643221626 Ensifer sp. Root31 Isolate Unclassified
259 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
260 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
261 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
262 2643221655 Ensifer sp. Root1252 Isolate Unclassified
263 2643221659 Ensifer sp. Root127 Isolate Unclassified
264 2643221668 Ensifer sp. Root423 Isolate Unclassified
265 2643221693 Rhizobium sp. Root491 Isolate Unclassified
266 2643221698 Ensifer sp. Root142 Isolate Unclassified
267 2643221712 Ensifer sp. Root258 Isolate Unclassified
268 2643221719 Rhizobium sp. Root274 Isolate Unclassified
269 2643221723 Ensifer sp. Root278 Isolate Unclassified
270 2718217882 Rhizobium sp. N741 Isolate Nodule
271 2718217927 Rhizobium sp. N324 Isolate Nodule
272 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
273 2718218009 Rhizobium sp. N561 Isolate Nodule
274 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
275 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
276 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
277 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
278 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
279 2718218363 Rhizobium sp. N113 Isolate Nodule
280 2718218365 Rhizobium sp. N731 Isolate Nodule
281 2718218366 Rhizobium sp. N621 Isolate Nodule
282 2718218423 Rhizobium sp. N941 Isolate Nodule
283 2721755514 Rhizobium sp. N6212 Isolate Nodule
284 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
285 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
286 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
287 2721755809 Rhizobium sp. N541 Isolate Nodule
288 2721755810 Rhizobium sp. N871 Isolate Nodule
289 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
290 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
291 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
292 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
293 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
294 2728369365 Rhizobium sp. N1341 Isolate Nodule
295 2728369397 Rhizobium sp. N1314 Isolate Nodule
296 2738541293 Rhizobium sp. GV031 Isolate Unclassified
297 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
298 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
299 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
300 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
301 2791355256 Rhizobium sp. M10 Isolate Nodule
302 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
303 2791355260 Rhizobium sp. L9 Isolate Nodule
304 2791355261 Rhizobium sp. J15 Isolate Nodule
305 2791355262 Rhizobium sp. M1 Isolate Nodule
306 2791355263 Rhizobium chutanense C5 Isolate Nodule
307 2791355264 Rhizobium sp. S9 Isolate Nodule
308 2791355265 Rhizobium sp. H4 Isolate Nodule
309 2791355266 Rhizobium sp. L43 Isolate Nodule
310 2791355267 Rhizobium sp. L18 Isolate Nodule
311 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
312 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
313 2802429633 Rhizobium anhuiense J3 Isolate Nodule
314 2802429634 Rhizobium anhuiense S10 Isolate Nodule
315 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
316 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
317 2802429637 Rhizobium anhuiense C15 Isolate Nodule
318 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
319 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
320 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
321 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
322 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
323 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
324 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
325 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
326 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
327 2838048938 Rhizobium pisi 27/80 Isolate Nodule
328 2838061910 Rhizobium phaseoli L15 Isolate Nodule
329 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
330 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
331 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
332 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
333 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
334 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
335 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
336 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
337 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
338 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
339 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
340 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
341 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
342 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
343 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
344 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
345 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
346 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
347 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
348 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
349 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
350 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
351 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
352 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
353 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
354 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
355 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
356 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
357 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
358 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
359 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
360 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
361 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
362 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
363 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
364 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
365 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
366 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
367 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
368 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
369 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
370 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
371 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
372 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
373 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
374 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
375 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
376 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
377 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
378 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
379 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
380 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
381 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
382 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
383 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
384 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
385 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
386 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
387 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
388 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
389 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
390 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
391 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
392 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
393 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
394 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
395 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
396 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
397 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
398 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
399 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
400 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
401 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
402 2844163670 Ensifer sp. 1H6 Isolate Unclassified
403 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
404 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
405 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
406 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
407 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
408 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
409 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
410 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
411 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
412 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
413 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
414 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
415 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
416 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
417 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
418 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
419 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
420 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
421 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
422 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
423 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
424 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
425 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
426 2933599457 Rhizobium phaseoli M3 Isolate Nodule
427 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
428 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
429 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
430 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
431 2936381700 Rhizobium chutanense C16 Isolate Unclassified
432 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
433 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
434 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
435 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
436 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
437 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
438 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
439 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
440 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
441 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
442 2996887358 Rhizobium sp. R711 Isolate Nodule
443 2996893221 Rhizobium sp. R635 Isolate Nodule
444 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
445 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
446 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
447 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
448 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
449 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
450 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
451 8005258706 Rhizobium sp. R693 Isolate Nodule
452 8005275841 Rhizobium sp. N4311 Isolate Nodule
453 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
454 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
455 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
456 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
457 8005321885 Rhizobium sp. R72 Isolate Nodule
458 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
459 8005382845 Rhizobium sp. R634 Isolate Nodule
460 8005395548 Rhizobium sp. R339 Isolate Nodule
461 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
462 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
463 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
464 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
465 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
466 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
467 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
468 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
469 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
470 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
471 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
472 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
473 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
474 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
475 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
476 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
477 8018176218 Rhizobium sp. N122 Isolate Nodule
478 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
479 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
480 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
481 8024501048 Rhizobium sp. H4 Isolate Nodule
482 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
483 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
484 8056382006 Rhizobium croatiense 13T Isolate Nodule
485 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
486 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.5
Metatranscriptomes 0.69
Isolates 39.81

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 27.18
Nodule 27.32
Rhizoplane 1.66
Rhizosphere 24.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0171773 3300035692 Bacteria 1483
2 RicEn_C10344 2010549000 Bacteria 2414
3 JGI25158J39367_1000116 3300002739 Bacteria 18332
4 JGI25152J39213_1002679 3300002773 Bacteria 6558
5 JGI25152J39213_1007127 3300002773 Bacteria 2934
6 JGI25152J39213_1008840 3300002773 Bacteria 2457
7 JGI25152J39213_1012669 3300002773 Bacteria 1794
8 JGI25152J39213_1029515 3300002773 Bacteria 862
9 JGI25150J39212_1000037 3300002774 Bacteria 88885
10 JGI25150J39212_1002674 3300002774 Bacteria 4348
11 JGI25159J45721_1000017 3300002987 Bacteria 136127
12 JGI25159J45721_1002450 3300002987 Bacteria 7046
13 JGI25151J46595_10000220 3300003187 Bacteria 67327
14 JGI25151J46595_10002753 3300003187 Bacteria 10214
15 JGI25151J46595_10013759 3300003187 Bacteria 3630
16 JGI25151J46595_10055471 3300003187 Bacteria 1306
17 JGI25153J46596_10007468 3300003215 Bacteria 5371
18 JGI25153J46596_10008966 3300003215 Bacteria 4713
19 JGI25153J46596_10020908 3300003215 Bacteria 2457
20 JGI25153J46596_10029782 3300003215 Bacteria 1868
21 JGI25153J46596_10031300 3300003215 Bacteria 1794
22 JGI25153J46596_10071411 3300003215 Bacteria 897
23 rootH2_10072600 3300003320 Bacteria 1488
24 rootH1_10245785 3300003323 Bacteria 1197
25 JGI25160J50197_1000027 3300003354 Bacteria 182809
26 JGI25160J50197_1004236 3300003354 Bacteria 6235
27 JGI25160J50197_1021914 3300003354 Bacteria 1885
28 JGI25161J50226_1000327 3300003374 Bacteria 25949
29 JGI25161J50226_1000501 3300003374 Bacteria 17353
30 Ga0055526_1001473 3300003771 Bacteria 16693
31 Ga0055526_1004020 3300003771 Bacteria 9039
32 Ga0055526_1007862 3300003771 Bacteria 5447
33 Ga0055526_1008010 3300003771 Bacteria 5352
34 Ga0055526_1010107 3300003771 Bacteria 4430
35 Ga0055524_1002650 3300003775 Bacteria 9086
36 Ga0055524_1003843 3300003775 Bacteria 7130
37 Ga0055524_1004200 3300003775 Bacteria 6711
38 Ga0055524_1004836 3300003775 Bacteria 6135
39 Ga0055524_1026436 3300003775 Bacteria 1793
40 Ga0055524_1042784 3300003775 Bacteria 1122
41 Ga0055536_1001323 3300003781 Bacteria 15170
42 Ga0055528_1000099 3300003790 Bacteria 68463
43 Ga0055528_1002777 3300003790 Bacteria 9169
44 Ga0055528_1002884 3300003790 Bacteria 8946
45 Ga0055528_1003479 3300003790 Bacteria 7866
46 Ga0055528_1003641 3300003790 Bacteria 7651
47 Ga0055528_1015747 3300003790 Bacteria 2713
48 Ga0055528_1018827 3300003790 Bacteria 2321
49 Ga0055540_1004301 3300003792 Bacteria 6497
50 Ga0055540_1007209 3300003792 Bacteria 4249
51 Ga0055540_1009091 3300003792 Bacteria 3483
52 Ga0055540_1011960 3300003792 Bacteria 2756
53 Ga0055531_10004054 3300003794 Bacteria 9079
54 Ga0055531_10021365 3300003794 Bacteria 2513
55 Ga0058692_1004143 3300003856 Bacteria 4342
56 Ga0058692_1006819 3300003856 Bacteria 3085
57 Ga0055543_1000030 3300004625 Bacteria 130849
58 Ga0055543_1000062 3300004625 Bacteria 98034
59 Ga0055543_1004762 3300004625 Bacteria 3614
60 Ga0065165_1000122 3300005262 Bacteria 132524
61 Ga0065165_1009930 3300005262 Bacteria 4192
62 Ga0070670_100000116 3300005331 Bacteria 74586
63 Ga0070670_100627456 3300005331 Bacteria 963
64 Ga0070668_100163932 3300005347 Bacteria 1805
65 Ga0070671_100057902 3300005355 Bacteria 3225
66 Ga0070663_100835594 3300005455 Bacteria 792
67 Ga0070665_100004011 3300005548 Bacteria 15524
68 Ga0070665_100064560 3300005548 Bacteria 3672
69 Ga0070665_100214209 3300005548 Bacteria 1927
70 Ga0070665_100220976 3300005548 Bacteria 1895
71 Ga0070665_100843237 3300005548 Bacteria 929
72 Ga0068861_100961186 3300005719 Bacteria 813
73 Ga0075365_10000498 3300006038 Bacteria 14945
74 Ga0075365_10034493 3300006038 Bacteria 3268
75 Ga0075365_10054293 3300006038 Bacteria 2656
76 Ga0075365_10132303 3300006038 Bacteria 1727
77 Ga0075368_10003863 3300006042 Bacteria 5041
78 Ga0075368_10027222 3300006042 Bacteria 2204
79 Ga0075368_10044952 3300006042 Bacteria 1744
80 Ga0075363_100116730 3300006048 Bacteria 1487
81 Ga0075364_10000026 3300006051 Bacteria 51217
82 Ga0075364_10121436 3300006051 Bacteria 1749
83 Ga0075362_10002019 3300006177 Bacteria 6686
84 Ga0075362_10012138 3300006177 Bacteria 3414
85 Ga0075367_10004009 3300006178 Bacteria 7117
86 Ga0075367_10004494 3300006178 Bacteria 6818
87 Ga0075369_10002071 3300006186 Bacteria 7079
88 Ga0075369_10007620 3300006186 Bacteria 4136
89 Ga0075369_10036124 3300006186 Bacteria 2102
90 Ga0075369_10158987 3300006186 Bacteria 1035
91 Ga0075366_10081626 3300006195 Bacteria 1931
92 Ga0075366_10194627 3300006195 Bacteria 1232
93 Ga0075370_10169851 3300006353 Bacteria 1282
94 Ga0075370_10202411 3300006353 Bacteria 1171
95 Ga0079104_1000195 3300006946 Bacteria 85244
96 Ga0099826_10000958 3300006948 Bacteria 16050
97 Ga0099826_10019601 3300006948 Bacteria 5082
98 Ga0105251_10017043 3300009011 Bacteria 3903
99 Ga0105244_10088997 3300009036 Bacteria 1520
100 Ga0105250_10029222 3300009092 Bacteria 2218
101 Ga0105250_10250695 3300009092 Bacteria 756
102 Ga0105243_10005164 3300009148 Bacteria 10226
103 Ga0105248_10119214 3300009177 Bacteria 2976
104 Ga0105249_10600761 3300009553 Bacteria 1155
105 Ga0123341_1000009 3300009765 Bacteria 122597
106 Ga0123342_1009724 3300009766 Bacteria 11342
107 Ga0105246_10046692 3300011119 Bacteria 2955
108 Ga0105246_10729693 3300011119 Bacteria 871
109 Ga0157322_1003437 3300012490 Bacteria 970
110 Ga0157373_10135423 3300013100 Bacteria 1732
111 Ga0157373_10505532 3300013100 Bacteria 873
112 Ga0157371_10000108 3300013102 Bacteria 126288
113 Ga0157370_10004961 3300013104 Bacteria 15062
114 Ga0157370_10555371 3300013104 Bacteria 1052
115 Ga0157370_10830905 3300013104 Bacteria 840
116 Ga0163161_10076548 3300017792 Bacteria 2456
117 Ga0209436_100018 3300025208 Bacteria 113499
118 Ga0209436_100664 3300025208 Bacteria 14651
119 Ga0207425_1000034 3300025245 Bacteria 227886
120 Ga0207425_1002143 3300025245 Bacteria 7234
121 Ga0207425_1009172 3300025245 Bacteria 2477
122 Ga0207425_1020102 3300025245 Bacteria 1431
123 Ga0209129_1000118 3300025258 Bacteria 139972
124 Ga0209129_1000253 3300025258 Bacteria 55709
125 Ga0209129_1000971 3300025258 Bacteria 17232
126 Ga0209129_1003196 3300025258 Bacteria 7326
127 Ga0209129_1003252 3300025258 Bacteria 7210
128 Ga0209129_1004160 3300025258 Bacteria 5843
129 Ga0209129_1004572 3300025258 Bacteria 5327
130 Ga0209673_1000033 3300025273 Bacteria 335369
131 Ga0209673_1000050 3300025273 Bacteria 285287
132 Ga0209673_1000052 3300025273 Bacteria 279795
133 Ga0209673_1004625 3300025273 Bacteria 7285
134 Ga0209673_1005860 3300025273 Bacteria 6081
135 Ga0209673_1010491 3300025273 Bacteria 3902
136 Ga0209673_1011538 3300025273 Bacteria 3636
137 Ga0209130_1000009 3300025284 Bacteria 498952
138 Ga0209130_1000027 3300025284 Bacteria 327700
139 Ga0209676_1000406 3300025292 Bacteria 77603
140 Ga0209676_1014960 3300025292 Bacteria 2883
141 Ga0209025_1000241 3300025294 Bacteria 128329
142 Ga0209025_1000335 3300025294 Bacteria 103615
143 Ga0209025_1000487 3300025294 Bacteria 76541
144 Ga0209025_1000533 3300025294 Bacteria 72404
145 Ga0209025_1002217 3300025294 Bacteria 21448
146 Ga0209025_1005633 3300025294 Bacteria 10106
147 Ga0209025_1013935 3300025294 Bacteria 5003
148 Ga0209025_1015409 3300025294 Bacteria 4609
149 Ga0209025_1027717 3300025294 Bacteria 2800
150 Ga0209025_1064942 3300025294 Bacteria 1336
151 Ga0209564_1000111 3300025295 Bacteria 212210
152 Ga0209564_1000782 3300025295 Bacteria 44138
153 Ga0209564_1003320 3300025295 Bacteria 11178
154 Ga0209564_1003367 3300025295 Bacteria 11059
155 Ga0209564_1016817 3300025295 Bacteria 2888
156 Ga0209564_1024253 3300025295 Bacteria 2077
157 Ga0209758_1000415 3300025297 Bacteria 72404
158 Ga0209758_1000570 3300025297 Bacteria 57866
159 Ga0209758_1001085 3300025297 Bacteria 35309
160 Ga0209758_1001086 3300025297 Bacteria 35300
161 Ga0209758_1002520 3300025297 Bacteria 18534
162 Ga0209758_1002827 3300025297 Bacteria 16891
163 Ga0209758_1004611 3300025297 Bacteria 11315
164 Ga0209758_1015745 3300025297 Bacteria 3893
165 Ga0209758_1040429 3300025297 Bacteria 1758
166 Ga0209050_1000572 3300025298 Bacteria 59716
167 Ga0209050_1004422 3300025298 Bacteria 9506
168 Ga0209050_1004558 3300025298 Bacteria 9300
169 Ga0209256_1001743 3300025299 Bacteria 20757
170 Ga0209256_1002370 3300025299 Bacteria 15544
171 Ga0209256_1003544 3300025299 Bacteria 10827
172 Ga0209256_1003766 3300025299 Bacteria 10227
173 Ga0209256_1007283 3300025299 Bacteria 5513
174 Ga0209256_1007659 3300025299 Bacteria 5251
175 Ga0209256_1012473 3300025299 Bacteria 3250
176 Ga0209256_1064228 3300025299 Bacteria 845
177 Ga0207426_1000041 3300025302 Bacteria 433536
178 Ga0207426_1000072 3300025302 Bacteria 327700
179 Ga0207426_1000348 3300025302 Bacteria 85294
180 Ga0207426_1001232 3300025302 Bacteria 22539
181 Ga0209051_1000276 3300025303 Bacteria 84192
182 Ga0209051_1001068 3300025303 Bacteria 25445
183 Ga0209051_1003342 3300025303 Bacteria 10589
184 Ga0209051_1005359 3300025303 Bacteria 7531
185 Ga0209051_1006368 3300025303 Bacteria 6674
186 Ga0209051_1009487 3300025303 Bacteria 5011
187 Ga0209051_1025776 3300025303 Bacteria 2384
188 Ga0209051_1084775 3300025303 Bacteria 901
189 Ga0209257_1002707 3300025304 Bacteria 16894
190 Ga0209257_1003532 3300025304 Bacteria 13296
191 Ga0209257_1007840 3300025304 Bacteria 6305
192 Ga0207650_10000691 3300025925 Bacteria 26420
193 Ga0207650_10456487 3300025925 Bacteria 1064
194 Ga0207668_10211867 3300025972 Bacteria 1550
195 Ga0207678_10157915 3300026067 Bacteria 1937
196 Ga0209281_1000028 3300027111 Bacteria 440027
197 Ga0209371_1000037 3300027312 Bacteria 367074
198 Ga0209282_1061069 3300027666 Bacteria 2099
199 Ga0209813_10008558 3300027866 Bacteria 2590
200 Ga0209813_10018240 3300027866 Bacteria 1936
201 Ga0268266_10006277 3300028379 Bacteria 10907
202 Ga0268266_10046940 3300028379 Bacteria 3698
203 Ga0268266_10274370 3300028379 Bacteria 1566
204 Ga0268266_10559781 3300028379 Bacteria 1096
205 Ga0307515_10091403 3300028794 Bacteria 3803
206 Ga0307515_10341559 3300028794 Bacteria 1149
207 Ga0268256_1000039 3300030500 Bacteria 354969
208 Ga0268256_1006192 3300030500 Bacteria 4501
209 Ga0316181_1219928 3300030744 Bacteria 3350
210 Ga0316182_1125124 3300030745 Bacteria 1540
211 Ga0307405_10014073 3300031731 Bacteria 4290
212 Ga0307412_10005736 3300031911 Bacteria 6978
213 Ga0307414_10092769 3300032004 Bacteria 2249
214 Ga0307414_10275341 3300032004 Bacteria 1412
215 Ga0373943_0279673 3300035170 Bacteria 943
216 Ga0373927_0000311 3300035695 Bacteria 38278
217 Ga0373925_0004023 3300037068 Bacteria 11180
218 Ga0395905_0008738 3300037471 Bacteria 9964
219 Ga0395905_0016140 3300037471 Bacteria 7099
220 Ga0395901_0737547 3300038443 Bacteria 979
221 Ga0439465_0003192 3300041413 Bacteria 5345
222 Ga0451791_1345467 3300041451 Bacteria 1290
223 Ga0451802_0488296 3300041460 Bacteria 826
224 Ga0451804_0031999 3300041463 Bacteria 1371
225 Ga0451839_1011021 3300041496 Bacteria 2984
226 Ga0451846_16282 3300041502 Bacteria 1956
227 Ga0451847_0484987 3300041503 Bacteria 2034
228 Ga0451849_1333317 3300041505 Bacteria 1233
229 Ga0451843_0168405 3300041509 Bacteria 1790
230 Ga0451854_27717 3300041510 Bacteria 1071
231 Ga0451855_0487823 3300041511 Bacteria 1485
232 Ga0451855_1356374 3300041511 Bacteria 902
233 Ga0452271_84286 3300041916 Bacteria 628
234 Ga0439432_055974 3300042006 Bacteria 1223
235 Ga0439449_0011037 3300042007 Bacteria 3407
236 Ga0439449_0054074 3300042007 Bacteria 1484
237 Ga0466965_0083615 3300044683 Bacteria 1616
238 Ga0495617_045425 3300046452 Bacteria 1464
239 Ga0495592_0027176 3300046454 Bacteria 4338
240 Ga0495590_0157878 3300046457 Bacteria 824
241 Ga0495629_0012949 3300046459 Bacteria 6032
242 Ga0495638_0003269 3300046460 Bacteria 12786
243 Ga0495650_0049192 3300046471 Bacteria 1752
244 Ga0495650_0064425 3300046471 Bacteria 1458
245 Ga0495605_0002525 3300046474 Bacteria 11283
246 Ga0495605_0055743 3300046474 Bacteria 1908
247 Ga0495639_0203543 3300046475 Bacteria 970
248 Ga0495662_0002948 3300046476 Bacteria 8590
249 Ga0495585_0075254 3300046492 Bacteria 1836
250 Ga0495607_0039229 3300046501 Bacteria 2830
251 Ga0495607_0043296 3300046501 Bacteria 2663
252 Ga0495583_0020888 3300046506 Bacteria 3378
253 Ga0495583_0030217 3300046506 Bacteria 2641
254 Ga0495583_0078164 3300046506 Bacteria 1442
255 Ga0495606_0002721 3300046507 Bacteria 19935
256 Ga0495606_0065112 3300046507 Bacteria 2317
257 Ga0495606_0069944 3300046507 Bacteria 2215
258 Ga0495606_0199747 3300046507 Bacteria 1140
259 Ga0495610_0018390 3300046512 Bacteria 3950
260 Ga0495610_0049789 3300046512 Bacteria 2049
261 Ga0495610_0099707 3300046512 Bacteria 1303
262 Ga0495616_0020903 3300046513 Bacteria 3554
263 Ga0495616_0079629 3300046513 Bacteria 1570
264 Ga0495618_0354244 3300046514 Bacteria 904
265 Ga0495620_0042756 3300046515 Bacteria 1977
266 Ga0495620_0051274 3300046515 Bacteria 1757
267 Ga0495620_0092762 3300046515 Bacteria 1210
268 Ga0495631_0002242 3300046518 Bacteria 11099
269 Ga0495631_0069816 3300046518 Bacteria 1519
270 Ga0495631_0145392 3300046518 Bacteria 1017
271 Ga0495632_0009845 3300046519 Bacteria 5718
272 Ga0495632_0018201 3300046519 Bacteria 3860
273 Ga0495632_0028409 3300046519 Bacteria 2919
274 Ga0495643_0031476 3300046522 Bacteria 2951
275 Ga0495643_0075118 3300046522 Bacteria 1769
276 Ga0495643_0082130 3300046522 Bacteria 1675
277 Ga0495644_0124905 3300046523 Bacteria 980
278 Ga0495648_0170951 3300046524 Bacteria 1114
279 Ga0495663_0032664 3300046525 Bacteria 1551
280 Ga0495652_0673457 3300046529 Bacteria 698
281 Ga0495654_0036910 3300046530 Bacteria 2454
282 Ga0495654_0203180 3300046530 Bacteria 847
283 Ga0495587_0043343 3300046536 Bacteria 2680
284 Ga0495597_0211758 3300046542 Bacteria 772
285 Ga0495622_0056449 3300046557 Bacteria 1821
286 Ga0495633_0017477 3300046558 Bacteria 3666
287 Ga0495633_0043486 3300046558 Bacteria 2131
288 Ga0495656_0017308 3300046615 Bacteria 2749
289 Ga0495656_0084332 3300046615 Bacteria 1441
290 Ga0495668_0006323 3300046616 Bacteria 7788
291 Ga0495668_0033189 3300046616 Bacteria 2901
292 Ga0495611_0010753 3300046648 Bacteria 3876
293 Ga0495611_0245018 3300046648 Bacteria 831
294 Ga0495625_0004490 3300046660 Bacteria 13166
295 Ga0495625_0234310 3300046660 Bacteria 1198
296 Ga0495635_0274900 3300046663 Bacteria 1132
297 Ga0495588_0003857 3300046674 Bacteria 6571
298 Ga0495588_0199378 3300046674 Bacteria 1057
299 Ga0495657_0040807 3300046675 Bacteria 3180
300 Ga0495658_0143846 3300046683 Bacteria 1460
301 Ga0495670_0077090 3300046691 Bacteria 1694
302 Ga0495649_0172590 3300046694 Bacteria 1131
303 Ga0495600_0205169 3300046809 Bacteria 1264
304 Ga0495604_0030094 3300047317 Bacteria 4315
305 Ga0495636_0075163 3300047318 Bacteria 1448
306 Ga0495672_0050339 3300047320 Bacteria 2460
307 Ga0495683_0189236 3300047323 Bacteria 935
308 Ga0495687_109531 3300047443 Bacteria 1018
309 Ga0495673_0159922 3300047469 Bacteria 865
310 Ga0495681_0004907 3300047470 Bacteria 9040
311 Ga0495686_0015554 3300047472 Bacteria 5189
312 Ga0495686_0022064 3300047472 Bacteria 4216
313 Ga0495686_0038018 3300047472 Bacteria 3081
314 Ga0495686_0072884 3300047472 Bacteria 2110
315 Ga0495686_0400493 3300047472 Bacteria 737
316 Ga0495615_0037031 3300048090 Bacteria 1200
317 Ga0495626_0085234 3300048091 Bacteria 1397
318 Ga0496111_0025110 3300048914 Bacteria 4202
319 Ga0496113_0322481 3300048916 Bacteria 1238
320 Ga0496116_0005573 3300048919 Bacteria 11611
321 Ga0496116_0025349 3300048919 Bacteria 4361
322 Ga0496116_0028421 3300048919 Bacteria 4052
323 Ga0496116_0065649 3300048919 Bacteria 2326
324 Ga0496117_0000031 3300048920 Bacteria 381048
325 Ga0496117_0032840 3300048920 Bacteria 3935
326 Ga0496117_0042184 3300048920 Bacteria 3332
327 Ga0496117_0074990 3300048920 Bacteria 2249
328 Ga0496118_0000899 3300048921 Bacteria 46663
329 Ga0496118_0076791 3300048921 Bacteria 2373
330 Ga0496118_0080335 3300048921 Bacteria 2295
331 Ga0496118_0097285 3300048921 Bacteria 2003
332 Ga0496118_0157308 3300048921 Bacteria 1411
333 Ga0496119_0182203 3300048922 Bacteria 1100
334 Ga0496120_0000337 3300048923 Bacteria 78140
335 Ga0496120_0105201 3300048923 Bacteria 1484
336 Ga0496120_0281825 3300048923 Bacteria 768
337 Ga0496121_0005857 3300048924 Bacteria 15571
338 Ga0496121_0017796 3300048924 Bacteria 7221
339 Ga0496121_0026755 3300048924 Bacteria 5420
340 Ga0496121_0027371 3300048924 Bacteria 5336
341 Ga0496121_0032092 3300048924 Bacteria 4781
342 Ga0496121_0038490 3300048924 Bacteria 4233
343 Ga0496121_0067368 3300048924 Bacteria 2902
344 Ga0496121_0103185 3300048924 Bacteria 2194
345 Ga0496121_0178040 3300048924 Bacteria 1538
346 Ga0496121_0250461 3300048924 Bacteria 1228
347 Ga0496121_0263865 3300048924 Bacteria 1187
348 Ga0496121_0524669 3300048924 Bacteria 746
349 Ga0496122_0000023 3300048925 Bacteria 381035
350 Ga0496122_0000074 3300048925 Bacteria 219900
351 Ga0496122_0000286 3300048925 Bacteria 112940
352 Ga0496122_0017308 3300048925 Bacteria 6750
353 Ga0496122_0021693 3300048925 Bacteria 5738
354 Ga0496122_0025165 3300048925 Bacteria 5180
355 Ga0496122_0150487 3300048925 Bacteria 1437
356 Ga0496123_0000027 3300048926 Bacteria 306773
357 Ga0496123_0000062 3300048926 Bacteria 219882
358 Ga0496123_0006549 3300048926 Bacteria 11249
359 Ga0496123_0007630 3300048926 Bacteria 10125
360 Ga0496123_0017095 3300048926 Bacteria 5854
361 Ga0496123_0036008 3300048926 Bacteria 3517
362 Ga0496123_0038065 3300048926 Bacteria 3386
363 Ga0496123_0068460 3300048926 Bacteria 2235
364 Ga0496123_0164731 3300048926 Bacteria 1177
365 Ga0496124_0002248 3300048927 Bacteria 25664
366 Ga0496124_0021541 3300048927 Bacteria 5937
367 Ga0496124_0024118 3300048927 Bacteria 5537
368 Ga0496124_0027332 3300048927 Bacteria 5123
369 Ga0496124_0037520 3300048927 Bacteria 4214
370 Ga0496124_0103547 3300048927 Bacteria 2302
371 Ga0496124_0154210 3300048927 Bacteria 1798
372 Ga0496124_0282908 3300048927 Bacteria 1208
373 Ga0496124_0284143 3300048927 Bacteria 1204
374 Ga0496124_0764549 3300048927 Bacteria 603
375 Ga0496125_0008659 3300048928 Bacteria 10606
376 Ga0496125_0027541 3300048928 Bacteria 5150
377 Ga0496125_0042092 3300048928 Bacteria 3896
378 Ga0496125_0223410 3300048928 Bacteria 1211
379 Ga0496126_0000892 3300048929 Bacteria 52105
380 Ga0496126_0165125 3300048929 Bacteria 1890
381 Ga0496126_0322983 3300048929 Bacteria 1268
382 Ga0495678_006181 3300049459 Bacteria 6412
383 Ga0501032_0215700 3300049569 Bacteria 1250
384 Ga0501038_0238399 3300049574 Bacteria 1445
385 Ga0501043_0025472 3300049579 Bacteria 4641
386 Ga0501080_0520876 3300049742 Bacteria 1061
387 Ga0501280_002832 3300049776 Bacteria 2792
388 Ga0501282_002248 3300049778 Bacteria 2120
389 Ga0501044_0179878 3300049823 Bacteria 2082
390 nmdc:mga03683_23864_c1 3300050489 Bacteria 2387
391 nmdc:mga03683_40021_c1 3300050489 Bacteria 1921
392 nmdc:mga00v17_1285_c1 3300050491 Bacteria 13183
393 nmdc:mga00v17_151_c1 3300050491 Bacteria 40348
394 nmdc:mga00v17_41963_c1 3300050491 Bacteria 2749
395 nmdc:mga0yw44_137544_c1 3300050492 Bacteria 1586
396 nmdc:mga0yw44_29465_c1 3300050492 Bacteria 3169
397 nmdc:mga0k408_155997_c1 3300050493 Bacteria 1360
398 nmdc:mga0k408_55701_c1 3300050493 Bacteria 2293
399 nmdc:mga06z11_6588_c1 3300050494 Bacteria 4741
400 nmdc:mga04h51_7309_c1 3300050495 Bacteria 2909
401 nmdc:mga04h51_9426_c1 3300050495 Bacteria 2647
402 nmdc:mga07m45_115924_c1 3300050496 Bacteria 1545
403 nmdc:mga0sz30_107_c1 3300050516 Bacteria 31264
404 nmdc:mga0sz30_1545_c1 3300050516 Bacteria 8206
405 nmdc:mga0sz30_32333_c1 3300050516 Bacteria 2170
406 nmdc:mga0sz30_98810_c1 3300050516 Bacteria 1274
407 Ga0500610_0012502 3300053079 Bacteria 3914
408 Ga0495619_0085068 3300053085 Bacteria 2135
409 Ga0500578_0067685 3300053086 Bacteria 2277
410 Ga0500560_002140 3300053107 Bacteria 3691
411 Ga0500569_144190 3300053109 Bacteria 801
412 Ga0500594_0007425 3300053118 Bacteria 2479
413 Ga0500614_076585 3300053123 Bacteria 928
414 Ga0500618_001412 3300053125 Bacteria 10762
415 Ga0500618_002740 3300053125 Bacteria 6410
416 Ga0500618_011654 3300053125 Bacteria 2325
417 Ga0500618_018603 3300053125 Bacteria 1717
418 Ga0500618_023849 3300053125 Bacteria 1478
419 Ga0500658_0000309 3300053134 Bacteria 21891
420 Ga0500658_0018303 3300053134 Bacteria 2625
421 Ga0500559_0003675 3300053136 Bacteria 7485
422 Ga0500568_0008863 3300053139 Bacteria 4817
423 Ga0500568_0018858 3300053139 Bacteria 3009
424 Ga0500604_0009869 3300053151 Bacteria 2546
425 Ga0500616_0005597 3300053153 Bacteria 8483
426 Ga0500616_0007819 3300053153 Bacteria 6733
427 Ga0500616_0020147 3300053153 Bacteria 3750
428 Ga0500622_0118528 3300053156 Bacteria 1286
429 Ga0500627_0156409 3300053158 Bacteria 1029
430 Ga0500633_0012605 3300053160 Bacteria 2341
431 Ga0500645_037445 3300053730 Bacteria 1441
432 Ga0587077_047895 3300059493 Bacteria 884
433 Ga0587072_049824 3300059643 Bacteria 836
434 2509389424 2509276021 Bacteria 7634384
435 2509446179 2509276033 Bacteria 7180565
436 2510135233 2510065019 Bacteria 6903379
437 2510896688 2510461076 Bacteria 8618824
438 2511169790 2510917026 Bacteria 7046020
439 2511183985 2510917028 Bacteria 6185411
440 2511194589 2510917030 Bacteria 7460662
441 2513571617 2513237084 Bacteria 7231967
442 2513578651 2513237085 Bacteria 7695351
443 2513596816 2513237088 Bacteria 6927906
444 2513630164 2513237093 Bacteria 7545552
445 2513711337 2513237103 Bacteria 7647401
446 2513867467 2513237138 Bacteria 7368160
447 2513912366 2513237144 Bacteria 7530820
448 2513928449 2513237146 Bacteria 7166346
449 2514019388 2513237162 Bacteria 7468464
450 2515114391 2515075009 Bacteria 7288508
451 2515635394 2515154113 Bacteria 7807172
452 2515643198 2515154114 Bacteria 7848616
453 2515657662 2515154116 Bacteria 7552979
454 2515741575 2515154134 Bacteria 7220242
455 2517038041 2516653077 Bacteria 7555578
456 2517078305 2516653085 Bacteria 7346596
457 2517097064 2517093000 Bacteria 7412387
458 2517408552 2517287029 Bacteria 6905599
459 2520377452 2519899620 Bacteria 6499161
460 2530647364 2529292951 Bacteria 6916614
461 2535519008 2534681796 Bacteria 7146037
462 2537873832 2537561587 Bacteria 5425293
463 2554248854 2554235003 Bacteria 5877155
464 2559295942 2558860242 Bacteria 5568029
465 2561467104 2558860983 Bacteria 4133860
466 2585201751 2582581294 Bacteria 6626667
467 2585223910 2582581298 Bacteria 7315509
468 2585228754 2582581299 Bacteria 6518058
469 2585257361 2582581304 Bacteria 5831370
470 2585399735 2582581867 Bacteria 7184437
471 2585526058 2585427526 Bacteria 7258840
472 2585540765 2585427528 Bacteria 6842387
473 2585549133 2585427529 Bacteria 7395659
474 2585820822 2585427590 Bacteria 6824633
475 2585839035 2585427593 Bacteria 7141551
476 2585844878 2585427594 Bacteria 6180594
477 2585997766 2585427633 Bacteria 6413184
478 2586002351 2585427634 Bacteria 6455027
479 2599420161 2599185170 Bacteria 7295545
480 2599603267 2599185210 Bacteria 5624189
481 2599720321 2599185236 Bacteria 6875203
482 2600193360 2599185352 Bacteria 7228948
483 2600373249 2600254933 Bacteria 4750527
484 2601610829 2600255279 Bacteria 5605316
485 2601747603 2600255308 Bacteria 5611129
486 2616296328 2615840624 Bacteria 6557588
487 2643808058 2643221557 Bacteria 7184309
488 2643813750 2643221558 Bacteria 5460675
489 2643921467 2643221582 Bacteria 5804683
490 2644002457 2643221599 Bacteria 6292121
491 2644110159 2643221618 Bacteria 7717186
492 2644150435 2643221626 Bacteria 8069654
493 2644194837 2643221634 Bacteria 6705461
494 2644240517 2643221643 Bacteria 5749658
495 2644299817 2643221653 Bacteria 4569637
496 2644313039 2643221655 Bacteria 7722067
497 2644336587 2643221659 Bacteria 7890716
498 2644379492 2643221668 Bacteria 7306521
499 2644521520 2643221693 Bacteria 5513853
500 2644546234 2643221698 Bacteria 7756764
501 2644618769 2643221712 Bacteria 7729434
502 2644658044 2643221719 Bacteria 4568197
503 2644677086 2643221723 Bacteria 7095460
504 2719182950 2718217882 Bacteria 6556348
505 2719387663 2718217927 Bacteria 6972593
506 2719667295 2718217997 Bacteria 6740740
507 2719733667 2718218009 Bacteria 6478651
508 2720493715 2718218199 Bacteria 6740745
509 2720615168 2718218232 Bacteria 6720332
510 2720621963 2718218233 Bacteria 6662049
511 2720633313 2718218235 Bacteria 6630699
512 2720777011 2718218269 Bacteria 6906114
513 2721149062 2718218363 Bacteria 6524337
514 2721160460 2718218365 Bacteria 6274507
515 2721165875 2718218366 Bacteria 6425255
516 2721401297 2718218423 Bacteria 6438183
517 2722842045 2721755514 Bacteria 6424414
518 2723028609 2721755556 Bacteria 6745503
519 2723562213 2721755684 Bacteria 6859907
520 2723568916 2721755685 Bacteria 6704835
521 2724040111 2721755809 Bacteria 6438790
522 2724046423 2721755810 Bacteria 6479005
523 2724091618 2721755819 Bacteria 6906405
524 2724106181 2721755822 Bacteria 6726041
525 2724111987 2721755823 Bacteria 6752556
526 2725947524 2724679232 Bacteria 7646494
527 2730109545 2728369352 Bacteria 6745171
528 2730166185 2728369365 Bacteria 6555560
529 2730300092 2728369397 Bacteria 6274511
530 2738805586 2738541293 Bacteria 7065685
531 2738947069 2738541317 Bacteria 5340176
532 2739037262 2738541333 Bacteria 7106503
533 2766064281 2765235942 Bacteria 7445910
534 2776915610 2775507049 Bacteria 6284736
535 2793295641 2791355256 Bacteria 6798008
536 2793313392 2791355259 Bacteria 7254731
537 2793320698 2791355260 Bacteria 6598818
538 2793327270 2791355261 Bacteria 6661293
539 2793332224 2791355262 Bacteria 6774204
540 2793338799 2791355263 Bacteria 6872478
541 2793346587 2791355264 Bacteria 6429314
542 2793353874 2791355265 Bacteria 6539969
543 2793359409 2791355266 Bacteria 7116587
544 2793365891 2791355267 Bacteria 7222458
545 2805926202 2802429605 Bacteria 6875453
546 2805933928 2802429606 Bacteria 6346811
547 2806047353 2802429633 Bacteria 7341974
548 2806054208 2802429634 Bacteria 7083200
549 2806060208 2802429635 Bacteria 7650140
550 2806068819 2802429636 Bacteria 7597525
551 2806076425 2802429637 Bacteria 7067217
552 2808988234 2808606387 Bacteria 5697198
553 2819244603 2818991272 Bacteria 4622173
554 2819560952 2818991439 Bacteria 6907412
555 2819687021 2818991461 Bacteria 7026071
556 2821128714 2821123053 Bacteria 7836056
557 2838018345 2838016132 Bacteria 6577831
558 2838024028 2838022645 Bacteria 6494267
559 2838040367 2838035591 Bacteria 7166484
560 2838047826 2838042994 Bacteria 6046894
561 2838050793 2838048938 Bacteria 6044578
562 2838062559 2838061910 Bacteria 6794874
563 2838072110 2838068647 Bacteria 6208656
564 2838667781 2838661181 Bacteria 7385261
565 2838672151 2838668709 Bacteria 6671819
566 2838678685 2838675328 Bacteria 4909118
567 2838683892 2838680041 Bacteria 6545511
568 2838690268 2838686498 Bacteria 7807632
569 2838698420 2838694306 Bacteria 6853137
570 2838704979 2838701080 Bacteria 6669771
571 2838711535 2838707686 Bacteria 6619912
572 2838718227 2838714209 Bacteria 5525906
573 2838722981 2838719591 Bacteria 5523910
574 2838728293 2838724970 Bacteria 4908691
575 2838732043 2838729681 Bacteria 7400765
576 2838741730 2838736955 Bacteria 5760694
577 2838744939 2838742623 Bacteria 7396178
578 2841845436 2841840854 Bacteria 5761912
579 2841850537 2841846520 Bacteria 5345850
580 2841855997 2841851746 Bacteria 7532261
581 2841863210 2841859092 Bacteria 5436171
582 2841867773 2841864319 Bacteria 6742987
583 2842081336 2842077413 Bacteria 6508645
584 2842116868 2842110456 Bacteria 7656360
585 2842121887 2842118031 Bacteria 7033875
586 2842128953 2842124991 Bacteria 5346824
587 2842133577 2842130223 Bacteria 4909145
588 2842145139 2842140634 Bacteria 5759631
589 2842148785 2842146304 Bacteria 5957337
590 2842155511 2842152218 Bacteria 4908957
591 2842161167 2842156927 Bacteria 6894975
592 2842166679 2842163707 Bacteria 6916235
593 2842174531 2842170452 Bacteria 5525737
594 2842179191 2842175837 Bacteria 4908771
595 2842184783 2842180545 Bacteria 6888678
596 2842190651 2842187318 Bacteria 5524014
597 2842194895 2842192696 Bacteria 6147454
598 2842201621 2842198810 Bacteria 6608673
599 2842207406 2842205361 Bacteria 6340321
600 2842215025 2842211629 Bacteria 5523832
601 2842221766 2842217011 Bacteria 7497767
602 2842227746 2842224351 Bacteria 5524473
603 2842232365 2842229732 Bacteria 7475766
604 2842240901 2842237096 Bacteria 6620661
605 2842246781 2842243621 Bacteria 7421798
606 2842254660 2842250916 Bacteria 6579627
607 2842261118 2842257432 Bacteria 7401195
608 2842269625 2842264693 Bacteria 6472963
609 2842274288 2842271015 Bacteria 7807131
610 2842280883 2842278818 Bacteria 6340002
611 2842288505 2842285085 Bacteria 6011953
612 2842294993 2842291075 Bacteria 7076806
613 2842305869 2842304105 Bacteria 7023636
614 2842311397 2842311132 Bacteria 6616990
615 2842321098 2842317721 Bacteria 6793725
616 2842346597 2842341865 Bacteria 7003929
617 2842366286 2842363717 Bacteria 6844742
618 2842374989 2842370503 Bacteria 7038661
619 2842381392 2842377471 Bacteria 7140707
620 2842388462 2842384541 Bacteria 7057858
621 2842395958 2842395702 Bacteria 6780583
622 2842406149 2842402390 Bacteria 6681310
623 2842412734 2842409023 Bacteria 6687331
624 2842419387 2842415677 Bacteria 6596907
625 2842425742 2842422224 Bacteria 6239196
626 2842433613 2842428310 Bacteria 6767288
627 2842439941 2842434925 Bacteria 6502746
628 2842446570 2842441272 Bacteria 6769273
629 2842448794 2842447887 Bacteria 6754142
630 2842467921 2842462802 Bacteria 6588055
631 2842474550 2842469257 Bacteria 6752936
632 2842491151 2842489311 Bacteria 6620893
633 2842498488 2842495871 Bacteria 6820686
634 2842520052 2842515876 Bacteria 5436280
635 2842926304 2842922631 Bacteria 5824079
636 2844166247 2844163670 Bacteria 7266046
637 2844457033 2844454524 Bacteria 7952546
638 2854901736 2854896431 Bacteria 5869725
639 2854919469 2854916844 Bacteria 5725939
640 2857519560 2857516855 Bacteria 7787325
641 2857534133 2857531043 Bacteria 6754041
642 2891377929 2891373044 Bacteria 5202277
643 2899795310 2899792073 Bacteria 4926588
644 2899808053 2899803654 Bacteria 5577784
645 2899849290 2899845264 Bacteria 5672268
646 2913312102 2913308742 Bacteria 5350706
647 2919105373 2919100787 Bacteria 7710546
648 2919118515 2919114240 Bacteria 5700270
649 2919175800 2919171160 Bacteria 6499771
650 2920825939 2920822456 Bacteria 6897201
651 2923559504 2923556063 Bacteria 6793593
652 2926755045 2926754445 Bacteria 5964435
653 2926762205 2926760298 Bacteria 5505990
654 2933010639 2933006813 Bacteria 4912075
655 2933015689 2933011516 Bacteria 5439334
656 2933017013 2933016740 Bacteria 6355406
657 2933572374 2933570622 Bacteria 7023390
658 2933593127 2933586486 Bacteria 7667493
659 2933597570 2933594066 Bacteria 5594265
660 2933603037 2933599457 Bacteria 5858799
661 2935897929 2935894831 Bacteria 6620579
662 2935903649 2935901341 Bacteria 7341747
663 2936369875 2936367885 Bacteria 7324495
664 2936379060 2936375103 Bacteria 6652732
665 2936381965 2936381700 Bacteria 7006523
666 2941501360 2941499720 Bacteria 7599444
667 2979092525 2979089926 Bacteria 5670289
668 2979100084 2979095461 Bacteria 5669583
669 2979104496 2979100975 Bacteria 5423623
670 2984513709 2984509177 Bacteria 5274802
671 2984522713 2984518228 Bacteria 5277463
672 2984542019 2984537506 Bacteria 5277481
673 2984601449 2984601300 Bacteria 5455244
674 2989354956 2989349275 Bacteria 6349068
675 2989780141 2989776772 Bacteria 4843317
676 2996890226 2996887358 Bacteria 5795980
677 2996895266 2996893221 Bacteria 5823108
678 3005415783 3005409236 Bacteria 7188837
679 3005449645 3005445848 Bacteria 6906074
680 3005455928 3005452660 Bacteria 5889319
681 639650417 639633055 Bacteria 7751309
682 650741155 650716007 Bacteria 5573770
683 8003573785 8003570095 Bacteria 5747666
684 8005249282 8005246636 Bacteria 4933972
685 8005262410 8005258706 Bacteria 6184835
686 8005282418 8005275841 Bacteria 6929066
687 8005286763 8005282627 Bacteria 6675747
688 8005295069 8005289223 Bacteria 6634003
689 8005305948 8005301065 Bacteria 6614431
690 8005313684 8005307578 Bacteria 7395396
691 8005324753 8005321885 Bacteria 5795980
692 8005381582 8005376324 Bacteria 6590079
693 8005387786 8005382845 Bacteria 6732062
694 8005400822 8005395548 Bacteria 6806915
695 8005431091 8005430974 Bacteria 6689030
696 8005465082 8005460587 Bacteria 7157962
697 8005497659 8005497431 Bacteria 6477605
698 8005546657 8005542996 Bacteria 7077758
699 8005561157 8005556819 Bacteria 6908598
700 8005565782 8005563573 Bacteria 7153261
701 8005571829 8005570704 Bacteria 6957481
702 8005623393 8005619151 Bacteria 7030230
703 8005631027 8005626139 Bacteria 6534237
704 8005660794 8005658619 Bacteria 4500593
705 8005669064 8005668836 Bacteria 6953162
706 8005694353 8005688590 Bacteria 6610080
707 8005695719 8005695170 Bacteria 6912330
708 8018128896 8018127388 Bacteria 7351159
709 8018153351 8018150411 Bacteria 5549903
710 8018165104 8018163183 Bacteria 7277977
711 8018177136 8018176218 Bacteria 6896178
712 8023686523 8023680758 Bacteria 7729763
713 8024484356 8024479707 Bacteria 6954785
714 8024490836 8024486573 Bacteria 6540512
715 8024502339 8024501048 Bacteria 6427847
716 8055435570 8055431914 Bacteria 4551896
717 8056380400 8056375014 Bacteria 7006639
718 8056385231 8056382006 Bacteria 6408074
719 8056878236 8056875544 Bacteria 4355797
720 8057879273 8057874678 Bacteria 7494653
721 Ga0373935_0171773
722 RicEn_C10344
723 JGI25158J39367_1000116
724 JGI25152J39213_1002679
725 JGI25152J39213_1007127
726 JGI25152J39213_1008840
727 JGI25152J39213_1012669
728 JGI25152J39213_1029515
729 JGI25150J39212_1000037
730 JGI25150J39212_1002674
731 JGI25159J45721_1000017
732 JGI25159J45721_1002450
733 JGI25151J46595_10000220
734 JGI25151J46595_10002753
735 JGI25151J46595_10013759
736 JGI25151J46595_10055471
737 JGI25153J46596_10007468
738 JGI25153J46596_10008966
739 JGI25153J46596_10020908
740 JGI25153J46596_10029782
741 JGI25153J46596_10031300
742 JGI25153J46596_10071411
743 rootH2_10072600
744 rootH1_10245785
745 JGI25160J50197_1000027
746 JGI25160J50197_1004236
747 JGI25160J50197_1021914
748 JGI25161J50226_1000327
749 JGI25161J50226_1000501
750 Ga0055526_1001473
751 Ga0055526_1004020
752 Ga0055526_1007862
753 Ga0055526_1008010
754 Ga0055526_1010107
755 Ga0055524_1002650
756 Ga0055524_1003843
757 Ga0055524_1004200
758 Ga0055524_1004836
759 Ga0055524_1026436
760 Ga0055524_1042784
761 Ga0055536_1001323
762 Ga0055528_1000099
763 Ga0055528_1002777
764 Ga0055528_1002884
765 Ga0055528_1003479
766 Ga0055528_1003641
767 Ga0055528_1015747
768 Ga0055528_1018827
769 Ga0055540_1004301
770 Ga0055540_1007209
771 Ga0055540_1009091
772 Ga0055540_1011960
773 Ga0055531_10004054
774 Ga0055531_10021365
775 Ga0058692_1004143
776 Ga0058692_1006819
777 Ga0055543_1000030
778 Ga0055543_1000062
779 Ga0055543_1004762
780 Ga0065165_1000122
781 Ga0065165_1009930
782 Ga0070670_100000116
783 Ga0070670_100627456
784 Ga0070668_100163932
785 Ga0070671_100057902
786 Ga0070663_100835594
787 Ga0070665_100004011
788 Ga0070665_100064560
789 Ga0070665_100214209
790 Ga0070665_100220976
791 Ga0070665_100843237
792 Ga0068861_100961186
793 Ga0075365_10000498
794 Ga0075365_10034493
795 Ga0075365_10054293
796 Ga0075365_10132303
797 Ga0075368_10003863
798 Ga0075368_10027222
799 Ga0075368_10044952
800 Ga0075363_100116730
801 Ga0075364_10000026
802 Ga0075364_10121436
803 Ga0075362_10002019
804 Ga0075362_10012138
805 Ga0075367_10004009
806 Ga0075367_10004494
807 Ga0075369_10002071
808 Ga0075369_10007620
809 Ga0075369_10036124
810 Ga0075369_10158987
811 Ga0075366_10081626
812 Ga0075366_10194627
813 Ga0075370_10169851
814 Ga0075370_10202411
815 Ga0079104_1000195
816 Ga0099826_10000958
817 Ga0099826_10019601
818 Ga0105251_10017043
819 Ga0105244_10088997
820 Ga0105250_10029222
821 Ga0105250_10250695
822 Ga0105243_10005164
823 Ga0105248_10119214
824 Ga0105249_10600761
825 Ga0123341_1000009
826 Ga0123342_1009724
827 Ga0105246_10046692
828 Ga0105246_10729693
829 Ga0157322_1003437
830 Ga0157373_10135423
831 Ga0157373_10505532
832 Ga0157371_10000108
833 Ga0157370_10004961
834 Ga0157370_10555371
835 Ga0157370_10830905
836 Ga0163161_10076548
837 Ga0209436_100018
838 Ga0209436_100664
839 Ga0207425_1000034
840 Ga0207425_1002143
841 Ga0207425_1009172
842 Ga0207425_1020102
843 Ga0209129_1000118
844 Ga0209129_1000253
845 Ga0209129_1000971
846 Ga0209129_1003196
847 Ga0209129_1003252
848 Ga0209129_1004160
849 Ga0209129_1004572
850 Ga0209673_1000033
851 Ga0209673_1000050
852 Ga0209673_1000052
853 Ga0209673_1004625
854 Ga0209673_1005860
855 Ga0209673_1010491
856 Ga0209673_1011538
857 Ga0209130_1000009
858 Ga0209130_1000027
859 Ga0209676_1000406
860 Ga0209676_1014960
861 Ga0209025_1000241
862 Ga0209025_1000335
863 Ga0209025_1000487
864 Ga0209025_1000533
865 Ga0209025_1002217
866 Ga0209025_1005633
867 Ga0209025_1013935
868 Ga0209025_1015409
869 Ga0209025_1027717
870 Ga0209025_1064942
871 Ga0209564_1000111
872 Ga0209564_1000782
873 Ga0209564_1003320
874 Ga0209564_1003367
875 Ga0209564_1016817
876 Ga0209564_1024253
877 Ga0209758_1000415
878 Ga0209758_1000570
879 Ga0209758_1001085
880 Ga0209758_1001086
881 Ga0209758_1002520
882 Ga0209758_1002827
883 Ga0209758_1004611
884 Ga0209758_1015745
885 Ga0209758_1040429
886 Ga0209050_1000572
887 Ga0209050_1004422
888 Ga0209050_1004558
889 Ga0209256_1001743
890 Ga0209256_1002370
891 Ga0209256_1003544
892 Ga0209256_1003766
893 Ga0209256_1007283
894 Ga0209256_1007659
895 Ga0209256_1012473
896 Ga0209256_1064228
897 Ga0207426_1000041
898 Ga0207426_1000072
899 Ga0207426_1000348
900 Ga0207426_1001232
901 Ga0209051_1000276
902 Ga0209051_1001068
903 Ga0209051_1003342
904 Ga0209051_1005359
905 Ga0209051_1006368
906 Ga0209051_1009487
907 Ga0209051_1025776
908 Ga0209051_1084775
909 Ga0209257_1002707
910 Ga0209257_1003532
911 Ga0209257_1007840
912 Ga0207650_10000691
913 Ga0207650_10456487
914 Ga0207668_10211867
915 Ga0207678_10157915
916 Ga0209281_1000028
917 Ga0209371_1000037
918 Ga0209282_1061069
919 Ga0209813_10008558
920 Ga0209813_10018240
921 Ga0268266_10006277
922 Ga0268266_10046940
923 Ga0268266_10274370
924 Ga0268266_10559781
925 Ga0307515_10091403
926 Ga0307515_10341559
927 Ga0268256_1000039
928 Ga0268256_1006192
929 Ga0316181_1219928
930 Ga0316182_1125124
931 Ga0307405_10014073
932 Ga0307412_10005736
933 Ga0307414_10092769
934 Ga0307414_10275341
935 Ga0373943_0279673
936 Ga0373927_0000311
937 Ga0373925_0004023
938 Ga0395905_0008738
939 Ga0395905_0016140
940 Ga0395901_0737547
941 Ga0439465_0003192
942 Ga0451791_1345467
943 Ga0451802_0488296
944 Ga0451804_0031999
945 Ga0451839_1011021
946 Ga0451846_16282
947 Ga0451847_0484987
948 Ga0451849_1333317
949 Ga0451843_0168405
950 Ga0451854_27717
951 Ga0451855_0487823
952 Ga0451855_1356374
953 Ga0452271_84286
954 Ga0439432_055974
955 Ga0439449_0011037
956 Ga0439449_0054074
957 Ga0466965_0083615
958 Ga0495617_045425
959 Ga0495592_0027176
960 Ga0495590_0157878
961 Ga0495629_0012949
962 Ga0495638_0003269
963 Ga0495650_0049192
964 Ga0495650_0064425
965 Ga0495605_0002525
966 Ga0495605_0055743
967 Ga0495639_0203543
968 Ga0495662_0002948
969 Ga0495585_0075254
970 Ga0495607_0039229
971 Ga0495607_0043296
972 Ga0495583_0020888
973 Ga0495583_0030217
974 Ga0495583_0078164
975 Ga0495606_0002721
976 Ga0495606_0065112
977 Ga0495606_0069944
978 Ga0495606_0199747
979 Ga0495610_0018390
980 Ga0495610_0049789
981 Ga0495610_0099707
982 Ga0495616_0020903
983 Ga0495616_0079629
984 Ga0495618_0354244
985 Ga0495620_0042756
986 Ga0495620_0051274
987 Ga0495620_0092762
988 Ga0495631_0002242
989 Ga0495631_0069816
990 Ga0495631_0145392
991 Ga0495632_0009845
992 Ga0495632_0018201
993 Ga0495632_0028409
994 Ga0495643_0031476
995 Ga0495643_0075118
996 Ga0495643_0082130
997 Ga0495644_0124905
998 Ga0495648_0170951
999 Ga0495663_0032664
1000 Ga0495652_0673457
1001 Ga0495654_0036910
1002 Ga0495654_0203180
1003 Ga0495587_0043343
1004 Ga0495597_0211758
1005 Ga0495622_0056449
1006 Ga0495633_0017477
1007 Ga0495633_0043486
1008 Ga0495656_0017308
1009 Ga0495656_0084332
1010 Ga0495668_0006323
1011 Ga0495668_0033189
1012 Ga0495611_0010753
1013 Ga0495611_0245018
1014 Ga0495625_0004490
1015 Ga0495625_0234310
1016 Ga0495635_0274900
1017 Ga0495588_0003857
1018 Ga0495588_0199378
1019 Ga0495657_0040807
1020 Ga0495658_0143846
1021 Ga0495670_0077090
1022 Ga0495649_0172590
1023 Ga0495600_0205169
1024 Ga0495604_0030094
1025 Ga0495636_0075163
1026 Ga0495672_0050339
1027 Ga0495683_0189236
1028 Ga0495687_109531
1029 Ga0495673_0159922
1030 Ga0495681_0004907
1031 Ga0495686_0015554
1032 Ga0495686_0022064
1033 Ga0495686_0038018
1034 Ga0495686_0072884
1035 Ga0495686_0400493
1036 Ga0495615_0037031
1037 Ga0495626_0085234
1038 Ga0496111_0025110
1039 Ga0496113_0322481
1040 Ga0496116_0005573
1041 Ga0496116_0025349
1042 Ga0496116_0028421
1043 Ga0496116_0065649
1044 Ga0496117_0000031
1045 Ga0496117_0032840
1046 Ga0496117_0042184
1047 Ga0496117_0074990
1048 Ga0496118_0000899
1049 Ga0496118_0076791
1050 Ga0496118_0080335
1051 Ga0496118_0097285
1052 Ga0496118_0157308
1053 Ga0496119_0182203
1054 Ga0496120_0000337
1055 Ga0496120_0105201
1056 Ga0496120_0281825
1057 Ga0496121_0005857
1058 Ga0496121_0017796
1059 Ga0496121_0026755
1060 Ga0496121_0027371
1061 Ga0496121_0032092
1062 Ga0496121_0038490
1063 Ga0496121_0067368
1064 Ga0496121_0103185
1065 Ga0496121_0178040
1066 Ga0496121_0250461
1067 Ga0496121_0263865
1068 Ga0496121_0524669
1069 Ga0496122_0000023
1070 Ga0496122_0000074
1071 Ga0496122_0000286
1072 Ga0496122_0017308
1073 Ga0496122_0021693
1074 Ga0496122_0025165
1075 Ga0496122_0150487
1076 Ga0496123_0000027
1077 Ga0496123_0000062
1078 Ga0496123_0006549
1079 Ga0496123_0007630
1080 Ga0496123_0017095
1081 Ga0496123_0036008
1082 Ga0496123_0038065
1083 Ga0496123_0068460
1084 Ga0496123_0164731
1085 Ga0496124_0002248
1086 Ga0496124_0021541
1087 Ga0496124_0024118
1088 Ga0496124_0027332
1089 Ga0496124_0037520
1090 Ga0496124_0103547
1091 Ga0496124_0154210
1092 Ga0496124_0282908
1093 Ga0496124_0284143
1094 Ga0496124_0764549
1095 Ga0496125_0008659
1096 Ga0496125_0027541
1097 Ga0496125_0042092
1098 Ga0496125_0223410
1099 Ga0496126_0000892
1100 Ga0496126_0165125
1101 Ga0496126_0322983
1102 Ga0495678_006181
1103 Ga0501032_0215700
1104 Ga0501038_0238399
1105 Ga0501043_0025472
1106 Ga0501080_0520876
1107 Ga0501280_002832
1108 Ga0501282_002248
1109 Ga0501044_0179878
1110 nmdc:mga03683_23864_c1
1111 nmdc:mga03683_40021_c1
1112 nmdc:mga00v17_1285_c1
1113 nmdc:mga00v17_151_c1
1114 nmdc:mga00v17_41963_c1
1115 nmdc:mga0yw44_137544_c1
1116 nmdc:mga0yw44_29465_c1
1117 nmdc:mga0k408_155997_c1
1118 nmdc:mga0k408_55701_c1
1119 nmdc:mga06z11_6588_c1
1120 nmdc:mga04h51_7309_c1
1121 nmdc:mga04h51_9426_c1
1122 nmdc:mga07m45_115924_c1
1123 nmdc:mga0sz30_107_c1
1124 nmdc:mga0sz30_1545_c1
1125 nmdc:mga0sz30_32333_c1
1126 nmdc:mga0sz30_98810_c1
1127 Ga0500610_0012502
1128 Ga0495619_0085068
1129 Ga0500578_0067685
1130 Ga0500560_002140
1131 Ga0500569_144190
1132 Ga0500594_0007425
1133 Ga0500614_076585
1134 Ga0500618_001412
1135 Ga0500618_002740
1136 Ga0500618_011654
1137 Ga0500618_018603
1138 Ga0500618_023849
1139 Ga0500658_0000309
1140 Ga0500658_0018303
1141 Ga0500559_0003675
1142 Ga0500568_0008863
1143 Ga0500568_0018858
1144 Ga0500604_0009869
1145 Ga0500616_0005597
1146 Ga0500616_0007819
1147 Ga0500616_0020147
1148 Ga0500622_0118528
1149 Ga0500627_0156409
1150 Ga0500633_0012605
1151 Ga0500645_037445
1152 Ga0587077_047895
1153 Ga0587072_049824
1154 2509389424
1155 2509446179
1156 2510135233
1157 2510896688
1158 2511169790
1159 2511183985
1160 2511194589
1161 2513571617
1162 2513578651
1163 2513596816
1164 2513630164
1165 2513711337
1166 2513867467
1167 2513912366
1168 2513928449
1169 2514019388
1170 2515114391
1171 2515635394
1172 2515643198
1173 2515657662
1174 2515741575
1175 2517038041
1176 2517078305
1177 2517097064
1178 2517408552
1179 2520377452
1180 2530647364
1181 2535519008
1182 2537873832
1183 2554248854
1184 2559295942
1185 2561467104
1186 2585201751
1187 2585223910
1188 2585228754
1189 2585257361
1190 2585399735
1191 2585526058
1192 2585540765
1193 2585549133
1194 2585820822
1195 2585839035
1196 2585844878
1197 2585997766
1198 2586002351
1199 2599420161
1200 2599603267
1201 2599720321
1202 2600193360
1203 2600373249
1204 2601610829
1205 2601747603
1206 2616296328
1207 2643808058
1208 2643813750
1209 2643921467
1210 2644002457
1211 2644110159
1212 2644150435
1213 2644194837
1214 2644240517
1215 2644299817
1216 2644313039
1217 2644336587
1218 2644379492
1219 2644521520
1220 2644546234
1221 2644618769
1222 2644658044
1223 2644677086
1224 2719182950
1225 2719387663
1226 2719667295
1227 2719733667
1228 2720493715
1229 2720615168
1230 2720621963
1231 2720633313
1232 2720777011
1233 2721149062
1234 2721160460
1235 2721165875
1236 2721401297
1237 2722842045
1238 2723028609
1239 2723562213
1240 2723568916
1241 2724040111
1242 2724046423
1243 2724091618
1244 2724106181
1245 2724111987
1246 2725947524
1247 2730109545
1248 2730166185
1249 2730300092
1250 2738805586
1251 2738947069
1252 2739037262
1253 2766064281
1254 2776915610
1255 2793295641
1256 2793313392
1257 2793320698
1258 2793327270
1259 2793332224
1260 2793338799
1261 2793346587
1262 2793353874
1263 2793359409
1264 2793365891
1265 2805926202
1266 2805933928
1267 2806047353
1268 2806054208
1269 2806060208
1270 2806068819
1271 2806076425
1272 2808988234
1273 2819244603
1274 2819560952
1275 2819687021
1276 2821128714
1277 2838018345
1278 2838024028
1279 2838040367
1280 2838047826
1281 2838050793
1282 2838062559
1283 2838072110
1284 2838667781
1285 2838672151
1286 2838678685
1287 2838683892
1288 2838690268
1289 2838698420
1290 2838704979
1291 2838711535
1292 2838718227
1293 2838722981
1294 2838728293
1295 2838732043
1296 2838741730
1297 2838744939
1298 2841845436
1299 2841850537
1300 2841855997
1301 2841863210
1302 2841867773
1303 2842081336
1304 2842116868
1305 2842121887
1306 2842128953
1307 2842133577
1308 2842145139
1309 2842148785
1310 2842155511
1311 2842161167
1312 2842166679
1313 2842174531
1314 2842179191
1315 2842184783
1316 2842190651
1317 2842194895
1318 2842201621
1319 2842207406
1320 2842215025
1321 2842221766
1322 2842227746
1323 2842232365
1324 2842240901
1325 2842246781
1326 2842254660
1327 2842261118
1328 2842269625
1329 2842274288
1330 2842280883
1331 2842288505
1332 2842294993
1333 2842305869
1334 2842311397
1335 2842321098
1336 2842346597
1337 2842366286
1338 2842374989
1339 2842381392
1340 2842388462
1341 2842395958
1342 2842406149
1343 2842412734
1344 2842419387
1345 2842425742
1346 2842433613
1347 2842439941
1348 2842446570
1349 2842448794
1350 2842467921
1351 2842474550
1352 2842491151
1353 2842498488
1354 2842520052
1355 2842926304
1356 2844166247
1357 2844457033
1358 2854901736
1359 2854919469
1360 2857519560
1361 2857534133
1362 2891377929
1363 2899795310
1364 2899808053
1365 2899849290
1366 2913312102
1367 2919105373
1368 2919118515
1369 2919175800
1370 2920825939
1371 2923559504
1372 2926755045
1373 2926762205
1374 2933010639
1375 2933015689
1376 2933017013
1377 2933572374
1378 2933593127
1379 2933597570
1380 2933603037
1381 2935897929
1382 2935903649
1383 2936369875
1384 2936379060
1385 2936381965
1386 2941501360
1387 2979092525
1388 2979100084
1389 2979104496
1390 2984513709
1391 2984522713
1392 2984542019
1393 2984601449
1394 2989354956
1395 2989780141
1396 2996890226
1397 2996895266
1398 3005415783
1399 3005449645
1400 3005455928
1401 639650417
1402 650741155
1403 8003573785
1404 8005249282
1405 8005262410
1406 8005282418
1407 8005286763
1408 8005295069
1409 8005305948
1410 8005313684
1411 8005324753
1412 8005381582
1413 8005387786
1414 8005400822
1415 8005431091
1416 8005465082
1417 8005497659
1418 8005546657
1419 8005561157
1420 8005565782
1421 8005571829
1422 8005623393
1423 8005631027
1424 8005660794
1425 8005669064
1426 8005694353
1427 8005695719
1428 8018128896
1429 8018153351
1430 8018165104
1431 8018177136
1432 8023686523
1433 8024484356
1434 8024490836
1435 8024502339
1436 8055435570
1437 8056380400
1438 8056385231
1439 8056878236
1440 8057879273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13905

Thioredoxin_8

Thioredoxin-like

84

172

0.94

PF00578

AhpC-TSA

AhpC/TSA family

52

175

0.87

PF08534

Redoxin

Redoxin

52

191

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kng-assembly1.cif.gz_A crystal structure of ccmg reducing oxidoreductase at 1.14 a 0.9659 61 197
3k8n-assembly1.cif.gz_A crystal structure of e. coli ccmg 0.9182 55 201
3kh9-assembly1.cif.gz_A crystal structure of the periplasmic soluble domain of oxidized ccmg from pseudomonas aeruginosa 0.916 52 198
2b1k-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9151 56 197
1kng-assembly1.cif.gz_A crystal structure of ccmg reducing oxidoreductase at 1.14 a 0.914 61 197
ID Description Score Start End Superfamily
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9659 61 197 3.40.30.10
5hfiA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9338 87 120 3.40.30.10
2b1kA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9151 56 197 3.40.30.10
1kngA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.914 61 197 3.40.30.10
af_P71990_1_182_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.864 55 176 3.40.30.10
ID Description Score Start End GO Terms
AF-E6YG17-F1-model_v4 Thiol:disulfide interchange protein 0.9753 90 200 GO:0015036
GO:0017004
GO:0030288
AF-A0A3D5I3M4-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9685 83 199 GO:0016491
GO:0017004
AF-A0A3D4TMJ4-F1-model_v4 DsbE family thiol:disulfide interchange protein 0.9656 90 196 GO:0005886
GO:0015036
GO:0017004
GO:0030288
AF-A0A7W3WC79-F1-model_v4 deleted 0.9637 45 201
AF-A0A1Q7WVB3-F1-model_v4 Thiol:disulfide interchange protein 0.9634 73 201 GO:0015036
GO:0017004
GO:0030288

Map