F477393

General Info

Members Datasets Scaffolds Average Seq Length
721 373 1442 255

Family's Representative Sequence

Representative Sequence 3300053119|Ga0500595_003304|Ga0500595_003304_3563_4510
Length 315
Sequence MLMLRPDRRSAMLRPIAAFRAIPPAGIHAFPLHRKECQTAPAAAMGLDNIGAGAAVIASAMPEMPGLFTLAIALSGMFLIAFMKGAFGGGFAIVGIPLLSLAMDPITAGALLAPLFVVMDITALHYWRPNTWSRVDLAMLLPALVVGIGLGYFALRDLDRHAVEIVMGAVTLAFVALWFLGGGEVKPRPRSTWKAMLAGLSSGVTTMVAHSGGPPLAIYLLPLGMSKALYAGTTSLFFTVGNLLKAGPWLVLATPSKSLWILMALCVPAVPAGVWAGWRLHERLDQRALYRACYAILVVTAAKLLWDGLAGYVRA

Samples

Sample ID Description Type Environment
1 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
84 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
115 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
120 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
127 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
181 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
183 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
184 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
185 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
186 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
196 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
197 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
203 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
215 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
219 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
224 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
225 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
247 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
250 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
251 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
255 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
256 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
257 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
262 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
263 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
264 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
265 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
266 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
267 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
268 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
286 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
287 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
288 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
289 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
290 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
291 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
292 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
293 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
294 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
295 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
296 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
297 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
298 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
309 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
310 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
311 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
312 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
313 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
314 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
315 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
316 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
317 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
318 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
319 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
320 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
323 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
324 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
325 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
326 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
327 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
328 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
329 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
330 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
331 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
332 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
333 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
334 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
335 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
336 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
337 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
338 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
339 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
340 2738541300 Massilia sp. GV016 Isolate Unclassified
341 2738543018 Massilia sp. GV045 Isolate Unclassified
342 2738543030 Massilia sp. GV097 Isolate Unclassified
343 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
344 2818991452 Burkholderia cepacia 561 Isolate Unclassified
345 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
346 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
347 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
348 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
349 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
350 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
351 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
352 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
353 2904699407
354 2906610324
355 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
356 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
357 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
358 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
359 2928170801 Burkholderia sp. 572 Isolate Unclassified
360 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
361 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
362 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
363 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
364 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
365 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
366 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
367 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
368 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
369 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
370 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
371 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
372 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
373 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.58
Metatranscriptomes 0
Isolates 5.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.59
Nodule 5.13
Rhizoplane 8.18
Rhizosphere 60.06
Stem 0
Stem Tuber 0
Unclassified 0.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500595_003304 3300053119 Bacteria 7595
2 JGI24739J22299_10004632 3300001989 Bacteria 5258
3 JGI25159J45721_1000030 3300002987 Bacteria 102429
4 JGI25151J46595_10001370 3300003187 Bacteria 16856
5 JGI25151J46595_10002889 3300003187 Bacteria 9851
6 JGI25406J46586_10000085 3300003203 Bacteria 42549
7 JGI25165J46597_1000975 3300003214 Bacteria 19228
8 rootH2_10065025 3300003320 Bacteria 1425
9 rootH1_10265325 3300003323 Bacteria 1805
10 JGI25160J50197_1000075 3300003354 Bacteria 102429
11 JGI25160J50197_1000524 3300003354 Bacteria 22193
12 JGI25161J50226_1000388 3300003374 Bacteria 22193
13 JGI25161J50226_1000593 3300003374 Bacteria 15214
14 JGI25404J52841_10000831 3300003659 Bacteria 4943
15 Ga0055532_1001009 3300003758 Bacteria 8826
16 Ga0055527_1000150 3300003760 Bacteria 49156
17 Ga0055535_1000202 3300003761 Bacteria 63538
18 Ga0055542_1000237 3300003762 Bacteria 63538
19 Ga0055529_1000257 3300003763 Bacteria 63538
20 Ga0055526_1002008 3300003771 Bacteria 14018
21 Ga0055526_1006673 3300003771 Bacteria 6192
22 Ga0055526_1008700 3300003771 Bacteria 5009
23 Ga0055526_1012200 3300003771 Bacteria 3774
24 Ga0055524_1000014 3300003775 Bacteria 259417
25 Ga0055524_1006932 3300003775 Bacteria 4872
26 Ga0055536_1000203 3300003781 Bacteria 48522
27 Ga0055536_1005974 3300003781 Bacteria 5804
28 Ga0055534_1000660 3300003784 Bacteria 17385
29 Ga0055534_1004256 3300003784 Bacteria 4211
30 Ga0055528_1000858 3300003790 Bacteria 20639
31 Ga0055531_10018718 3300003794 Bacteria 2843
32 Ga0058692_1011333 3300003856 Bacteria 2160
33 Ga0055543_1000168 3300004625 Bacteria 54974
34 Ga0055543_1000449 3300004625 Bacteria 25002
35 Ga0065165_1000206 3300005262 Bacteria 102467
36 Ga0065165_1001476 3300005262 Bacteria 25122
37 Ga0070683_100149183 3300005329 Bacteria 2217
38 Ga0068869_100435843 3300005334 Bacteria 1084
39 Ga0068868_100105920 3300005338 Bacteria 2281
40 Ga0070691_10001016 3300005341 Bacteria 11520
41 Ga0070661_100070893 3300005344 Bacteria 2564
42 Ga0070668_100113315 3300005347 Bacteria 2160
43 Ga0070668_100311228 3300005347 Bacteria 1323
44 Ga0070669_100010500 3300005353 Bacteria 6576
45 Ga0070669_100312136 3300005353 Bacteria 1268
46 Ga0070675_100246230 3300005354 Bacteria 1563
47 Ga0070671_100034409 3300005355 Bacteria 4194
48 Ga0070671_100081155 3300005355 Bacteria 2712
49 Ga0070671_100318680 3300005355 Bacteria 1325
50 Ga0070674_100041548 3300005356 Bacteria 3118
51 Ga0070674_100597411 3300005356 Bacteria 932
52 Ga0070673_100195956 3300005364 Bacteria 1737
53 Ga0070709_10000216 3300005434 Bacteria 37230
54 Ga0070709_10270246 3300005434 Bacteria 1232
55 Ga0070713_100050867 3300005436 Bacteria 3425
56 Ga0070710_10003345 3300005437 Bacteria 7602
57 Ga0070710_10272384 3300005437 Bacteria 1095
58 Ga0070711_100014513 3300005439 Bacteria 4964
59 Ga0070711_100103366 3300005439 Bacteria 2076
60 Ga0070711_100190094 3300005439 Bacteria 1577
61 Ga0070700_100004033 3300005441 Bacteria 7642
62 Ga0070700_100106267 3300005441 Bacteria 1858
63 Ga0070700_100194720 3300005441 Bacteria 1420
64 Ga0070694_100124957 3300005444 Bacteria 1851
65 Ga0070663_100151170 3300005455 Bacteria 1780
66 Ga0070663_100292779 3300005455 Bacteria 1301
67 Ga0070678_100030921 3300005456 Bacteria 3687
68 Ga0070678_100213961 3300005456 Bacteria 1599
69 Ga0070678_100501511 3300005456 Bacteria 1071
70 Ga0070662_100085523 3300005457 Bacteria 2357
71 Ga0070681_10067376 3300005458 Bacteria 3548
72 Ga0068867_100605631 3300005459 Bacteria 956
73 Ga0070685_10148200 3300005466 Bacteria 1485
74 Ga0070706_100201010 3300005467 Bacteria 1862
75 Ga0070699_100055039 3300005518 Bacteria 3446
76 Ga0068853_100740690 3300005539 Bacteria 939
77 Ga0070695_100000381 3300005545 Bacteria 22893
78 Ga0070696_100170054 3300005546 Bacteria 1610
79 Ga0068855_100124512 3300005563 Bacteria 2948
80 Ga0068856_100115164 3300005614 Bacteria 2688
81 Ga0068856_100824728 3300005614 Bacteria 947
82 Ga0068852_100032142 3300005616 Bacteria 4341
83 Ga0068859_100249718 3300005617 Bacteria 1864
84 Ga0068864_100053213 3300005618 Bacteria 3492
85 Ga0068864_100482899 3300005618 Bacteria 1189
86 Ga0068861_100025826 3300005719 Bacteria 4265
87 Ga0068863_100684527 3300005841 Bacteria 1019
88 Ga0068858_100422023 3300005842 Bacteria 1283
89 Ga0068860_100271287 3300005843 Bacteria 1656
90 Ga0068862_100717787 3300005844 Bacteria 970
91 Ga0081455_10015097 3300005937 Bacteria 7519
92 Ga0081540_1001168 3300005983 Bacteria 23063
93 Ga0081540_1001292 3300005983 Bacteria 21853
94 Ga0081540_1001561 3300005983 Bacteria 19619
95 Ga0081540_1004935 3300005983 Bacteria 10034
96 Ga0081540_1010233 3300005983 Bacteria 6371
97 Ga0081540_1013374 3300005983 Bacteria 5340
98 Ga0081540_1024995 3300005983 Bacteria 3452
99 Ga0081540_1037124 3300005983 Bacteria 2587
100 Ga0081540_1046539 3300005983 Bacteria 2189
101 Ga0081540_1047943 3300005983 Bacteria 2144
102 Ga0081540_1059518 3300005983 Bacteria 1833
103 Ga0081540_1064159 3300005983 Bacteria 1734
104 Ga0081540_1082315 3300005983 Bacteria 1444
105 Ga0081540_1105346 3300005983 Bacteria 1205
106 Ga0081539_10000003 3300005985 Bacteria 594833
107 Ga0075365_10080588 3300006038 Bacteria 2204
108 Ga0075365_10081745 3300006038 Bacteria 2190
109 Ga0075363_100023998 3300006048 Bacteria 3097
110 Ga0075363_100114755 3300006048 Bacteria 1500
111 Ga0075363_100159599 3300006048 Bacteria 1276
112 Ga0070716_100011407 3300006173 Bacteria 4473
113 Ga0070716_100386896 3300006173 Bacteria 1001
114 Ga0070712_100056386 3300006175 Bacteria 2756
115 Ga0070712_100174541 3300006175 Bacteria 1670
116 Ga0075362_10013528 3300006177 Bacteria 3269
117 Ga0075362_10014315 3300006177 Bacteria 3198
118 Ga0075362_10194877 3300006177 Bacteria 985
119 Ga0075367_10009837 3300006178 Bacteria 5010
120 Ga0075367_10176499 3300006178 Bacteria 1331
121 Ga0075367_10176815 3300006178 Bacteria 1330
122 Ga0075369_10004647 3300006186 Bacteria 5092
123 Ga0075369_10071047 3300006186 Bacteria 1532
124 Ga0075369_10137584 3300006186 Bacteria 1112
125 Ga0075366_10024023 3300006195 Bacteria 3554
126 Ga0097621_100197921 3300006237 Bacteria 1743
127 Ga0097621_100484999 3300006237 Bacteria 1118
128 Ga0075370_10031353 3300006353 Bacteria 2967
129 Ga0075370_10283004 3300006353 Bacteria 985
130 Ga0068871_100139043 3300006358 Bacteria 2064
131 Ga0075428_100440920 3300006844 Bacteria 1395
132 Ga0075433_10007299 3300006852 Bacteria 8766
133 Ga0075434_100011869 3300006871 Bacteria 8235
134 Ga0075434_100187476 3300006871 Bacteria 2089
135 Ga0068865_100248066 3300006881 Bacteria 1404
136 Ga0068865_100341054 3300006881 Bacteria 1211
137 Ga0068865_100382044 3300006881 Bacteria 1149
138 Ga0097620_100249719 3300006931 Bacteria 1864
139 Ga0099823_1016936 3300006944 Bacteria 7127
140 Ga0099823_1018785 3300006944 Bacteria 6648
141 Ga0099826_10000013 3300006948 Bacteria 265459
142 Ga0099795_10065222 3300007788 Bacteria 1361
143 Ga0099795_10104886 3300007788 Bacteria 1113
144 Ga0105251_10016616 3300009011 Bacteria 3968
145 Ga0105251_10021512 3300009011 Bacteria 3365
146 Ga0105250_10010707 3300009092 Bacteria 3817
147 Ga0111539_10891516 3300009094 Bacteria 1035
148 Ga0105245_10049804 3300009098 Bacteria 3752
149 Ga0105245_10079949 3300009098 Bacteria 2986
150 Ga0105245_10230938 3300009098 Bacteria 1789
151 Ga0105245_10404395 3300009098 Bacteria 1365
152 Ga0105247_10257099 3300009101 Bacteria 1196
153 Ga0105247_10325575 3300009101 Bacteria 1074
154 Ga0114129_10196308 3300009147 Bacteria 2736
155 Ga0105243_10179674 3300009148 Bacteria 1839
156 Ga0105243_10336116 3300009148 Bacteria 1382
157 Ga0105243_10387330 3300009148 Bacteria 1295
158 Ga0105243_10621299 3300009148 Bacteria 1043
159 Ga0105241_10035047 3300009174 Bacteria 3774
160 Ga0105241_10064819 3300009174 Bacteria 2822
161 Ga0105242_10084686 3300009176 Bacteria 2657
162 Ga0105242_10362484 3300009176 Bacteria 1342
163 Ga0105248_10034058 3300009177 Bacteria 5693
164 Ga0105248_10054096 3300009177 Bacteria 4501
165 Ga0105248_10194397 3300009177 Bacteria 2286
166 Ga0105237_10030235 3300009545 Bacteria 5503
167 Ga0105237_10130535 3300009545 Bacteria 2507
168 Ga0105237_10231480 3300009545 Bacteria 1849
169 Ga0105237_10264745 3300009545 Bacteria 1722
170 Ga0105237_10518106 3300009545 Bacteria 1199
171 Ga0105238_10289878 3300009551 Bacteria 1619
172 Ga0105238_10874636 3300009551 Bacteria 916
173 Ga0105249_10074635 3300009553 Bacteria 3139
174 Ga0105249_10302474 3300009553 Bacteria 1605
175 Ga0105249_10889471 3300009553 Bacteria 957
176 Ga0099796_10046893 3300010159 Bacteria 1485
177 Ga0105239_10011851 3300010375 Bacteria 9727
178 Ga0105239_10012140 3300010375 Bacteria 9606
179 Ga0105239_10075944 3300010375 Bacteria 3695
180 Ga0105239_10421767 3300010375 Bacteria 1512
181 Ga0105246_10083115 3300011119 Bacteria 2287
182 Ga0105246_10098459 3300011119 Bacteria 2124
183 Ga0105246_10191172 3300011119 Bacteria 1584
184 Ga0105246_10501948 3300011119 Bacteria 1030
185 Ga0157370_10027578 3300013104 Bacteria 5599
186 Ga0157370_10168772 3300013104 Bacteria 2034
187 Ga0157374_10080954 3300013296 Bacteria 3081
188 Ga0157374_10258654 3300013296 Bacteria 1714
189 Ga0163162_10124775 3300013306 Bacteria 2680
190 Ga0163162_10141115 3300013306 Bacteria 2523
191 Ga0157375_10018732 3300013308 Bacteria 6282
192 Ga0157375_10112761 3300013308 Bacteria 2820
193 Ga0157375_10255364 3300013308 Bacteria 1914
194 Ga0157375_10422745 3300013308 Bacteria 1499
195 Ga0163163_10174349 3300014325 Bacteria 2197
196 Ga0163163_10175381 3300014325 Bacteria 2190
197 Ga0163163_10214567 3300014325 Bacteria 1974
198 Ga0163163_10333207 3300014325 Bacteria 1572
199 Ga0157380_10340015 3300014326 Bacteria 1400
200 Ga0157380_10461206 3300014326 Bacteria 1223
201 Ga0157377_10160862 3300014745 Bacteria 1396
202 Ga0157377_10203701 3300014745 Bacteria 1258
203 Ga0157379_10780084 3300014968 Bacteria 901
204 Ga0157376_10019174 3300014969 Bacteria 5264
205 Ga0157376_10143567 3300014969 Bacteria 2144
206 Ga0157376_10667290 3300014969 Bacteria 1042
207 Ga0182007_10000608 3300015262 Bacteria 20908
208 Ga0182005_1014887 3300015265 Bacteria 2174
209 Ga0163161_10053658 3300017792 Bacteria 2924
210 Ga0163161_10059876 3300017792 Bacteria 2770
211 Ga0163161_10207646 3300017792 Bacteria 1512
212 Ga0214542_1027346 3300021321 Bacteria 2626
213 Ga0214543_1001580 3300021327 Bacteria 44273
214 Ga0213872_10000907 3300021361 Bacteria 21260
215 Ga0213872_10001086 3300021361 Bacteria 18698
216 Ga0213872_10001611 3300021361 Bacteria 14275
217 Ga0213872_10001866 3300021361 Bacteria 13028
218 Ga0213872_10028434 3300021361 Bacteria 2563
219 Ga0213872_10104833 3300021361 Bacteria 1258
220 Ga0209672_100035 3300025228 Bacteria 303111
221 Ga0209147_100041 3300025229 Bacteria 303111
222 Ga0209147_100156 3300025229 Bacteria 93105
223 Ga0209437_100858 3300025233 Bacteria 12861
224 Ga0209258_100063 3300025242 Bacteria 303577
225 Ga0209148_1000088 3300025254 Bacteria 258188
226 Ga0209233_1000584 3300025261 Bacteria 19289
227 Ga0209233_1001106 3300025261 Bacteria 11025
228 Ga0209233_1010556 3300025261 Bacteria 2761
229 Ga0209565_1000201 3300025263 Bacteria 71408
230 Ga0209565_1006577 3300025263 Bacteria 3245
231 Ga0209455_1000075 3300025272 Bacteria 285430
232 Ga0209455_1002576 3300025272 Bacteria 6913
233 Ga0209673_1000036 3300025273 Bacteria 323162
234 Ga0209673_1000061 3300025273 Bacteria 262274
235 Ga0209130_1000154 3300025284 Bacteria 102645
236 Ga0209130_1000409 3300025284 Bacteria 46757
237 Ga0209130_1006540 3300025284 Bacteria 3766
238 Ga0209675_1000013 3300025291 Bacteria 448220
239 Ga0209675_1000167 3300025291 Bacteria 79477
240 Ga0209675_1007498 3300025291 Bacteria 4174
241 Ga0209676_1000121 3300025292 Bacteria 198920
242 Ga0209676_1005963 3300025292 Bacteria 6163
243 Ga0209025_1000032 3300025294 Bacteria 416141
244 Ga0209025_1000051 3300025294 Bacteria 330080
245 Ga0209025_1001002 3300025294 Bacteria 41890
246 Ga0209025_1008061 3300025294 Bacteria 7670
247 Ga0209564_1000025 3300025295 Bacteria 520535
248 Ga0209564_1000133 3300025295 Bacteria 189140
249 Ga0209564_1000240 3300025295 Bacteria 118922
250 Ga0209564_1000434 3300025295 Bacteria 72534
251 Ga0209564_1000578 3300025295 Bacteria 58027
252 Ga0209564_1003386 3300025295 Bacteria 10994
253 Ga0209564_1004064 3300025295 Bacteria 9225
254 Ga0209564_1019204 3300025295 Bacteria 2566
255 Ga0209758_1000868 3300025297 Bacteria 41599
256 Ga0209050_1019218 3300025298 Bacteria 2608
257 Ga0209256_1000052 3300025299 Bacteria 299374
258 Ga0209256_1000801 3300025299 Bacteria 40223
259 Ga0209256_1009401 3300025299 Bacteria 4296
260 Ga0207426_1000269 3300025302 Bacteria 109050
261 Ga0207426_1000286 3300025302 Bacteria 102853
262 Ga0207426_1000439 3300025302 Bacteria 67107
263 Ga0209051_1015854 3300025303 Bacteria 3449
264 Ga0209257_1005525 3300025304 Bacteria 8814
265 Ga0209257_1012653 3300025304 Bacteria 3867
266 Ga0207697_10053949 3300025315 Bacteria 1665
267 Ga0207697_10059965 3300025315 Bacteria 1582
268 Ga0207713_1055515 3300025735 Bacteria 1545
269 Ga0207692_10001498 3300025898 Bacteria 8769
270 Ga0207688_10060451 3300025901 Bacteria 2134
271 Ga0207688_10063154 3300025901 Bacteria 2089
272 Ga0207688_10078029 3300025901 Bacteria 1888
273 Ga0207647_10024012 3300025904 Bacteria 4023
274 Ga0207647_10253591 3300025904 Bacteria 1008
275 Ga0207685_10104914 3300025905 Bacteria 1215
276 Ga0207699_10001209 3300025906 Bacteria 12241
277 Ga0207699_10229295 3300025906 Bacteria 1271
278 Ga0207645_10081665 3300025907 Bacteria 2072
279 Ga0207684_10296148 3300025910 Bacteria 1395
280 Ga0207654_10066590 3300025911 Bacteria 2125
281 Ga0207707_10162591 3300025912 Bacteria 1952
282 Ga0207695_10154144 3300025913 Bacteria 2233
283 Ga0207671_10222242 3300025914 Bacteria 1480
284 Ga0207693_10021080 3300025915 Bacteria 5180
285 Ga0207693_10032038 3300025915 Bacteria 4151
286 Ga0207693_10174175 3300025915 Bacteria 1693
287 Ga0207693_10201893 3300025915 Bacteria 1563
288 Ga0207693_10344303 3300025915 Bacteria 1167
289 Ga0207663_10001932 3300025916 Bacteria 9814
290 Ga0207663_10124266 3300025916 Bacteria 1772
291 Ga0207649_10093549 3300025920 Bacteria 1973
292 Ga0207694_10080092 3300025924 Bacteria 2563
293 Ga0207650_10479750 3300025925 Bacteria 1038
294 Ga0207687_10025333 3300025927 Bacteria 3970
295 Ga0207687_10110474 3300025927 Bacteria 2039
296 Ga0207687_10221890 3300025927 Bacteria 1489
297 Ga0207700_10058522 3300025928 Bacteria 2911
298 Ga0207664_10050921 3300025929 Bacteria 3268
299 Ga0207644_10126042 3300025931 Bacteria 1955
300 Ga0207706_10005893 3300025933 Bacteria 11399
301 Ga0207686_10137816 3300025934 Bacteria 1682
302 Ga0207686_10299409 3300025934 Bacteria 1194
303 Ga0207709_10116283 3300025935 Bacteria 1798
304 Ga0207709_10306939 3300025935 Bacteria 1182
305 Ga0207665_10019548 3300025939 Bacteria 4454
306 Ga0207665_10234163 3300025939 Bacteria 1351
307 Ga0207691_10227241 3300025940 Bacteria 1617
308 Ga0207691_10312468 3300025940 Bacteria 1348
309 Ga0207711_10048075 3300025941 Bacteria 3649
310 Ga0207711_10141715 3300025941 Bacteria 2163
311 Ga0207711_10404783 3300025941 Bacteria 1268
312 Ga0207689_10005976 3300025942 Bacteria 10768
313 Ga0207689_10204640 3300025942 Bacteria 1630
314 Ga0207689_10206622 3300025942 Bacteria 1622
315 Ga0207667_10061099 3300025949 Bacteria 3943
316 Ga0207712_10256372 3300025961 Bacteria 1416
317 Ga0207712_10441389 3300025961 Bacteria 1102
318 Ga0207668_10007990 3300025972 Bacteria 6296
319 Ga0207668_10123377 3300025972 Bacteria 1965
320 Ga0207668_10206681 3300025972 Bacteria 1567
321 Ga0207658_10119941 3300025986 Bacteria 2095
322 Ga0207703_10166302 3300026035 Bacteria 1936
323 Ga0207703_10168249 3300026035 Bacteria 1926
324 Ga0207703_10231864 3300026035 Bacteria 1655
325 Ga0207678_10053206 3300026067 Bacteria 3490
326 Ga0207678_10118746 3300026067 Bacteria 2257
327 Ga0207678_10288341 3300026067 Bacteria 1410
328 Ga0207708_10005744 3300026075 Bacteria 9168
329 Ga0207708_10021747 3300026075 Bacteria 4840
330 Ga0207708_10145077 3300026075 Bacteria 1865
331 Ga0207708_10339450 3300026075 Bacteria 1230
332 Ga0207641_10312969 3300026088 Bacteria 1487
333 Ga0207641_10420258 3300026088 Bacteria 1287
334 Ga0207648_10598162 3300026089 Bacteria 1016
335 Ga0207648_10659761 3300026089 Bacteria 967
336 Ga0207676_10264548 3300026095 Bacteria 1554
337 Ga0207674_10208086 3300026116 Bacteria 1905
338 Ga0207675_100045363 3300026118 Bacteria 4107
339 Ga0207675_100115548 3300026118 Bacteria 2536
340 Ga0207683_10073252 3300026121 Bacteria 3030
341 Ga0207683_10088006 3300026121 Bacteria 2763
342 Ga0207683_10090469 3300026121 Bacteria 2725
343 Ga0207683_10121405 3300026121 Bacteria 2346
344 Ga0207698_10306334 3300026142 Bacteria 1481
345 Ga0209389_1008948 3300027296 Bacteria 8938
346 Ga0209389_1010024 3300027296 Bacteria 8516
347 Ga0209371_1000179 3300027312 Bacteria 93861
348 Ga0209589_1000676 3300027357 Bacteria 49982
349 Ga0209489_100062 3300027361 Bacteria 145478
350 Ga0209489_111509 3300027361 Bacteria 8938
351 Ga0209489_111839 3300027361 Bacteria 8516
352 Ga0209700_110927 3300027363 Bacteria 8938
353 Ga0209700_111242 3300027363 Bacteria 8516
354 Ga0209282_1000043 3300027666 Bacteria 119260
355 Ga0209588_1014646 3300027671 Bacteria 2403
356 Ga0268266_10009304 3300028379 Bacteria 8665
357 Ga0268266_10193947 3300028379 Bacteria 1856
358 Ga0268265_10005524 3300028380 Bacteria 8627
359 Ga0268265_10139082 3300028380 Bacteria 2030
360 Ga0268265_10243572 3300028380 Bacteria 1588
361 Ga0268264_10367337 3300028381 Bacteria 1374
362 Ga0268264_10368601 3300028381 Bacteria 1372
363 Ga0307515_10000160 3300028794 Bacteria 164789
364 Ga0268256_1000149 3300030500 Bacteria 93861
365 Ga0307513_10326741 3300031456 Bacteria 1290
366 Ga0307516_10310350 3300031730 Bacteria 1251
367 Ga0307510_10010555 3300033180 Bacteria 10973
368 Ga0307510_10052806 3300033180 Bacteria 4279
369 Ga0307510_10209592 3300033180 Bacteria 1473
370 Ga0315911_1000006 3300033442 Bacteria 414563
371 Ga0315911_1000010 3300033442 Bacteria 322197
372 Ga0373940_0014228 3300035088 Bacteria 1938
373 Ga0373952_0009842 3300035092 Bacteria 1838
374 Ga0373932_0041064 3300035112 Bacteria 1335
375 Ga0373945_0098173 3300035116 Bacteria 1143
376 Ga0373960_0004154 3300035121 Bacteria 3308
377 Ga0373943_0050055 3300035170 Bacteria 2052
378 Ga0373942_0053073 3300035207 Bacteria 1142
379 Ga0373961_0076659 3300035241 Bacteria 1044
380 Ga0373931_0002876 3300035691 Bacteria 7672
381 Ga0373931_0140751 3300035691 Bacteria 1397
382 Ga0373927_0005782 3300035695 Bacteria 8489
383 Ga0373927_0016306 3300035695 Bacteria 4902
384 Ga0373947_0004169 3300035725 Bacteria 8492
385 Ga0373947_0037380 3300035725 Bacteria 2881
386 Ga0373925_0062663 3300037068 Bacteria 2797
387 Ga0395905_0031525 3300037471 Bacteria 4991
388 Ga0395905_0280648 3300037471 Bacteria 1552
389 Ga0436365_0913976 3300039437 Bacteria 2063
390 Ga0436365_0931078 3300039437 Bacteria 2910
391 Ga0436365_1178230 3300039437 Bacteria 1949
392 Ga0436365_1769494 3300039437 Bacteria 1192
393 Ga0436360_0148226 3300039438 Bacteria 1326
394 Ga0436360_0731023 3300039438 Bacteria 1774
395 Ga0436360_1020232 3300039438 Bacteria 2296
396 Ga0436361_0082970 3300039447 Bacteria 8400
397 Ga0436361_0091951 3300039447 Bacteria 10819
398 Ga0436361_0096149 3300039447 Bacteria 15910
399 Ga0436361_0201274 3300039447 Bacteria 3163
400 Ga0436361_0204659 3300039447 Bacteria 10676
401 Ga0436361_0262026 3300039447 Bacteria 30890
402 Ga0436361_0277135 3300039447 Bacteria 3682
403 Ga0436361_0681104 3300039447 Bacteria 24321
404 Ga0436361_0796193 3300039447 Bacteria 1244
405 Ga0436361_0827273 3300039447 Bacteria 14015
406 Ga0436361_1011321 3300039447 Bacteria 1200
407 Ga0436361_1085489 3300039447 Bacteria 1823
408 Ga0436363_0540076 3300039450 Bacteria 1167
409 Ga0436362_0514368 3300039453 Bacteria 2928
410 Ga0439452_033630 3300042010 Bacteria 1244
411 Ga0466964_0027182 3300044706 Bacteria 2245
412 Ga0466960_0055738 3300044901 Bacteria 1923
413 Ga0466967_0312108 3300045976 Bacteria 1515
414 Ga0495603_0006194 3300046455 Bacteria 7154
415 Ga0495603_0177132 3300046455 Bacteria 1234
416 Ga0495591_000251 3300046458 Bacteria 51890
417 Ga0495638_0007874 3300046460 Bacteria 7603
418 Ga0495641_0034815 3300046461 Bacteria 2378
419 Ga0495650_0051104 3300046471 Bacteria 1705
420 Ga0495580_0262535 3300046472 Bacteria 1181
421 Ga0495605_0018977 3300046474 Bacteria 3680
422 Ga0495605_0031954 3300046474 Bacteria 2684
423 Ga0495605_0047395 3300046474 Bacteria 2108
424 Ga0495605_0047792 3300046474 Unclassified 2097
425 Ga0495664_0400051 3300046477 Bacteria 825
426 Ga0495584_0000007 3300046491 Bacteria 294820
427 Ga0495584_0000018 3300046491 Bacteria 142382
428 Ga0495584_0000901 3300046491 Bacteria 19022
429 Ga0495585_0000003 3300046492 Bacteria 406344
430 Ga0495585_0000264 3300046492 Bacteria 52455
431 Ga0495585_0001279 3300046492 Bacteria 20094
432 Ga0495585_0006146 3300046492 Bacteria 7492
433 Ga0495585_0020057 3300046492 Bacteria 3846
434 Ga0495596_0001236 3300046500 Bacteria 14883
435 Ga0495596_0005439 3300046500 Bacteria 6016
436 Ga0495596_0077643 3300046500 Bacteria 1289
437 Ga0495607_0007789 3300046501 Bacteria 7373
438 Ga0495607_0030451 3300046501 Bacteria 3313
439 Ga0495583_0001238 3300046506 Bacteria 27122
440 Ga0495583_0004255 3300046506 Bacteria 10381
441 Ga0495583_0008979 3300046506 Bacteria 6028
442 Ga0495583_0039461 3300046506 Bacteria 2224
443 Ga0495606_0001356 3300046507 Bacteria 33234
444 Ga0495606_0002146 3300046507 Bacteria 23772
445 Ga0495606_0036483 3300046507 Bacteria 3347
446 Ga0495606_0042940 3300046507 Bacteria 3020
447 Ga0495606_0063805 3300046507 Bacteria 2347
448 Ga0495616_0000228 3300046513 Bacteria 46105
449 Ga0495616_0003233 3300046513 Bacteria 10486
450 Ga0495616_0003675 3300046513 Bacteria 9798
451 Ga0495616_0015489 3300046513 Bacteria 4240
452 Ga0495616_0034720 3300046513 Bacteria 2616
453 Ga0495620_0001264 3300046515 Bacteria 15433
454 Ga0495630_0122386 3300046517 Bacteria 1974
455 Ga0495631_0000090 3300046518 Bacteria 59264
456 Ga0495632_0000681 3300046519 Bacteria 31033
457 Ga0495632_0169762 3300046519 Bacteria 1003
458 Ga0495643_0013974 3300046522 Bacteria 4786
459 Ga0495643_0037229 3300046522 Bacteria 2670
460 Ga0495643_0063433 3300046522 Bacteria 1954
461 Ga0495643_0151802 3300046522 Bacteria 1147
462 Ga0495648_0000171 3300046524 Bacteria 74494
463 Ga0495648_0003560 3300046524 Bacteria 13627
464 Ga0495648_0005173 3300046524 Bacteria 10916
465 Ga0495648_0010240 3300046524 Bacteria 7161
466 Ga0495648_0029940 3300046524 Bacteria 3606
467 Ga0495648_0078434 3300046524 Unclassified 1888
468 Ga0495648_0083356 3300046524 Bacteria 1812
469 Ga0495642_0003682 3300046528 Bacteria 6015
470 Ga0495654_0007039 3300046530 Bacteria 6331
471 Ga0495609_0000566 3300046538 Bacteria 29042
472 Ga0495609_0020794 3300046538 Bacteria 3029
473 Ga0495609_0034901 3300046538 Unclassified 2278
474 Ga0495609_0038300 3300046538 Bacteria 2162
475 Ga0495597_0008221 3300046542 Bacteria 5244
476 Ga0495622_0069563 3300046557 Bacteria 1625
477 Ga0495622_0085362 3300046557 Bacteria 1452
478 Ga0495633_0000702 3300046558 Bacteria 30531
479 Ga0495633_0013203 3300046558 Bacteria 4362
480 Ga0495633_0031351 3300046558 Bacteria 2578
481 Ga0495656_0054638 3300046615 Bacteria 1719
482 Ga0495668_0000094 3300046616 Bacteria 141412
483 Ga0495668_0000129 3300046616 Bacteria 113044
484 Ga0495668_0007639 3300046616 Bacteria 6883
485 Ga0495668_0009157 3300046616 Bacteria 6101
486 Ga0495668_0145382 3300046616 Bacteria 1298
487 Ga0495611_0013495 3300046648 Bacteria 3479
488 Ga0495611_0077769 3300046648 Bacteria 1522
489 Ga0495611_0185090 3300046648 Bacteria 973
490 Ga0495625_0003017 3300046660 Bacteria 17334
491 Ga0495625_0007263 3300046660 Bacteria 9691
492 Ga0495625_0026997 3300046660 Bacteria 4329
493 Ga0495625_0128561 3300046660 Bacteria 1718
494 Ga0495659_0008109 3300046664 Bacteria 3338
495 Ga0495659_0077495 3300046664 Bacteria 1256
496 Ga0495661_0011409 3300046665 Bacteria 6032
497 Ga0495661_0037066 3300046665 Bacteria 3046
498 Ga0495661_0081364 3300046665 Bacteria 1866
499 Ga0495588_0316572 3300046674 Bacteria 821
500 Ga0495669_0035469 3300046684 Bacteria 2202
501 Ga0495670_0000770 3300046691 Bacteria 15357
502 Ga0495671_0004568 3300046692 Bacteria 8237
503 Ga0495671_0011654 3300046692 Bacteria 4824
504 Ga0495671_0013199 3300046692 Bacteria 4484
505 Ga0495671_0036772 3300046692 Bacteria 2479
506 Ga0495671_0270782 3300046692 Bacteria 819
507 Ga0495649_0003412 3300046694 Bacteria 10738
508 Ga0495649_0026960 3300046694 Bacteria 3190
509 Ga0495589_0000033 3300046794 Bacteria 162794
510 Ga0495660_0001774 3300046810 Bacteria 14278
511 Ga0495660_0002528 3300046810 Bacteria 11661
512 Ga0495660_0025127 3300046810 Bacteria 3385
513 Ga0495660_0169777 3300046810 Bacteria 1063
514 Ga0495674_0264219 3300047319 Bacteria 1413
515 Ga0495672_0011421 3300047320 Bacteria 6269
516 Ga0495672_0050386 3300047320 Bacteria 2457
517 Ga0495676_0119583 3300047321 Bacteria 1919
518 Ga0495683_0000083 3300047323 Bacteria 93743
519 Ga0495683_0001589 3300047323 Bacteria 14641
520 Ga0495683_0002730 3300047323 Bacteria 10522
521 Ga0495683_0005834 3300047323 Bacteria 6775
522 Ga0495683_0009551 3300047323 Bacteria 5167
523 Ga0495683_0018287 3300047323 Bacteria 3626
524 Ga0495683_0066995 3300047323 Bacteria 1768
525 Ga0495683_0087202 3300047323 Bacteria 1516
526 Ga0495683_0215841 3300047323 Bacteria 858
527 Ga0495687_000017 3300047443 Bacteria 350429
528 Ga0495687_009263 3300047443 Bacteria 5528
529 Ga0495687_084482 3300047443 Bacteria 1234
530 Ga0495679_007526 3300047446 Bacteria 4526
531 Ga0495679_043286 3300047446 Bacteria 1385
532 Ga0495685_000938 3300047447 Bacteria 8820
533 Ga0495685_004641 3300047447 Bacteria 4454
534 Ga0495673_0003848 3300047469 Bacteria 9682
535 Ga0495673_0005900 3300047469 Bacteria 7314
536 Ga0495673_0028679 3300047469 Bacteria 2634
537 Ga0495673_0177686 3300047469 Bacteria 808
538 Ga0495681_0005657 3300047470 Bacteria 8326
539 Ga0495684_0329700 3300047471 Bacteria 1089
540 Ga0495593_0044363 3300047673 Bacteria 2379
541 Ga0495626_0001391 3300048091 Bacteria 19406
542 Ga0496100_0021982 3300048903 Bacteria 3852
543 Ga0496100_0036374 3300048903 Bacteria 3105
544 Ga0496100_0151990 3300048903 Bacteria 1652
545 Ga0496101_0009247 3300048904 Bacteria 6471
546 Ga0496101_0242695 3300048904 Bacteria 1402
547 Ga0496102_0006087 3300048905 Bacteria 10289
548 Ga0496102_0006237 3300048905 Bacteria 10164
549 Ga0496102_0018498 3300048905 Bacteria 6124
550 Ga0496102_0210877 3300048905 Bacteria 1831
551 Ga0496102_0558935 3300048905 Bacteria 1067
552 Ga0496103_0038267 3300048906 Bacteria 2942
553 Ga0496103_0050426 3300048906 Bacteria 2575
554 Ga0496103_0094082 3300048906 Bacteria 1893
555 Ga0496104_0004902 3300048907 Bacteria 11673
556 Ga0496104_0048949 3300048907 Bacteria 3985
557 Ga0496104_0056150 3300048907 Bacteria 3723
558 Ga0496104_0083602 3300048907 Bacteria 3044
559 Ga0496105_0000318 3300048908 Bacteria 31631
560 Ga0496105_0009330 3300048908 Bacteria 7670
561 Ga0496105_0017517 3300048908 Bacteria 5746
562 Ga0496105_0038302 3300048908 Bacteria 3950
563 Ga0496105_0287710 3300048908 Bacteria 1324
564 Ga0496106_0016217 3300048909 Bacteria 5511
565 Ga0496106_0026512 3300048909 Bacteria 4316
566 Ga0496106_0039933 3300048909 Bacteria 3514
567 Ga0496106_0065252 3300048909 Bacteria 2772
568 Ga0496106_0298450 3300048909 Bacteria 1292
569 Ga0496107_0002391 3300048910 Bacteria 12143
570 Ga0496107_0003592 3300048910 Bacteria 10401
571 Ga0496108_0137938 3300048911 Bacteria 2100
572 Ga0496108_0429783 3300048911 Bacteria 1153
573 Ga0496109_0034401 3300048912 Bacteria 4563
574 Ga0496109_0060185 3300048912 Bacteria 3470
575 Ga0496109_0143239 3300048912 Bacteria 2235
576 Ga0496109_0165578 3300048912 Bacteria 2072
577 Ga0496109_0198344 3300048912 Bacteria 1887
578 Ga0496109_0258248 3300048912 Bacteria 1641
579 Ga0496110_0046958 3300048913 Bacteria 3779
580 Ga0496110_0123808 3300048913 Bacteria 2331
581 Ga0496110_0160483 3300048913 Bacteria 2038
582 Ga0496110_0319451 3300048913 Bacteria 1414
583 Ga0496111_0045682 3300048914 Bacteria 3152
584 Ga0496111_0078950 3300048914 Bacteria 2400
585 Ga0496112_0052196 3300048915 Bacteria 4012
586 Ga0496112_0138190 3300048915 Bacteria 2406
587 Ga0496112_0339272 3300048915 Bacteria 1446
588 Ga0496113_0003901 3300048916 Bacteria 9039
589 Ga0496113_0088444 3300048916 Bacteria 2383
590 Ga0496113_0191174 3300048916 Bacteria 1625
591 Ga0496113_0191469 3300048916 Bacteria 1623
592 Ga0496114_0017140 3300048917 Bacteria 5842
593 Ga0496114_0179980 3300048917 Bacteria 1846
594 Ga0496114_0557354 3300048917 Bacteria 1012
595 Ga0496115_0013677 3300048918 Bacteria 6144
596 Ga0496115_0073868 3300048918 Bacteria 2768
597 Ga0496115_0089701 3300048918 Bacteria 2511
598 Ga0496115_0095385 3300048918 Bacteria 2435
599 Ga0496116_0004369 3300048919 Bacteria 13514
600 Ga0496116_0105368 3300048919 Bacteria 1673
601 Ga0496116_0244197 3300048919 Bacteria 899
602 Ga0496117_0002629 3300048920 Bacteria 22276
603 Ga0496117_0055074 3300048920 Bacteria 2782
604 Ga0496117_0094433 3300048920 Bacteria 1914
605 Ga0496117_0141950 3300048920 Bacteria 1437
606 Ga0496118_0000966 3300048921 Bacteria 44919
607 Ga0496118_0031253 3300048921 Bacteria 4419
608 Ga0496118_0044513 3300048921 Bacteria 3475
609 Ga0496118_0054891 3300048921 Bacteria 3013
610 Ga0496118_0104009 3300048921 Bacteria 1908
611 Ga0496119_0016165 3300048922 Bacteria 5698
612 Ga0496119_0023355 3300048922 Bacteria 4390
613 Ga0496120_0013451 3300048923 Bacteria 5506
614 Ga0496121_0002217 3300048924 Bacteria 30352
615 Ga0496121_0015838 3300048924 Bacteria 7843
616 Ga0496121_0137735 3300048924 Bacteria 1816
617 Ga0496121_0262874 3300048924 Bacteria 1190
618 Ga0496121_0317503 3300048924 Bacteria 1050
619 Ga0496122_0000043 3300048925 Bacteria 280333
620 Ga0496122_0000908 3300048925 Bacteria 54441
621 Ga0496123_0000090 3300048926 Bacteria 179735
622 Ga0496123_0000412 3300048926 Bacteria 78170
623 Ga0496123_0020702 3300048926 Bacteria 5138
624 Ga0496123_0096315 3300048926 Bacteria 1738
625 Ga0496124_0180048 3300048927 Bacteria 1627
626 Ga0496125_0000051 3300048928 Bacteria 285754
627 Ga0496125_0311741 3300048928 Bacteria 958
628 Ga0496126_0007725 3300048929 Bacteria 11734
629 Ga0496126_0022164 3300048929 Bacteria 6187
630 Ga0496126_0143739 3300048929 Bacteria 2051
631 Ga0495678_003182 3300049459 Bacteria 10343
632 Ga0495682_0001062 3300049460 Bacteria 16167
633 Ga0495682_0007135 3300049460 Bacteria 4465
634 nmdc:mga03n38_276029_c1 3300050490 Bacteria 896
635 nmdc:mga03n38_45650_c1 3300050490 Bacteria 1930
636 nmdc:mga00v17_62136_c1 3300050491 Bacteria 2297
637 nmdc:mga0k408_154697_c1 3300050493 Bacteria 1366
638 nmdc:mga06z11_158517_c1 3300050494 Bacteria 1292
639 nmdc:mga06z11_21857_c1 3300050494 Bacteria 2979
640 nmdc:mga06z11_357388_c1 3300050494 Bacteria 875
641 nmdc:mga06z11_61061_c1 3300050494 Bacteria 1965
642 nmdc:mga04h51_4538_c1 3300050495 Bacteria 3466
643 nmdc:mga07m45_242283_c1 3300050496 Bacteria 1049
644 nmdc:mga07m45_5932_c1 3300050496 Bacteria 6131
645 nmdc:mga05p37_705158_c1 3300050507 Bacteria 1120
646 nmdc:mga05p37_72341_c1 3300050507 Bacteria 4242
647 nmdc:mga08y16_34670_c1 3300050511 Bacteria 5302
648 nmdc:mga0n895_182164_c1 3300050512 Bacteria 2132
649 nmdc:mga0n895_502_c1 3300050512 Bacteria 26508
650 nmdc:mga0a205_4465_c1 3300050515 Bacteria 12556
651 nmdc:mga0sz30_32577_c1 3300050516 Bacteria 2162
652 nmdc:mga0sz30_53526_c2 3300050516 Bacteria 1155
653 nmdc:mga0sz30_84720_c1 3300050516 Bacteria 1375
654 Ga0500635_0037167 3300053080 Bacteria 1609
655 Ga0500643_000015 3300053087 Bacteria 310312
656 Ga0500555_009621 3300053103 Bacteria 2765
657 Ga0500556_0006082 3300053104 Bacteria 3421
658 Ga0500556_0044133 3300053104 Bacteria 1585
659 Ga0500562_003619 3300053108 Bacteria 3879
660 Ga0500569_004065 3300053109 Bacteria 3047
661 Ga0500592_005045 3300053116 Bacteria 2098
662 Ga0500594_0020507 3300053118 Bacteria 1650
663 Ga0500642_0078492 3300053130 Bacteria 1513
664 Ga0500564_093306 3300053138 Bacteria 1338
665 Ga0500577_0140046 3300053142 Bacteria 1020
666 Ga0500616_0013901 3300053153 Bacteria 4647
667 Ga0500619_036813 3300053154 Bacteria 1525
668 Ga0500620_021597 3300053155 Bacteria 1926
669 Ga0500622_0025216 3300053156 Bacteria 3142
670 Ga0500627_0038138 3300053158 Bacteria 2053
671 Ga0500633_0013380 3300053160 Bacteria 2298
672 Ga0500638_052038 3300053162 Bacteria 1979
673 Ga0500638_176194 3300053162 Bacteria 927
674 Ga0500636_0000206 3300053177 Bacteria 31849
675 Ga0500636_0155931 3300053177 Bacteria 1250
676 Ga0500637_0125989 3300053178 Bacteria 1485
677 Ga0500645_016121 3300053730 Bacteria 2358
678 Ga0500599_000862 3300053736 Bacteria 3361
679 Ga0500601_000281 3300053737 Bacteria 9680
680 Ga0500661_007848 3300055283 Bacteria 1968
681 2513915899 2513237145 Bacteria 8979722
682 2513924695 2513237146 Bacteria 7166346
683 2524534551 2524023228 Bacteria 10118060
684 2599416248 2599185170 Bacteria 7295545
685 2599738877 2599185239 Bacteria 8686614
686 2671119212 2667528175 Bacteria 7532676
687 2738846719 2738541300 Bacteria 6675882
688 2739277623 2738543018 Bacteria 6718814
689 2739346692 2738543030 Bacteria 6719714
690 2776259366 2775506901 Bacteria 9631051
691 2776266308 2775506901 Bacteria 9631051
692 2819631450 2818991452 Bacteria 8442785
693 2838036372 2838035591 Bacteria 7166484
694 2840764674 2840764183 Bacteria 6358399
695 2842342157 2842341865 Bacteria 7003929
696 2842365867 2842363717 Bacteria 6844742
697 2842477436 2842475841 Bacteria 6603183
698 2842504232 2842502639 Bacteria 6604161
699 2903752999 2903748898 Bacteria 9972761
700 2904697780 2904690495 Bacteria 9412302
701 2904705941
702 2906611517
703 2906642441 2906635258 Bacteria 8601019
704 2906660748 2906660503 Bacteria 8595048
705 2908745101 2908739725 Bacteria 8628932
706 2908757123 2908756301 Bacteria 8864324
707 2928176080 2928170801 Bacteria 8785406
708 2935632226 2935630451 Bacteria 8169952
709 2941505716 2941499720 Bacteria 7599444
710 2941508174 2941507105 Bacteria 8166816
711 2941515321 2941515067 Bacteria 8166720
712 2941524104 2941523033 Bacteria 8169134
713 2981996562 2981990288 Bacteria 7590678
714 3005477550 3005474847 Bacteria 9259049
715 642414425 641736154 Bacteria 7689995
716 8006933685 8006933436 Bacteria 10410654
717 8006983357 8006973647 Bacteria 10679141
718 8018851116 8018845410 Bacteria 8933938
719 8019559615 8019555841 Bacteria 9642137
720 8019569718 8019565922 Bacteria 9639779
721 8021126097 8021120328 Bacteria 8782274
722 Ga0500595_003304
723 JGI24739J22299_10004632
724 JGI25159J45721_1000030
725 JGI25151J46595_10001370
726 JGI25151J46595_10002889
727 JGI25406J46586_10000085
728 JGI25165J46597_1000975
729 rootH2_10065025
730 rootH1_10265325
731 JGI25160J50197_1000075
732 JGI25160J50197_1000524
733 JGI25161J50226_1000388
734 JGI25161J50226_1000593
735 JGI25404J52841_10000831
736 Ga0055532_1001009
737 Ga0055527_1000150
738 Ga0055535_1000202
739 Ga0055542_1000237
740 Ga0055529_1000257
741 Ga0055526_1002008
742 Ga0055526_1006673
743 Ga0055526_1008700
744 Ga0055526_1012200
745 Ga0055524_1000014
746 Ga0055524_1006932
747 Ga0055536_1000203
748 Ga0055536_1005974
749 Ga0055534_1000660
750 Ga0055534_1004256
751 Ga0055528_1000858
752 Ga0055531_10018718
753 Ga0058692_1011333
754 Ga0055543_1000168
755 Ga0055543_1000449
756 Ga0065165_1000206
757 Ga0065165_1001476
758 Ga0070683_100149183
759 Ga0068869_100435843
760 Ga0068868_100105920
761 Ga0070691_10001016
762 Ga0070661_100070893
763 Ga0070668_100113315
764 Ga0070668_100311228
765 Ga0070669_100010500
766 Ga0070669_100312136
767 Ga0070675_100246230
768 Ga0070671_100034409
769 Ga0070671_100081155
770 Ga0070671_100318680
771 Ga0070674_100041548
772 Ga0070674_100597411
773 Ga0070673_100195956
774 Ga0070709_10000216
775 Ga0070709_10270246
776 Ga0070713_100050867
777 Ga0070710_10003345
778 Ga0070710_10272384
779 Ga0070711_100014513
780 Ga0070711_100103366
781 Ga0070711_100190094
782 Ga0070700_100004033
783 Ga0070700_100106267
784 Ga0070700_100194720
785 Ga0070694_100124957
786 Ga0070663_100151170
787 Ga0070663_100292779
788 Ga0070678_100030921
789 Ga0070678_100213961
790 Ga0070678_100501511
791 Ga0070662_100085523
792 Ga0070681_10067376
793 Ga0068867_100605631
794 Ga0070685_10148200
795 Ga0070706_100201010
796 Ga0070699_100055039
797 Ga0068853_100740690
798 Ga0070695_100000381
799 Ga0070696_100170054
800 Ga0068855_100124512
801 Ga0068856_100115164
802 Ga0068856_100824728
803 Ga0068852_100032142
804 Ga0068859_100249718
805 Ga0068864_100053213
806 Ga0068864_100482899
807 Ga0068861_100025826
808 Ga0068863_100684527
809 Ga0068858_100422023
810 Ga0068860_100271287
811 Ga0068862_100717787
812 Ga0081455_10015097
813 Ga0081540_1001168
814 Ga0081540_1001292
815 Ga0081540_1001561
816 Ga0081540_1004935
817 Ga0081540_1010233
818 Ga0081540_1013374
819 Ga0081540_1024995
820 Ga0081540_1037124
821 Ga0081540_1046539
822 Ga0081540_1047943
823 Ga0081540_1059518
824 Ga0081540_1064159
825 Ga0081540_1082315
826 Ga0081540_1105346
827 Ga0081539_10000003
828 Ga0075365_10080588
829 Ga0075365_10081745
830 Ga0075363_100023998
831 Ga0075363_100114755
832 Ga0075363_100159599
833 Ga0070716_100011407
834 Ga0070716_100386896
835 Ga0070712_100056386
836 Ga0070712_100174541
837 Ga0075362_10013528
838 Ga0075362_10014315
839 Ga0075362_10194877
840 Ga0075367_10009837
841 Ga0075367_10176499
842 Ga0075367_10176815
843 Ga0075369_10004647
844 Ga0075369_10071047
845 Ga0075369_10137584
846 Ga0075366_10024023
847 Ga0097621_100197921
848 Ga0097621_100484999
849 Ga0075370_10031353
850 Ga0075370_10283004
851 Ga0068871_100139043
852 Ga0075428_100440920
853 Ga0075433_10007299
854 Ga0075434_100011869
855 Ga0075434_100187476
856 Ga0068865_100248066
857 Ga0068865_100341054
858 Ga0068865_100382044
859 Ga0097620_100249719
860 Ga0099823_1016936
861 Ga0099823_1018785
862 Ga0099826_10000013
863 Ga0099795_10065222
864 Ga0099795_10104886
865 Ga0105251_10016616
866 Ga0105251_10021512
867 Ga0105250_10010707
868 Ga0111539_10891516
869 Ga0105245_10049804
870 Ga0105245_10079949
871 Ga0105245_10230938
872 Ga0105245_10404395
873 Ga0105247_10257099
874 Ga0105247_10325575
875 Ga0114129_10196308
876 Ga0105243_10179674
877 Ga0105243_10336116
878 Ga0105243_10387330
879 Ga0105243_10621299
880 Ga0105241_10035047
881 Ga0105241_10064819
882 Ga0105242_10084686
883 Ga0105242_10362484
884 Ga0105248_10034058
885 Ga0105248_10054096
886 Ga0105248_10194397
887 Ga0105237_10030235
888 Ga0105237_10130535
889 Ga0105237_10231480
890 Ga0105237_10264745
891 Ga0105237_10518106
892 Ga0105238_10289878
893 Ga0105238_10874636
894 Ga0105249_10074635
895 Ga0105249_10302474
896 Ga0105249_10889471
897 Ga0099796_10046893
898 Ga0105239_10011851
899 Ga0105239_10012140
900 Ga0105239_10075944
901 Ga0105239_10421767
902 Ga0105246_10083115
903 Ga0105246_10098459
904 Ga0105246_10191172
905 Ga0105246_10501948
906 Ga0157370_10027578
907 Ga0157370_10168772
908 Ga0157374_10080954
909 Ga0157374_10258654
910 Ga0163162_10124775
911 Ga0163162_10141115
912 Ga0157375_10018732
913 Ga0157375_10112761
914 Ga0157375_10255364
915 Ga0157375_10422745
916 Ga0163163_10174349
917 Ga0163163_10175381
918 Ga0163163_10214567
919 Ga0163163_10333207
920 Ga0157380_10340015
921 Ga0157380_10461206
922 Ga0157377_10160862
923 Ga0157377_10203701
924 Ga0157379_10780084
925 Ga0157376_10019174
926 Ga0157376_10143567
927 Ga0157376_10667290
928 Ga0182007_10000608
929 Ga0182005_1014887
930 Ga0163161_10053658
931 Ga0163161_10059876
932 Ga0163161_10207646
933 Ga0214542_1027346
934 Ga0214543_1001580
935 Ga0213872_10000907
936 Ga0213872_10001086
937 Ga0213872_10001611
938 Ga0213872_10001866
939 Ga0213872_10028434
940 Ga0213872_10104833
941 Ga0209672_100035
942 Ga0209147_100041
943 Ga0209147_100156
944 Ga0209437_100858
945 Ga0209258_100063
946 Ga0209148_1000088
947 Ga0209233_1000584
948 Ga0209233_1001106
949 Ga0209233_1010556
950 Ga0209565_1000201
951 Ga0209565_1006577
952 Ga0209455_1000075
953 Ga0209455_1002576
954 Ga0209673_1000036
955 Ga0209673_1000061
956 Ga0209130_1000154
957 Ga0209130_1000409
958 Ga0209130_1006540
959 Ga0209675_1000013
960 Ga0209675_1000167
961 Ga0209675_1007498
962 Ga0209676_1000121
963 Ga0209676_1005963
964 Ga0209025_1000032
965 Ga0209025_1000051
966 Ga0209025_1001002
967 Ga0209025_1008061
968 Ga0209564_1000025
969 Ga0209564_1000133
970 Ga0209564_1000240
971 Ga0209564_1000434
972 Ga0209564_1000578
973 Ga0209564_1003386
974 Ga0209564_1004064
975 Ga0209564_1019204
976 Ga0209758_1000868
977 Ga0209050_1019218
978 Ga0209256_1000052
979 Ga0209256_1000801
980 Ga0209256_1009401
981 Ga0207426_1000269
982 Ga0207426_1000286
983 Ga0207426_1000439
984 Ga0209051_1015854
985 Ga0209257_1005525
986 Ga0209257_1012653
987 Ga0207697_10053949
988 Ga0207697_10059965
989 Ga0207713_1055515
990 Ga0207692_10001498
991 Ga0207688_10060451
992 Ga0207688_10063154
993 Ga0207688_10078029
994 Ga0207647_10024012
995 Ga0207647_10253591
996 Ga0207685_10104914
997 Ga0207699_10001209
998 Ga0207699_10229295
999 Ga0207645_10081665
1000 Ga0207684_10296148
1001 Ga0207654_10066590
1002 Ga0207707_10162591
1003 Ga0207695_10154144
1004 Ga0207671_10222242
1005 Ga0207693_10021080
1006 Ga0207693_10032038
1007 Ga0207693_10174175
1008 Ga0207693_10201893
1009 Ga0207693_10344303
1010 Ga0207663_10001932
1011 Ga0207663_10124266
1012 Ga0207649_10093549
1013 Ga0207694_10080092
1014 Ga0207650_10479750
1015 Ga0207687_10025333
1016 Ga0207687_10110474
1017 Ga0207687_10221890
1018 Ga0207700_10058522
1019 Ga0207664_10050921
1020 Ga0207644_10126042
1021 Ga0207706_10005893
1022 Ga0207686_10137816
1023 Ga0207686_10299409
1024 Ga0207709_10116283
1025 Ga0207709_10306939
1026 Ga0207665_10019548
1027 Ga0207665_10234163
1028 Ga0207691_10227241
1029 Ga0207691_10312468
1030 Ga0207711_10048075
1031 Ga0207711_10141715
1032 Ga0207711_10404783
1033 Ga0207689_10005976
1034 Ga0207689_10204640
1035 Ga0207689_10206622
1036 Ga0207667_10061099
1037 Ga0207712_10256372
1038 Ga0207712_10441389
1039 Ga0207668_10007990
1040 Ga0207668_10123377
1041 Ga0207668_10206681
1042 Ga0207658_10119941
1043 Ga0207703_10166302
1044 Ga0207703_10168249
1045 Ga0207703_10231864
1046 Ga0207678_10053206
1047 Ga0207678_10118746
1048 Ga0207678_10288341
1049 Ga0207708_10005744
1050 Ga0207708_10021747
1051 Ga0207708_10145077
1052 Ga0207708_10339450
1053 Ga0207641_10312969
1054 Ga0207641_10420258
1055 Ga0207648_10598162
1056 Ga0207648_10659761
1057 Ga0207676_10264548
1058 Ga0207674_10208086
1059 Ga0207675_100045363
1060 Ga0207675_100115548
1061 Ga0207683_10073252
1062 Ga0207683_10088006
1063 Ga0207683_10090469
1064 Ga0207683_10121405
1065 Ga0207698_10306334
1066 Ga0209389_1008948
1067 Ga0209389_1010024
1068 Ga0209371_1000179
1069 Ga0209589_1000676
1070 Ga0209489_100062
1071 Ga0209489_111509
1072 Ga0209489_111839
1073 Ga0209700_110927
1074 Ga0209700_111242
1075 Ga0209282_1000043
1076 Ga0209588_1014646
1077 Ga0268266_10009304
1078 Ga0268266_10193947
1079 Ga0268265_10005524
1080 Ga0268265_10139082
1081 Ga0268265_10243572
1082 Ga0268264_10367337
1083 Ga0268264_10368601
1084 Ga0307515_10000160
1085 Ga0268256_1000149
1086 Ga0307513_10326741
1087 Ga0307516_10310350
1088 Ga0307510_10010555
1089 Ga0307510_10052806
1090 Ga0307510_10209592
1091 Ga0315911_1000006
1092 Ga0315911_1000010
1093 Ga0373940_0014228
1094 Ga0373952_0009842
1095 Ga0373932_0041064
1096 Ga0373945_0098173
1097 Ga0373960_0004154
1098 Ga0373943_0050055
1099 Ga0373942_0053073
1100 Ga0373961_0076659
1101 Ga0373931_0002876
1102 Ga0373931_0140751
1103 Ga0373927_0005782
1104 Ga0373927_0016306
1105 Ga0373947_0004169
1106 Ga0373947_0037380
1107 Ga0373925_0062663
1108 Ga0395905_0031525
1109 Ga0395905_0280648
1110 Ga0436365_0913976
1111 Ga0436365_0931078
1112 Ga0436365_1178230
1113 Ga0436365_1769494
1114 Ga0436360_0148226
1115 Ga0436360_0731023
1116 Ga0436360_1020232
1117 Ga0436361_0082970
1118 Ga0436361_0091951
1119 Ga0436361_0096149
1120 Ga0436361_0201274
1121 Ga0436361_0204659
1122 Ga0436361_0262026
1123 Ga0436361_0277135
1124 Ga0436361_0681104
1125 Ga0436361_0796193
1126 Ga0436361_0827273
1127 Ga0436361_1011321
1128 Ga0436361_1085489
1129 Ga0436363_0540076
1130 Ga0436362_0514368
1131 Ga0439452_033630
1132 Ga0466964_0027182
1133 Ga0466960_0055738
1134 Ga0466967_0312108
1135 Ga0495603_0006194
1136 Ga0495603_0177132
1137 Ga0495591_000251
1138 Ga0495638_0007874
1139 Ga0495641_0034815
1140 Ga0495650_0051104
1141 Ga0495580_0262535
1142 Ga0495605_0018977
1143 Ga0495605_0031954
1144 Ga0495605_0047395
1145 Ga0495605_0047792
1146 Ga0495664_0400051
1147 Ga0495584_0000007
1148 Ga0495584_0000018
1149 Ga0495584_0000901
1150 Ga0495585_0000003
1151 Ga0495585_0000264
1152 Ga0495585_0001279
1153 Ga0495585_0006146
1154 Ga0495585_0020057
1155 Ga0495596_0001236
1156 Ga0495596_0005439
1157 Ga0495596_0077643
1158 Ga0495607_0007789
1159 Ga0495607_0030451
1160 Ga0495583_0001238
1161 Ga0495583_0004255
1162 Ga0495583_0008979
1163 Ga0495583_0039461
1164 Ga0495606_0001356
1165 Ga0495606_0002146
1166 Ga0495606_0036483
1167 Ga0495606_0042940
1168 Ga0495606_0063805
1169 Ga0495616_0000228
1170 Ga0495616_0003233
1171 Ga0495616_0003675
1172 Ga0495616_0015489
1173 Ga0495616_0034720
1174 Ga0495620_0001264
1175 Ga0495630_0122386
1176 Ga0495631_0000090
1177 Ga0495632_0000681
1178 Ga0495632_0169762
1179 Ga0495643_0013974
1180 Ga0495643_0037229
1181 Ga0495643_0063433
1182 Ga0495643_0151802
1183 Ga0495648_0000171
1184 Ga0495648_0003560
1185 Ga0495648_0005173
1186 Ga0495648_0010240
1187 Ga0495648_0029940
1188 Ga0495648_0078434
1189 Ga0495648_0083356
1190 Ga0495642_0003682
1191 Ga0495654_0007039
1192 Ga0495609_0000566
1193 Ga0495609_0020794
1194 Ga0495609_0034901
1195 Ga0495609_0038300
1196 Ga0495597_0008221
1197 Ga0495622_0069563
1198 Ga0495622_0085362
1199 Ga0495633_0000702
1200 Ga0495633_0013203
1201 Ga0495633_0031351
1202 Ga0495656_0054638
1203 Ga0495668_0000094
1204 Ga0495668_0000129
1205 Ga0495668_0007639
1206 Ga0495668_0009157
1207 Ga0495668_0145382
1208 Ga0495611_0013495
1209 Ga0495611_0077769
1210 Ga0495611_0185090
1211 Ga0495625_0003017
1212 Ga0495625_0007263
1213 Ga0495625_0026997
1214 Ga0495625_0128561
1215 Ga0495659_0008109
1216 Ga0495659_0077495
1217 Ga0495661_0011409
1218 Ga0495661_0037066
1219 Ga0495661_0081364
1220 Ga0495588_0316572
1221 Ga0495669_0035469
1222 Ga0495670_0000770
1223 Ga0495671_0004568
1224 Ga0495671_0011654
1225 Ga0495671_0013199
1226 Ga0495671_0036772
1227 Ga0495671_0270782
1228 Ga0495649_0003412
1229 Ga0495649_0026960
1230 Ga0495589_0000033
1231 Ga0495660_0001774
1232 Ga0495660_0002528
1233 Ga0495660_0025127
1234 Ga0495660_0169777
1235 Ga0495674_0264219
1236 Ga0495672_0011421
1237 Ga0495672_0050386
1238 Ga0495676_0119583
1239 Ga0495683_0000083
1240 Ga0495683_0001589
1241 Ga0495683_0002730
1242 Ga0495683_0005834
1243 Ga0495683_0009551
1244 Ga0495683_0018287
1245 Ga0495683_0066995
1246 Ga0495683_0087202
1247 Ga0495683_0215841
1248 Ga0495687_000017
1249 Ga0495687_009263
1250 Ga0495687_084482
1251 Ga0495679_007526
1252 Ga0495679_043286
1253 Ga0495685_000938
1254 Ga0495685_004641
1255 Ga0495673_0003848
1256 Ga0495673_0005900
1257 Ga0495673_0028679
1258 Ga0495673_0177686
1259 Ga0495681_0005657
1260 Ga0495684_0329700
1261 Ga0495593_0044363
1262 Ga0495626_0001391
1263 Ga0496100_0021982
1264 Ga0496100_0036374
1265 Ga0496100_0151990
1266 Ga0496101_0009247
1267 Ga0496101_0242695
1268 Ga0496102_0006087
1269 Ga0496102_0006237
1270 Ga0496102_0018498
1271 Ga0496102_0210877
1272 Ga0496102_0558935
1273 Ga0496103_0038267
1274 Ga0496103_0050426
1275 Ga0496103_0094082
1276 Ga0496104_0004902
1277 Ga0496104_0048949
1278 Ga0496104_0056150
1279 Ga0496104_0083602
1280 Ga0496105_0000318
1281 Ga0496105_0009330
1282 Ga0496105_0017517
1283 Ga0496105_0038302
1284 Ga0496105_0287710
1285 Ga0496106_0016217
1286 Ga0496106_0026512
1287 Ga0496106_0039933
1288 Ga0496106_0065252
1289 Ga0496106_0298450
1290 Ga0496107_0002391
1291 Ga0496107_0003592
1292 Ga0496108_0137938
1293 Ga0496108_0429783
1294 Ga0496109_0034401
1295 Ga0496109_0060185
1296 Ga0496109_0143239
1297 Ga0496109_0165578
1298 Ga0496109_0198344
1299 Ga0496109_0258248
1300 Ga0496110_0046958
1301 Ga0496110_0123808
1302 Ga0496110_0160483
1303 Ga0496110_0319451
1304 Ga0496111_0045682
1305 Ga0496111_0078950
1306 Ga0496112_0052196
1307 Ga0496112_0138190
1308 Ga0496112_0339272
1309 Ga0496113_0003901
1310 Ga0496113_0088444
1311 Ga0496113_0191174
1312 Ga0496113_0191469
1313 Ga0496114_0017140
1314 Ga0496114_0179980
1315 Ga0496114_0557354
1316 Ga0496115_0013677
1317 Ga0496115_0073868
1318 Ga0496115_0089701
1319 Ga0496115_0095385
1320 Ga0496116_0004369
1321 Ga0496116_0105368
1322 Ga0496116_0244197
1323 Ga0496117_0002629
1324 Ga0496117_0055074
1325 Ga0496117_0094433
1326 Ga0496117_0141950
1327 Ga0496118_0000966
1328 Ga0496118_0031253
1329 Ga0496118_0044513
1330 Ga0496118_0054891
1331 Ga0496118_0104009
1332 Ga0496119_0016165
1333 Ga0496119_0023355
1334 Ga0496120_0013451
1335 Ga0496121_0002217
1336 Ga0496121_0015838
1337 Ga0496121_0137735
1338 Ga0496121_0262874
1339 Ga0496121_0317503
1340 Ga0496122_0000043
1341 Ga0496122_0000908
1342 Ga0496123_0000090
1343 Ga0496123_0000412
1344 Ga0496123_0020702
1345 Ga0496123_0096315
1346 Ga0496124_0180048
1347 Ga0496125_0000051
1348 Ga0496125_0311741
1349 Ga0496126_0007725
1350 Ga0496126_0022164
1351 Ga0496126_0143739
1352 Ga0495678_003182
1353 Ga0495682_0001062
1354 Ga0495682_0007135
1355 nmdc:mga03n38_276029_c1
1356 nmdc:mga03n38_45650_c1
1357 nmdc:mga00v17_62136_c1
1358 nmdc:mga0k408_154697_c1
1359 nmdc:mga06z11_158517_c1
1360 nmdc:mga06z11_21857_c1
1361 nmdc:mga06z11_357388_c1
1362 nmdc:mga06z11_61061_c1
1363 nmdc:mga04h51_4538_c1
1364 nmdc:mga07m45_242283_c1
1365 nmdc:mga07m45_5932_c1
1366 nmdc:mga05p37_705158_c1
1367 nmdc:mga05p37_72341_c1
1368 nmdc:mga08y16_34670_c1
1369 nmdc:mga0n895_182164_c1
1370 nmdc:mga0n895_502_c1
1371 nmdc:mga0a205_4465_c1
1372 nmdc:mga0sz30_32577_c1
1373 nmdc:mga0sz30_53526_c2
1374 nmdc:mga0sz30_84720_c1
1375 Ga0500635_0037167
1376 Ga0500643_000015
1377 Ga0500555_009621
1378 Ga0500556_0006082
1379 Ga0500556_0044133
1380 Ga0500562_003619
1381 Ga0500569_004065
1382 Ga0500592_005045
1383 Ga0500594_0020507
1384 Ga0500642_0078492
1385 Ga0500564_093306
1386 Ga0500577_0140046
1387 Ga0500616_0013901
1388 Ga0500619_036813
1389 Ga0500620_021597
1390 Ga0500622_0025216
1391 Ga0500627_0038138
1392 Ga0500633_0013380
1393 Ga0500638_052038
1394 Ga0500638_176194
1395 Ga0500636_0000206
1396 Ga0500636_0155931
1397 Ga0500637_0125989
1398 Ga0500645_016121
1399 Ga0500599_000862
1400 Ga0500601_000281
1401 Ga0500661_007848
1402 2513915899
1403 2513924695
1404 2524534551
1405 2599416248
1406 2599738877
1407 2671119212
1408 2738846719
1409 2739277623
1410 2739346692
1411 2776259366
1412 2776266308
1413 2819631450
1414 2838036372
1415 2840764674
1416 2842342157
1417 2842365867
1418 2842477436
1419 2842504232
1420 2903752999
1421 2904697780
1422 2904705941
1423 2906611517
1424 2906642441
1425 2906660748
1426 2908745101
1427 2908757123
1428 2928176080
1429 2935632226
1430 2941505716
1431 2941508174
1432 2941515321
1433 2941524104
1434 2981996562
1435 3005477550
1436 642414425
1437 8006933685
1438 8006983357
1439 8018851116
1440 8019559615
1441 8019569718
1442 8021126097

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

72

304

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.6005 14 251
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.5589 14 251
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5462 14 251
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.5191 14 251
7xq0-assembly1.cif.gz_A structure of hslc19a1+3'3'-cda 0.4053 21 252
ID Description Score Start End Superfamily
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4859 51 259 1.20.1250.20
af_Q22089_196_351_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4719 81 252 1.20.1250.20
af_Q54E81_92_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4712 51 259 1.20.1250.20
af_Q2G1R0_213_401_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4547 53 253 1.20.1250.20
af_A4IA48_423_647_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.451 52 256 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A6P2LV15-F1-model_v4 Probable membrane transporter protein 0.9604 2 261 GO:0005886
AF-A0A6P2LV15-F1-model_v4 Probable membrane transporter protein 0.9533 2 261 GO:0005886
AF-A0A1H8LSJ1-F1-model_v4 Probable membrane transporter protein 0.9105 11 226 GO:0005886
AF-A0A1Y5TKU4-F1-model_v4 Probable membrane transporter protein 0.9087 11 256 GO:0005886
AF-A0A7X6XQX7-F1-model_v4 Probable membrane transporter protein 0.8966 14 252 GO:0005886

Map