F477398
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 722 | 282 | 1444 | 371 |
Family's Representative Sequence
| Representative Sequence | 3300003784|Ga0055534_1009919|Ga0055534_10099192 |
| Length | 423 |
| Sequence | LQYEDPSFSATLVAWQKEYGRHDLPWQNTRDAYLVWLSEIMLQQTQVSAVLGYYERFLERFPTLASLAAAPVEDVMAQWAGLGYYTRARNLHKCAQRVVAEYGGVFPSDPALLAELPGIGRSTAAAIAAFSAGRRAAIMDGNVKRVFARVFGIDTYPGERKTEXAMWARAEALAPAEGIEAXTXGLMDMGATLCTRSSPSCERCPMQARCVAFATGRTAELPVRKPKKATPEKSAHMLLVVDRGQVLLEQRPASGIWGGLLSLPELAGHLAEADTPDDGAVAAAVHPFGPMESLERLLPVMHVFTHYKLHIHPLLVTLASRAALAGEGRYVWLDAAAIPDAALPAPIKKLLLDLLGERARRACSDRTQEMNSLATLNAVPITLTMLAAIAPTTHLIRRVSICAICVPIRANCISNFARSSFVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 2 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 10 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 11 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 34 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 35 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 36 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 47 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 48 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 49 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 50 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 52 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 53 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 54 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 67 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 77 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 93 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 94 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 95 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 96 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 97 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 98 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 99 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 100 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 101 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 102 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 104 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 107 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 108 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 109 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 110 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 111 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 112 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 113 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 114 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 115 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 116 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 117 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 118 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 119 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 120 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 121 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 122 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 207 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 208 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 214 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 215 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 216 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 217 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 218 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 219 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 220 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 221 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 222 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 223 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 226 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 227 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 228 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 229 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 232 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 233 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 234 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 235 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 236 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 237 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 238 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 239 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 240 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 241 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 242 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 243 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 244 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 245 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 246 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 247 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 248 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 249 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 250 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 251 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 252 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 253 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 254 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 255 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 256 | 2765235838 | Herbaspirillum robiniae AA6 | Isolate | Unclassified |
| 257 | 2808606386 | Herbaspirillum sp. SJZ099 | Isolate | Rhizosphere |
| 258 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 259 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 260 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 261 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 262 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 263 | 2839094727 | Herbaspirillum robiniae HZ10 | Isolate | Nodule |
| 264 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 265 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 266 | 2857547612 | Janthinobacterium sp. R-74502 | Isolate | Unclassified |
| 267 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 268 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 269 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 270 | 2885080285 | Janthinobacterium sp. AD80 | Isolate | Rhizosphere |
| 271 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 272 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 273 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 274 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 275 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 276 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 277 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 278 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 279 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 280 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 281 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 282 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.35 |
| Metatranscriptomes | 0.42 |
| Isolates | 6.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.48 |
| Nodule | 0.83 |
| Rhizoplane | 2.91 |
| Rhizosphere | 69.67 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055534_1009919 | 3300003784 | Bacteria | 2030 |
| 2 | JGI25158J39367_1002276 | 3300002739 | Bacteria | 3173 |
| 3 | JGI25158J39367_1006829 | 3300002739 | Bacteria | 1627 |
| 4 | JGI25152J39213_1000224 | 3300002773 | Bacteria | 38367 |
| 5 | JGI25159J45721_1003027 | 3300002987 | Bacteria | 6093 |
| 6 | JGI25151J46595_10002270 | 3300003187 | Bacteria | 11802 |
| 7 | JGI25151J46595_10004291 | 3300003187 | Bacteria | 7578 |
| 8 | JGI25165J46597_1000051 | 3300003214 | Bacteria | 241012 |
| 9 | rootL2_10029882 | 3300003322 | Bacteria | 4126 |
| 10 | rootL2_10183526 | 3300003322 | Bacteria | 3405 |
| 11 | rootH1_10075425 | 3300003323 | Bacteria | 2745 |
| 12 | JGI25161J50226_1000949 | 3300003374 | Bacteria | 10349 |
| 13 | Ga0007409J51694_1079496 | 3300003575 | Bacteria | 2071 |
| 14 | Ga0055538_1000025 | 3300003751 | Bacteria | 241012 |
| 15 | Ga0055538_1000062 | 3300003751 | Bacteria | 105260 |
| 16 | Ga0055539_1000032 | 3300003752 | Bacteria | 241012 |
| 17 | Ga0055539_1000093 | 3300003752 | Bacteria | 105260 |
| 18 | Ga0055533_1000042 | 3300003756 | Bacteria | 241012 |
| 19 | Ga0055533_1000105 | 3300003756 | Bacteria | 105260 |
| 20 | Ga0055525_1000018 | 3300003759 | Bacteria | 393974 |
| 21 | Ga0055525_1000050 | 3300003759 | Bacteria | 241012 |
| 22 | Ga0055525_1000137 | 3300003759 | Bacteria | 105260 |
| 23 | Ga0055529_1000079 | 3300003763 | Bacteria | 149370 |
| 24 | Ga0055526_1000211 | 3300003771 | Bacteria | 50334 |
| 25 | Ga0055526_1000272 | 3300003771 | Bacteria | 43827 |
| 26 | Ga0055526_1004035 | 3300003771 | Bacteria | 9023 |
| 27 | Ga0055526_1007275 | 3300003771 | Bacteria | 5797 |
| 28 | Ga0055526_1007509 | 3300003771 | Bacteria | 5648 |
| 29 | Ga0055526_1007814 | 3300003771 | Bacteria | 5473 |
| 30 | Ga0055526_1008251 | 3300003771 | Bacteria | 5231 |
| 31 | Ga0055537_1000038 | 3300003773 | Bacteria | 92762 |
| 32 | Ga0055537_1002750 | 3300003773 | Bacteria | 5689 |
| 33 | Ga0055524_1000024 | 3300003775 | Bacteria | 217953 |
| 34 | Ga0055524_1000728 | 3300003775 | Bacteria | 22579 |
| 35 | Ga0055524_1001031 | 3300003775 | Bacteria | 17211 |
| 36 | Ga0055524_1001453 | 3300003775 | Bacteria | 13555 |
| 37 | Ga0055524_1001929 | 3300003775 | Bacteria | 11171 |
| 38 | Ga0055536_1000134 | 3300003781 | Bacteria | 63257 |
| 39 | Ga0055534_1000074 | 3300003784 | Bacteria | 77272 |
| 40 | Ga0055534_1001413 | 3300003784 | Bacteria | 9578 |
| 41 | Ga0055528_1000231 | 3300003790 | Bacteria | 46568 |
| 42 | Ga0055528_1001043 | 3300003790 | Bacteria | 18281 |
| 43 | Ga0055530_10001965 | 3300003791 | Bacteria | 13987 |
| 44 | Ga0055530_10003946 | 3300003791 | Bacteria | 8028 |
| 45 | Ga0055531_10007726 | 3300003794 | Bacteria | 5805 |
| 46 | Ga0055541_1000023 | 3300003841 | Bacteria | 241012 |
| 47 | Ga0055541_1000063 | 3300003841 | Bacteria | 105260 |
| 48 | Ga0055543_1000924 | 3300004625 | Bacteria | 13678 |
| 49 | Ga0065165_1002806 | 3300005262 | Bacteria | 13678 |
| 50 | Ga0070660_100039087 | 3300005339 | Bacteria | 3605 |
| 51 | Ga0070660_100218844 | 3300005339 | Bacteria | 1547 |
| 52 | Ga0070673_100233069 | 3300005364 | Bacteria | 1598 |
| 53 | Ga0068853_100254777 | 3300005539 | Bacteria | 1612 |
| 54 | Ga0068855_100007118 | 3300005563 | Bacteria | 13571 |
| 55 | Ga0068855_100020379 | 3300005563 | Bacteria | 7954 |
| 56 | Ga0070664_100047821 | 3300005564 | Bacteria | 3615 |
| 57 | Ga0068854_100005433 | 3300005578 | Bacteria | 8045 |
| 58 | Ga0068856_100034024 | 3300005614 | Bacteria | 4991 |
| 59 | Ga0068851_10049041 | 3300005834 | Bacteria | 2141 |
| 60 | Ga0068863_100167702 | 3300005841 | Bacteria | 2106 |
| 61 | Ga0099826_10000007 | 3300006948 | Bacteria | 393518 |
| 62 | Ga0099826_10000010 | 3300006948 | Bacteria | 314346 |
| 63 | Ga0105244_10003379 | 3300009036 | Bacteria | 11424 |
| 64 | Ga0105240_10062674 | 3300009093 | Bacteria | 4628 |
| 65 | Ga0105240_10242754 | 3300009093 | Bacteria | 2087 |
| 66 | Ga0105245_10117468 | 3300009098 | Bacteria | 2481 |
| 67 | Ga0105241_10013339 | 3300009174 | Bacteria | 6023 |
| 68 | Ga0105242_10205817 | 3300009176 | Bacteria | 1750 |
| 69 | Ga0105237_10014347 | 3300009545 | Bacteria | 8291 |
| 70 | Ga0105238_10000763 | 3300009551 | Bacteria | 33477 |
| 71 | Ga0105239_10155414 | 3300010375 | Bacteria | 2554 |
| 72 | Ga0157371_10000018 | 3300013102 | Bacteria | 310522 |
| 73 | Ga0157380_10500275 | 3300014326 | Bacteria | 1180 |
| 74 | Ga0182008_10001672 | 3300014497 | Bacteria | 14588 |
| 75 | Ga0182008_10022614 | 3300014497 | Bacteria | 3219 |
| 76 | Ga0182006_1000141 | 3300015261 | Bacteria | 77478 |
| 77 | Ga0182006_1004639 | 3300015261 | Bacteria | 6734 |
| 78 | Ga0182006_1036812 | 3300015261 | Bacteria | 1944 |
| 79 | Ga0182007_10000144 | 3300015262 | Bacteria | 47717 |
| 80 | Ga0182007_10005958 | 3300015262 | Bacteria | 5289 |
| 81 | Ga0182005_1000016 | 3300015265 | Bacteria | 346889 |
| 82 | Ga0182005_1000024 | 3300015265 | Bacteria | 238256 |
| 83 | Ga0163161_10114153 | 3300017792 | Bacteria | 2023 |
| 84 | Ga0213872_10000005 | 3300021361 | Bacteria | 290165 |
| 85 | Ga0213872_10004614 | 3300021361 | Bacteria | 7263 |
| 86 | Ga0213872_10019006 | 3300021361 | Bacteria | 3165 |
| 87 | Ga0213872_10025486 | 3300021361 | Bacteria | 2718 |
| 88 | Ga0209760_103617 | 3300025207 | Bacteria | 1364 |
| 89 | Ga0209436_100797 | 3300025208 | Bacteria | 12952 |
| 90 | Ga0209784_100010 | 3300025224 | Bacteria | 683664 |
| 91 | Ga0209784_100021 | 3300025224 | Bacteria | 408534 |
| 92 | Ga0209566_100008 | 3300025225 | Bacteria | 683664 |
| 93 | Ga0209566_100119 | 3300025225 | Bacteria | 105312 |
| 94 | Ga0209674_100019 | 3300025226 | Bacteria | 683664 |
| 95 | Ga0209674_100036 | 3300025226 | Bacteria | 408534 |
| 96 | Ga0209563_100011 | 3300025230 | Bacteria | 1187808 |
| 97 | Ga0209563_100021 | 3300025230 | Bacteria | 683764 |
| 98 | Ga0209563_100040 | 3300025230 | Bacteria | 408534 |
| 99 | Ga0207427_100596 | 3300025231 | Bacteria | 18082 |
| 100 | Ga0209437_100019 | 3300025233 | Bacteria | 683764 |
| 101 | Ga0209437_100332 | 3300025233 | Bacteria | 58796 |
| 102 | Ga0207425_1000021 | 3300025245 | Bacteria | 367537 |
| 103 | Ga0207425_1000223 | 3300025245 | Bacteria | 44555 |
| 104 | Ga0207425_1000640 | 3300025245 | Bacteria | 19664 |
| 105 | Ga0209646_1000068 | 3300025246 | Bacteria | 233765 |
| 106 | Ga0209026_1002283 | 3300025250 | Bacteria | 7326 |
| 107 | Ga0209677_100011 | 3300025253 | Bacteria | 683664 |
| 108 | Ga0209677_100023 | 3300025253 | Bacteria | 408534 |
| 109 | Ga0209677_104408 | 3300025253 | Bacteria | 4074 |
| 110 | Ga0209129_1000020 | 3300025258 | Bacteria | 457053 |
| 111 | Ga0209129_1004859 | 3300025258 | Bacteria | 5038 |
| 112 | Ga0209233_1000025 | 3300025261 | Bacteria | 683764 |
| 113 | Ga0209565_1000104 | 3300025263 | Bacteria | 124432 |
| 114 | Ga0209565_1000123 | 3300025263 | Bacteria | 111069 |
| 115 | Ga0209565_1001864 | 3300025263 | Bacteria | 8419 |
| 116 | Ga0209565_1002627 | 3300025263 | Bacteria | 6341 |
| 117 | Ga0209565_1008102 | 3300025263 | Bacteria | 2776 |
| 118 | Ga0209455_1000070 | 3300025272 | Bacteria | 307867 |
| 119 | Ga0209673_1000040 | 3300025273 | Bacteria | 312633 |
| 120 | Ga0209130_1001646 | 3300025284 | Bacteria | 13692 |
| 121 | Ga0209130_1002608 | 3300025284 | Bacteria | 8713 |
| 122 | Ga0209675_1000117 | 3300025291 | Bacteria | 111087 |
| 123 | Ga0209675_1001657 | 3300025291 | Bacteria | 12392 |
| 124 | Ga0209675_1002531 | 3300025291 | Bacteria | 9301 |
| 125 | Ga0209675_1022431 | 3300025291 | Bacteria | 1659 |
| 126 | Ga0209676_1000036 | 3300025292 | Bacteria | 457623 |
| 127 | Ga0209025_1001884 | 3300025294 | Bacteria | 24520 |
| 128 | Ga0209025_1002014 | 3300025294 | Bacteria | 23186 |
| 129 | Ga0209025_1003834 | 3300025294 | Bacteria | 13691 |
| 130 | Ga0209025_1018501 | 3300025294 | Bacteria | 3940 |
| 131 | Ga0209564_1000027 | 3300025295 | Bacteria | 518458 |
| 132 | Ga0209564_1000047 | 3300025295 | Bacteria | 368031 |
| 133 | Ga0209564_1000121 | 3300025295 | Bacteria | 204081 |
| 134 | Ga0209564_1000780 | 3300025295 | Bacteria | 44199 |
| 135 | Ga0209564_1001065 | 3300025295 | Bacteria | 33211 |
| 136 | Ga0209564_1001271 | 3300025295 | Bacteria | 27762 |
| 137 | Ga0209564_1002491 | 3300025295 | Bacteria | 14365 |
| 138 | Ga0209564_1002959 | 3300025295 | Bacteria | 12247 |
| 139 | Ga0209758_1000077 | 3300025297 | Bacteria | 268195 |
| 140 | Ga0209758_1000322 | 3300025297 | Bacteria | 92458 |
| 141 | Ga0209758_1006210 | 3300025297 | Bacteria | 8726 |
| 142 | Ga0209050_1000050 | 3300025298 | Bacteria | 362578 |
| 143 | Ga0209050_1000795 | 3300025298 | Bacteria | 44648 |
| 144 | Ga0209256_1000054 | 3300025299 | Bacteria | 298431 |
| 145 | Ga0209256_1000287 | 3300025299 | Bacteria | 88526 |
| 146 | Ga0209256_1000288 | 3300025299 | Bacteria | 88470 |
| 147 | Ga0209256_1000543 | 3300025299 | Bacteria | 54373 |
| 148 | Ga0209256_1000674 | 3300025299 | Bacteria | 46225 |
| 149 | Ga0209256_1001001 | 3300025299 | Bacteria | 33573 |
| 150 | Ga0209256_1002870 | 3300025299 | Bacteria | 13096 |
| 151 | Ga0209256_1003939 | 3300025299 | Bacteria | 9768 |
| 152 | Ga0207426_1001270 | 3300025302 | Bacteria | 22014 |
| 153 | Ga0209257_1000075 | 3300025304 | Bacteria | 324855 |
| 154 | Ga0209257_1007416 | 3300025304 | Bacteria | 6628 |
| 155 | Ga0207655_1000710 | 3300025728 | Bacteria | 38274 |
| 156 | Ga0207655_1008685 | 3300025728 | Bacteria | 6412 |
| 157 | Ga0207654_10008046 | 3300025911 | Bacteria | 5314 |
| 158 | Ga0207695_10002760 | 3300025913 | Bacteria | 25592 |
| 159 | Ga0207671_10006962 | 3300025914 | Bacteria | 9936 |
| 160 | Ga0207657_10027747 | 3300025919 | Bacteria | 5179 |
| 161 | Ga0207694_10000343 | 3300025924 | Bacteria | 44142 |
| 162 | Ga0207706_10215656 | 3300025933 | Bacteria | 1681 |
| 163 | Ga0207686_10075326 | 3300025934 | Bacteria | 2184 |
| 164 | Ga0207689_10188798 | 3300025942 | Bacteria | 1700 |
| 165 | Ga0207667_10000912 | 3300025949 | Bacteria | 37632 |
| 166 | Ga0207640_10014951 | 3300025981 | Bacteria | 4480 |
| 167 | Ga0207640_10206951 | 3300025981 | Bacteria | 1491 |
| 168 | Ga0207678_10339963 | 3300026067 | Bacteria | 1293 |
| 169 | Ga0207702_10032111 | 3300026078 | Bacteria | 4381 |
| 170 | Ga0207702_10094471 | 3300026078 | Bacteria | 2625 |
| 171 | Ga0209281_1005795 | 3300027111 | Bacteria | 3338 |
| 172 | Ga0209282_1000021 | 3300027666 | Bacteria | 177705 |
| 173 | Ga0209282_1000072 | 3300027666 | Bacteria | 81137 |
| 174 | Ga0316181_1091467 | 3300030744 | Bacteria | 2915 |
| 175 | Ga0307408_100000531 | 3300031548 | Bacteria | 32967 |
| 176 | Ga0307408_100002211 | 3300031548 | Bacteria | 13890 |
| 177 | Ga0307408_100004170 | 3300031548 | Bacteria | 9847 |
| 178 | Ga0307408_100005814 | 3300031548 | Bacteria | 8206 |
| 179 | Ga0316576_10003778 | 3300031727 | Bacteria | 8949 |
| 180 | Ga0316578_10052312 | 3300031728 | Bacteria | 2393 |
| 181 | Ga0307518_10111354 | 3300031838 | Bacteria | 1950 |
| 182 | Ga0307411_10162416 | 3300032005 | Bacteria | 1675 |
| 183 | Ga0316583_10011958 | 3300032133 | Bacteria | 3132 |
| 184 | Ga0316593_10005972 | 3300032168 | Bacteria | 3256 |
| 185 | Ga0316588_1000267 | 3300033528 | Bacteria | 6412 |
| 186 | Ga0373931_0060346 | 3300035691 | Bacteria | 2041 |
| 187 | Ga0395899_0000386 | 3300037312 | Bacteria | 52584 |
| 188 | Ga0395899_0010874 | 3300037312 | Bacteria | 6974 |
| 189 | Ga0395899_0011797 | 3300037312 | Bacteria | 6687 |
| 190 | Ga0395900_0000321 | 3300037418 | Bacteria | 71088 |
| 191 | Ga0395900_0007976 | 3300037418 | Bacteria | 10896 |
| 192 | Ga0395900_0066996 | 3300037418 | Bacteria | 3689 |
| 193 | Ga0395905_0018554 | 3300037471 | Bacteria | 6602 |
| 194 | Ga0395901_0000187 | 3300038443 | Bacteria | 79696 |
| 195 | Ga0395901_0131972 | 3300038443 | Bacteria | 2625 |
| 196 | Ga0395901_0314752 | 3300038443 | Bacteria | 1620 |
| 197 | Ga0395901_0441198 | 3300038443 | Bacteria | 1332 |
| 198 | Ga0436361_0145169 | 3300039447 | Bacteria | 14273 |
| 199 | Ga0436361_0235534 | 3300039447 | Bacteria | 12344 |
| 200 | Ga0436361_0240080 | 3300039447 | Bacteria | 4429 |
| 201 | Ga0436361_0252850 | 3300039447 | Bacteria | 2993 |
| 202 | Ga0436361_0820978 | 3300039447 | Bacteria | 73779 |
| 203 | Ga0436361_0977423 | 3300039447 | Bacteria | 2265 |
| 204 | Ga0436361_1067374 | 3300039447 | Bacteria | 3776 |
| 205 | Ga0436361_1218785 | 3300039447 | Bacteria | 111760 |
| 206 | Ga0439455_0003129 | 3300042012 | Bacteria | 3118 |
| 207 | Ga0450904_002589 | 3300042139 | Bacteria | 2107 |
| 208 | Ga0439458_0017629 | 3300042157 | Bacteria | 1632 |
| 209 | Ga0466969_0007789 | 3300044656 | Bacteria | 5693 |
| 210 | Ga0466982_0082226 | 3300044672 | Bacteria | 1995 |
| 211 | Ga0466965_0000671 | 3300044683 | Bacteria | 12580 |
| 212 | Ga0466965_0046171 | 3300044683 | Bacteria | 2155 |
| 213 | Ga0466966_0037526 | 3300044684 | Bacteria | 3124 |
| 214 | Ga0466966_0102541 | 3300044684 | Bacteria | 1768 |
| 215 | Ga0466964_0011002 | 3300044706 | Bacteria | 3417 |
| 216 | Ga0466964_0017789 | 3300044706 | Bacteria | 2723 |
| 217 | Ga0466964_0021221 | 3300044706 | Bacteria | 2510 |
| 218 | Ga0466968_0000456 | 3300044735 | Bacteria | 13782 |
| 219 | Ga0466968_0004653 | 3300044735 | Bacteria | 5135 |
| 220 | Ga0466968_0036872 | 3300044735 | Bacteria | 2049 |
| 221 | Ga0466970_0052782 | 3300044765 | Bacteria | 2170 |
| 222 | Ga0466957_0004109 | 3300044842 | Bacteria | 8065 |
| 223 | Ga0466957_0010939 | 3300044842 | Bacteria | 5218 |
| 224 | Ga0466957_0058623 | 3300044842 | Bacteria | 2359 |
| 225 | Ga0466957_0167320 | 3300044842 | Bacteria | 1430 |
| 226 | Ga0466957_0218924 | 3300044842 | Bacteria | 1256 |
| 227 | Ga0466959_0020062 | 3300045049 | Bacteria | 4920 |
| 228 | Ga0466958_0028973 | 3300045836 | Bacteria | 3285 |
| 229 | Ga0495617_000245 | 3300046452 | Bacteria | 32248 |
| 230 | Ga0495617_001194 | 3300046452 | Bacteria | 11688 |
| 231 | Ga0495617_001502 | 3300046452 | Bacteria | 10168 |
| 232 | Ga0495617_005346 | 3300046452 | Bacteria | 4563 |
| 233 | Ga0495627_011269 | 3300046453 | Bacteria | 3212 |
| 234 | Ga0495603_0128606 | 3300046455 | Bacteria | 1475 |
| 235 | Ga0495590_0000020 | 3300046457 | Bacteria | 212352 |
| 236 | Ga0495590_0000595 | 3300046457 | Bacteria | 17060 |
| 237 | Ga0495590_0005786 | 3300046457 | Bacteria | 4857 |
| 238 | Ga0495590_0014851 | 3300046457 | Bacteria | 2838 |
| 239 | Ga0495590_0041314 | 3300046457 | Bacteria | 1608 |
| 240 | Ga0495629_0011085 | 3300046459 | Bacteria | 6549 |
| 241 | Ga0495638_0000235 | 3300046460 | Bacteria | 75760 |
| 242 | Ga0495638_0001049 | 3300046460 | Bacteria | 27280 |
| 243 | Ga0495638_0005988 | 3300046460 | Bacteria | 8916 |
| 244 | Ga0495638_0067899 | 3300046460 | Bacteria | 2188 |
| 245 | Ga0495638_0108844 | 3300046460 | Bacteria | 1648 |
| 246 | Ga0495651_0159788 | 3300046462 | Bacteria | 1615 |
| 247 | Ga0495653_0000067 | 3300046463 | Bacteria | 90116 |
| 248 | Ga0495653_0051408 | 3300046463 | Bacteria | 3164 |
| 249 | Ga0495653_0214620 | 3300046463 | Bacteria | 1297 |
| 250 | Ga0495653_0227246 | 3300046463 | Bacteria | 1251 |
| 251 | Ga0495650_0000200 | 3300046471 | Bacteria | 130223 |
| 252 | Ga0495650_0000251 | 3300046471 | Bacteria | 105577 |
| 253 | Ga0495650_0000436 | 3300046471 | Bacteria | 67167 |
| 254 | Ga0495650_0000483 | 3300046471 | Bacteria | 60911 |
| 255 | Ga0495650_0000864 | 3300046471 | Bacteria | 36231 |
| 256 | Ga0495650_0005399 | 3300046471 | Bacteria | 8311 |
| 257 | Ga0495650_0005880 | 3300046471 | Bacteria | 7802 |
| 258 | Ga0495582_0059028 | 3300046473 | Bacteria | 2116 |
| 259 | Ga0495605_0000061 | 3300046474 | Bacteria | 145286 |
| 260 | Ga0495605_0003908 | 3300046474 | Bacteria | 8830 |
| 261 | Ga0495605_0010641 | 3300046474 | Bacteria | 5142 |
| 262 | Ga0495605_0016281 | 3300046474 | Bacteria | 4027 |
| 263 | Ga0495605_0065541 | 3300046474 | Bacteria | 1727 |
| 264 | Ga0495605_0066502 | 3300046474 | Bacteria | 1712 |
| 265 | Ga0495605_0068379 | 3300046474 | Bacteria | 1683 |
| 266 | Ga0495639_0025159 | 3300046475 | Bacteria | 2624 |
| 267 | Ga0495584_0000005 | 3300046491 | Bacteria | 306957 |
| 268 | Ga0495584_0000308 | 3300046491 | Bacteria | 34325 |
| 269 | Ga0495584_0007872 | 3300046491 | Bacteria | 5542 |
| 270 | Ga0495584_0017557 | 3300046491 | Bacteria | 3640 |
| 271 | Ga0495584_0027118 | 3300046491 | Bacteria | 2903 |
| 272 | Ga0495584_0041240 | 3300046491 | Bacteria | 2330 |
| 273 | Ga0495584_0078477 | 3300046491 | Bacteria | 1661 |
| 274 | Ga0495585_0001291 | 3300046492 | Bacteria | 19967 |
| 275 | Ga0495585_0002222 | 3300046492 | Bacteria | 14064 |
| 276 | Ga0495585_0003470 | 3300046492 | Bacteria | 10645 |
| 277 | Ga0495585_0004078 | 3300046492 | Bacteria | 9593 |
| 278 | Ga0495585_0011431 | 3300046492 | Bacteria | 5252 |
| 279 | Ga0495585_0012559 | 3300046492 | Bacteria | 4989 |
| 280 | Ga0495585_0014579 | 3300046492 | Bacteria | 4574 |
| 281 | Ga0495585_0014717 | 3300046492 | Bacteria | 4551 |
| 282 | Ga0495585_0019383 | 3300046492 | Bacteria | 3922 |
| 283 | Ga0495585_0032392 | 3300046492 | Bacteria | 2960 |
| 284 | Ga0495585_0050534 | 3300046492 | Bacteria | 2306 |
| 285 | Ga0495585_0070352 | 3300046492 | Bacteria | 1909 |
| 286 | Ga0495585_0103435 | 3300046492 | Bacteria | 1521 |
| 287 | Ga0495594_0030447 | 3300046499 | Bacteria | 2920 |
| 288 | Ga0495594_0046406 | 3300046499 | Bacteria | 2386 |
| 289 | Ga0495594_0063373 | 3300046499 | Bacteria | 2048 |
| 290 | Ga0495594_0074022 | 3300046499 | Bacteria | 1897 |
| 291 | Ga0495596_0000299 | 3300046500 | Bacteria | 32765 |
| 292 | Ga0495596_0000435 | 3300046500 | Bacteria | 26782 |
| 293 | Ga0495596_0000500 | 3300046500 | Bacteria | 24891 |
| 294 | Ga0495596_0001709 | 3300046500 | Bacteria | 12348 |
| 295 | Ga0495596_0002826 | 3300046500 | Bacteria | 9071 |
| 296 | Ga0495596_0010550 | 3300046500 | Bacteria | 4019 |
| 297 | Ga0495596_0012169 | 3300046500 | Bacteria | 3689 |
| 298 | Ga0495596_0025399 | 3300046500 | Bacteria | 2394 |
| 299 | Ga0495596_0082821 | 3300046500 | Bacteria | 1245 |
| 300 | Ga0495607_0000514 | 3300046501 | Bacteria | 38263 |
| 301 | Ga0495607_0006228 | 3300046501 | Bacteria | 8414 |
| 302 | Ga0495607_0008009 | 3300046501 | Bacteria | 7258 |
| 303 | Ga0495607_0010458 | 3300046501 | Bacteria | 6237 |
| 304 | Ga0495607_0016220 | 3300046501 | Bacteria | 4810 |
| 305 | Ga0495607_0019852 | 3300046501 | Bacteria | 4261 |
| 306 | Ga0495607_0044523 | 3300046501 | Bacteria | 2617 |
| 307 | Ga0495607_0048199 | 3300046501 | Bacteria | 2492 |
| 308 | Ga0495607_0056988 | 3300046501 | Bacteria | 2241 |
| 309 | Ga0495583_0000158 | 3300046506 | Bacteria | 113645 |
| 310 | Ga0495583_0000214 | 3300046506 | Bacteria | 97639 |
| 311 | Ga0495583_0000317 | 3300046506 | Bacteria | 76193 |
| 312 | Ga0495583_0000817 | 3300046506 | Bacteria | 38095 |
| 313 | Ga0495583_0002937 | 3300046506 | Bacteria | 13735 |
| 314 | Ga0495583_0004418 | 3300046506 | Bacteria | 10070 |
| 315 | Ga0495583_0004541 | 3300046506 | Bacteria | 9872 |
| 316 | Ga0495583_0004572 | 3300046506 | Bacteria | 9824 |
| 317 | Ga0495583_0009922 | 3300046506 | Bacteria | 5629 |
| 318 | Ga0495583_0035926 | 3300046506 | Bacteria | 2360 |
| 319 | Ga0495583_0040199 | 3300046506 | Bacteria | 2198 |
| 320 | Ga0495583_0041718 | 3300046506 | Bacteria | 2147 |
| 321 | Ga0495583_0070235 | 3300046506 | Bacteria | 1540 |
| 322 | Ga0495583_0104038 | 3300046506 | Bacteria | 1209 |
| 323 | Ga0495606_0000120 | 3300046507 | Bacteria | 133907 |
| 324 | Ga0495606_0000262 | 3300046507 | Bacteria | 92896 |
| 325 | Ga0495606_0000433 | 3300046507 | Bacteria | 69506 |
| 326 | Ga0495606_0003347 | 3300046507 | Bacteria | 17098 |
| 327 | Ga0495606_0003359 | 3300046507 | Bacteria | 17058 |
| 328 | Ga0495606_0005585 | 3300046507 | Bacteria | 11970 |
| 329 | Ga0495606_0007912 | 3300046507 | Bacteria | 9374 |
| 330 | Ga0495606_0008104 | 3300046507 | Bacteria | 9212 |
| 331 | Ga0495606_0008155 | 3300046507 | Bacteria | 9172 |
| 332 | Ga0495606_0024893 | 3300046507 | Bacteria | 4301 |
| 333 | Ga0495606_0032534 | 3300046507 | Bacteria | 3611 |
| 334 | Ga0495606_0047463 | 3300046507 | Bacteria | 2830 |
| 335 | Ga0495608_0001440 | 3300046511 | Bacteria | 16905 |
| 336 | Ga0495608_0010752 | 3300046511 | Bacteria | 6380 |
| 337 | Ga0495610_0000017 | 3300046512 | Bacteria | 365675 |
| 338 | Ga0495610_0005990 | 3300046512 | Bacteria | 8501 |
| 339 | Ga0495610_0006236 | 3300046512 | Bacteria | 8265 |
| 340 | Ga0495610_0010999 | 3300046512 | Bacteria | 5569 |
| 341 | Ga0495610_0016874 | 3300046512 | Bacteria | 4183 |
| 342 | Ga0495610_0019833 | 3300046512 | Bacteria | 3750 |
| 343 | Ga0495610_0029250 | 3300046512 | Bacteria | 2904 |
| 344 | Ga0495616_0000968 | 3300046513 | Bacteria | 20583 |
| 345 | Ga0495616_0003646 | 3300046513 | Bacteria | 9834 |
| 346 | Ga0495616_0004117 | 3300046513 | Bacteria | 9224 |
| 347 | Ga0495616_0008053 | 3300046513 | Bacteria | 6276 |
| 348 | Ga0495616_0012210 | 3300046513 | Bacteria | 4886 |
| 349 | Ga0495616_0014213 | 3300046513 | Bacteria | 4465 |
| 350 | Ga0495616_0019686 | 3300046513 | Bacteria | 3680 |
| 351 | Ga0495616_0020246 | 3300046513 | Bacteria | 3622 |
| 352 | Ga0495616_0044097 | 3300046513 | Bacteria | 2263 |
| 353 | Ga0495616_0111038 | 3300046513 | Bacteria | 1273 |
| 354 | Ga0495618_0005745 | 3300046514 | Bacteria | 7539 |
| 355 | Ga0495620_0001878 | 3300046515 | Bacteria | 12352 |
| 356 | Ga0495628_0002346 | 3300046516 | Bacteria | 17099 |
| 357 | Ga0495631_0002979 | 3300046518 | Bacteria | 9370 |
| 358 | Ga0495631_0004446 | 3300046518 | Bacteria | 7465 |
| 359 | Ga0495631_0014038 | 3300046518 | Bacteria | 3871 |
| 360 | Ga0495631_0015576 | 3300046518 | Bacteria | 3639 |
| 361 | Ga0495631_0052150 | 3300046518 | Bacteria | 1786 |
| 362 | Ga0495631_0059700 | 3300046518 | Bacteria | 1656 |
| 363 | Ga0495631_0062941 | 3300046518 | Bacteria | 1607 |
| 364 | Ga0495632_0002504 | 3300046519 | Bacteria | 13934 |
| 365 | Ga0495632_0006166 | 3300046519 | Bacteria | 7766 |
| 366 | Ga0495632_0028547 | 3300046519 | Bacteria | 2911 |
| 367 | Ga0495637_0000179 | 3300046520 | Bacteria | 49260 |
| 368 | Ga0495637_0002381 | 3300046520 | Bacteria | 10416 |
| 369 | Ga0495637_0057767 | 3300046520 | Bacteria | 1601 |
| 370 | Ga0495643_0001515 | 3300046522 | Bacteria | 20976 |
| 371 | Ga0495643_0003833 | 3300046522 | Bacteria | 10843 |
| 372 | Ga0495643_0004577 | 3300046522 | Bacteria | 9629 |
| 373 | Ga0495643_0008786 | 3300046522 | Bacteria | 6365 |
| 374 | Ga0495643_0022557 | 3300046522 | Bacteria | 3591 |
| 375 | Ga0495643_0022831 | 3300046522 | Bacteria | 3563 |
| 376 | Ga0495643_0091662 | 3300046522 | Bacteria | 1567 |
| 377 | Ga0495643_0111783 | 3300046522 | Bacteria | 1388 |
| 378 | Ga0495644_0001273 | 3300046523 | Bacteria | 10323 |
| 379 | Ga0495644_0002046 | 3300046523 | Bacteria | 8130 |
| 380 | Ga0495644_0010549 | 3300046523 | Bacteria | 3559 |
| 381 | Ga0495644_0038991 | 3300046523 | Bacteria | 1791 |
| 382 | Ga0495648_0000183 | 3300046524 | Bacteria | 72118 |
| 383 | Ga0495648_0000350 | 3300046524 | Bacteria | 50788 |
| 384 | Ga0495648_0004377 | 3300046524 | Bacteria | 12086 |
| 385 | Ga0495648_0006400 | 3300046524 | Bacteria | 9621 |
| 386 | Ga0495648_0008929 | 3300046524 | Bacteria | 7834 |
| 387 | Ga0495648_0010395 | 3300046524 | Bacteria | 7091 |
| 388 | Ga0495648_0011915 | 3300046524 | Bacteria | 6523 |
| 389 | Ga0495648_0016470 | 3300046524 | Bacteria | 5330 |
| 390 | Ga0495648_0019269 | 3300046524 | Bacteria | 4804 |
| 391 | Ga0495648_0026508 | 3300046524 | Bacteria | 3899 |
| 392 | Ga0495648_0045451 | 3300046524 | Bacteria | 2731 |
| 393 | Ga0495648_0096526 | 3300046524 | Bacteria | 1642 |
| 394 | Ga0495648_0108041 | 3300046524 | Bacteria | 1520 |
| 395 | Ga0495663_0017336 | 3300046525 | Bacteria | 2043 |
| 396 | Ga0495666_0002304 | 3300046526 | Bacteria | 9519 |
| 397 | Ga0495666_0003839 | 3300046526 | Bacteria | 7601 |
| 398 | Ga0495666_0027086 | 3300046526 | Bacteria | 2822 |
| 399 | Ga0495642_0001394 | 3300046528 | Bacteria | 10821 |
| 400 | Ga0495642_0002375 | 3300046528 | Bacteria | 7674 |
| 401 | Ga0495642_0008501 | 3300046528 | Bacteria | 3927 |
| 402 | Ga0495642_0008897 | 3300046528 | Bacteria | 3842 |
| 403 | Ga0495642_0011049 | 3300046528 | Bacteria | 3462 |
| 404 | Ga0495642_0013848 | 3300046528 | Bacteria | 3123 |
| 405 | Ga0495642_0021316 | 3300046528 | Bacteria | 2549 |
| 406 | Ga0495642_0031048 | 3300046528 | Bacteria | 2141 |
| 407 | Ga0495642_0096715 | 3300046528 | Bacteria | 1253 |
| 408 | Ga0495652_0034764 | 3300046529 | Bacteria | 4391 |
| 409 | Ga0495654_0000060 | 3300046530 | Bacteria | 134307 |
| 410 | Ga0495654_0001159 | 3300046530 | Bacteria | 18844 |
| 411 | Ga0495654_0005774 | 3300046530 | Bacteria | 7133 |
| 412 | Ga0495654_0016211 | 3300046530 | Bacteria | 3943 |
| 413 | Ga0495665_0015384 | 3300046531 | Bacteria | 4120 |
| 414 | Ga0495587_0028066 | 3300046536 | Bacteria | 3427 |
| 415 | Ga0495587_0071587 | 3300046536 | Bacteria | 2016 |
| 416 | Ga0495609_0000314 | 3300046538 | Bacteria | 43536 |
| 417 | Ga0495609_0001512 | 3300046538 | Bacteria | 15329 |
| 418 | Ga0495609_0001993 | 3300046538 | Bacteria | 12904 |
| 419 | Ga0495609_0003500 | 3300046538 | Bacteria | 8974 |
| 420 | Ga0495609_0004793 | 3300046538 | Bacteria | 7298 |
| 421 | Ga0495609_0006945 | 3300046538 | Bacteria | 5714 |
| 422 | Ga0495609_0010694 | 3300046538 | Bacteria | 4391 |
| 423 | Ga0495609_0014295 | 3300046538 | Bacteria | 3735 |
| 424 | Ga0495609_0014512 | 3300046538 | Bacteria | 3701 |
| 425 | Ga0495597_0001017 | 3300046542 | Bacteria | 21453 |
| 426 | Ga0495597_0001024 | 3300046542 | Bacteria | 21396 |
| 427 | Ga0495597_0001027 | 3300046542 | Bacteria | 21345 |
| 428 | Ga0495597_0002718 | 3300046542 | Bacteria | 10912 |
| 429 | Ga0495597_0003136 | 3300046542 | Bacteria | 9898 |
| 430 | Ga0495597_0003813 | 3300046542 | Bacteria | 8572 |
| 431 | Ga0495597_0012946 | 3300046542 | Bacteria | 4005 |
| 432 | Ga0495597_0020801 | 3300046542 | Bacteria | 3053 |
| 433 | Ga0495597_0021173 | 3300046542 | Bacteria | 3024 |
| 434 | Ga0495597_0023809 | 3300046542 | Bacteria | 2830 |
| 435 | Ga0495645_0058669 | 3300046543 | Bacteria | 2792 |
| 436 | Ga0495622_0000488 | 3300046557 | Bacteria | 24999 |
| 437 | Ga0495622_0001922 | 3300046557 | Bacteria | 10209 |
| 438 | Ga0495622_0013368 | 3300046557 | Bacteria | 3807 |
| 439 | Ga0495622_0017669 | 3300046557 | Bacteria | 3320 |
| 440 | Ga0495633_0003504 | 3300046558 | Bacteria | 10412 |
| 441 | Ga0495633_0003677 | 3300046558 | Bacteria | 10131 |
| 442 | Ga0495633_0004606 | 3300046558 | Bacteria | 8688 |
| 443 | Ga0495633_0005099 | 3300046558 | Bacteria | 8156 |
| 444 | Ga0495633_0008760 | 3300046558 | Bacteria | 5663 |
| 445 | Ga0495633_0010011 | 3300046558 | Bacteria | 5201 |
| 446 | Ga0495633_0015948 | 3300046558 | Bacteria | 3887 |
| 447 | Ga0495633_0018108 | 3300046558 | Bacteria | 3582 |
| 448 | Ga0495633_0040530 | 3300046558 | Bacteria | 2218 |
| 449 | Ga0495633_0042766 | 3300046558 | Bacteria | 2150 |
| 450 | Ga0495633_0048390 | 3300046558 | Bacteria | 2007 |
| 451 | Ga0495656_0008532 | 3300046615 | Bacteria | 3660 |
| 452 | Ga0495668_0000162 | 3300046616 | Bacteria | 101114 |
| 453 | Ga0495668_0000427 | 3300046616 | Bacteria | 54797 |
| 454 | Ga0495668_0002105 | 3300046616 | Bacteria | 17216 |
| 455 | Ga0495668_0002232 | 3300046616 | Bacteria | 16406 |
| 456 | Ga0495668_0004696 | 3300046616 | Bacteria | 9580 |
| 457 | Ga0495668_0007960 | 3300046616 | Bacteria | 6684 |
| 458 | Ga0495668_0011146 | 3300046616 | Bacteria | 5400 |
| 459 | Ga0495668_0031864 | 3300046616 | Bacteria | 2969 |
| 460 | Ga0495668_0039173 | 3300046616 | Bacteria | 2647 |
| 461 | Ga0495611_0002762 | 3300046648 | Bacteria | 7876 |
| 462 | Ga0495611_0003285 | 3300046648 | Bacteria | 7149 |
| 463 | Ga0495611_0006211 | 3300046648 | Bacteria | 5098 |
| 464 | Ga0495625_0001192 | 3300046660 | Bacteria | 33259 |
| 465 | Ga0495625_0007112 | 3300046660 | Bacteria | 9829 |
| 466 | Ga0495625_0012748 | 3300046660 | Bacteria | 6799 |
| 467 | Ga0495625_0016783 | 3300046660 | Bacteria | 5751 |
| 468 | Ga0495625_0032343 | 3300046660 | Bacteria | 3880 |
| 469 | Ga0495625_0040242 | 3300046660 | Bacteria | 3410 |
| 470 | Ga0495625_0148623 | 3300046660 | Bacteria | 1576 |
| 471 | Ga0495625_0151161 | 3300046660 | Bacteria | 1561 |
| 472 | Ga0495659_0000127 | 3300046664 | Bacteria | 33507 |
| 473 | Ga0495659_0000721 | 3300046664 | Bacteria | 11881 |
| 474 | Ga0495659_0003375 | 3300046664 | Bacteria | 5118 |
| 475 | Ga0495661_0000490 | 3300046665 | Bacteria | 41412 |
| 476 | Ga0495661_0002987 | 3300046665 | Bacteria | 12747 |
| 477 | Ga0495661_0003261 | 3300046665 | Bacteria | 12063 |
| 478 | Ga0495661_0008306 | 3300046665 | Bacteria | 7192 |
| 479 | Ga0495661_0016109 | 3300046665 | Bacteria | 4966 |
| 480 | Ga0495661_0020630 | 3300046665 | Bacteria | 4299 |
| 481 | Ga0495661_0022899 | 3300046665 | Bacteria | 4060 |
| 482 | Ga0495661_0026903 | 3300046665 | Bacteria | 3699 |
| 483 | Ga0495661_0059339 | 3300046665 | Bacteria | 2277 |
| 484 | Ga0495661_0069284 | 3300046665 | Bacteria | 2067 |
| 485 | Ga0495661_0076269 | 3300046665 | Bacteria | 1945 |
| 486 | Ga0495661_0080054 | 3300046665 | Bacteria | 1886 |
| 487 | Ga0495661_0101486 | 3300046665 | Bacteria | 1618 |
| 488 | Ga0495588_0000199 | 3300046674 | Bacteria | 60892 |
| 489 | Ga0495599_0001957 | 3300046678 | Bacteria | 11933 |
| 490 | Ga0495623_0004092 | 3300046679 | Bacteria | 9608 |
| 491 | Ga0495646_0003630 | 3300046680 | Bacteria | 9627 |
| 492 | Ga0495669_0000844 | 3300046684 | Bacteria | 13033 |
| 493 | Ga0495669_0001832 | 3300046684 | Bacteria | 8697 |
| 494 | Ga0495669_0004619 | 3300046684 | Bacteria | 5705 |
| 495 | Ga0495669_0015545 | 3300046684 | Bacteria | 3259 |
| 496 | Ga0495669_0042112 | 3300046684 | Bacteria | 2029 |
| 497 | Ga0495669_0062005 | 3300046684 | Bacteria | 1693 |
| 498 | Ga0495613_0124142 | 3300046689 | Bacteria | 1852 |
| 499 | Ga0495624_0007612 | 3300046690 | Bacteria | 7602 |
| 500 | Ga0495624_0035957 | 3300046690 | Bacteria | 3195 |
| 501 | Ga0495670_0000952 | 3300046691 | Bacteria | 14003 |
| 502 | Ga0495670_0002230 | 3300046691 | Bacteria | 9568 |
| 503 | Ga0495670_0017515 | 3300046691 | Bacteria | 3526 |
| 504 | Ga0495670_0060273 | 3300046691 | Bacteria | 1906 |
| 505 | Ga0495671_0000037 | 3300046692 | Bacteria | 177605 |
| 506 | Ga0495671_0000266 | 3300046692 | Bacteria | 44137 |
| 507 | Ga0495671_0001588 | 3300046692 | Bacteria | 15013 |
| 508 | Ga0495671_0021170 | 3300046692 | Bacteria | 3419 |
| 509 | Ga0495671_0031973 | 3300046692 | Bacteria | 2688 |
| 510 | Ga0495671_0038570 | 3300046692 | Bacteria | 2414 |
| 511 | Ga0495671_0060337 | 3300046692 | Bacteria | 1872 |
| 512 | Ga0495671_0082603 | 3300046692 | Bacteria | 1574 |
| 513 | Ga0495649_0005779 | 3300046694 | Bacteria | 7792 |
| 514 | Ga0495649_0014891 | 3300046694 | Bacteria | 4444 |
| 515 | Ga0495649_0015065 | 3300046694 | Bacteria | 4408 |
| 516 | Ga0495649_0035786 | 3300046694 | Bacteria | 2730 |
| 517 | Ga0495649_0042129 | 3300046694 | Bacteria | 2495 |
| 518 | Ga0495649_0062254 | 3300046694 | Bacteria | 2006 |
| 519 | Ga0495649_0076532 | 3300046694 | Bacteria | 1791 |
| 520 | Ga0495589_0028246 | 3300046794 | Bacteria | 2832 |
| 521 | Ga0495589_0047304 | 3300046794 | Bacteria | 2132 |
| 522 | Ga0495600_0001939 | 3300046809 | Bacteria | 11625 |
| 523 | Ga0495660_0002471 | 3300046810 | Bacteria | 11786 |
| 524 | Ga0495660_0003717 | 3300046810 | Bacteria | 9368 |
| 525 | Ga0495660_0007910 | 3300046810 | Bacteria | 6243 |
| 526 | Ga0495660_0016480 | 3300046810 | Bacteria | 4261 |
| 527 | Ga0495660_0042667 | 3300046810 | Bacteria | 2506 |
| 528 | Ga0495660_0047139 | 3300046810 | Bacteria | 2361 |
| 529 | Ga0495660_0050070 | 3300046810 | Bacteria | 2277 |
| 530 | Ga0495604_0018828 | 3300047317 | Bacteria | 5530 |
| 531 | Ga0495604_0022591 | 3300047317 | Bacteria | 5022 |
| 532 | Ga0495636_0003200 | 3300047318 | Bacteria | 6350 |
| 533 | Ga0495674_0000762 | 3300047319 | Bacteria | 30538 |
| 534 | Ga0495672_0000013 | 3300047320 | Bacteria | 511827 |
| 535 | Ga0495672_0000297 | 3300047320 | Bacteria | 68017 |
| 536 | Ga0495672_0000353 | 3300047320 | Bacteria | 58748 |
| 537 | Ga0495672_0000528 | 3300047320 | Bacteria | 43698 |
| 538 | Ga0495672_0005338 | 3300047320 | Bacteria | 10227 |
| 539 | Ga0495672_0011050 | 3300047320 | Bacteria | 6394 |
| 540 | Ga0495672_0026668 | 3300047320 | Bacteria | 3682 |
| 541 | Ga0495672_0032578 | 3300047320 | Bacteria | 3240 |
| 542 | Ga0495672_0084496 | 3300047320 | Bacteria | 1760 |
| 543 | Ga0495672_0084888 | 3300047320 | Bacteria | 1756 |
| 544 | Ga0495676_0035724 | 3300047321 | Bacteria | 4155 |
| 545 | Ga0495676_0051856 | 3300047321 | Bacteria | 3279 |
| 546 | Ga0495676_0087306 | 3300047321 | Bacteria | 2344 |
| 547 | Ga0495676_0114962 | 3300047321 | Bacteria | 1968 |
| 548 | Ga0495676_0175399 | 3300047321 | Bacteria | 1506 |
| 549 | Ga0495683_0000717 | 3300047323 | Bacteria | 24140 |
| 550 | Ga0495683_0000773 | 3300047323 | Bacteria | 22984 |
| 551 | Ga0495683_0016868 | 3300047323 | Bacteria | 3790 |
| 552 | Ga0495683_0018685 | 3300047323 | Bacteria | 3581 |
| 553 | Ga0495683_0039873 | 3300047323 | Bacteria | 2373 |
| 554 | Ga0495687_000342 | 3300047443 | Bacteria | 59692 |
| 555 | Ga0495687_004513 | 3300047443 | Bacteria | 9355 |
| 556 | Ga0495687_004776 | 3300047443 | Bacteria | 8949 |
| 557 | Ga0495675_0007299 | 3300047444 | Bacteria | 6809 |
| 558 | Ga0495677_0001477 | 3300047445 | Bacteria | 9429 |
| 559 | Ga0495677_0006592 | 3300047445 | Bacteria | 4382 |
| 560 | Ga0495677_0006999 | 3300047445 | Bacteria | 4228 |
| 561 | Ga0495677_0010091 | 3300047445 | Bacteria | 3473 |
| 562 | Ga0495677_0012355 | 3300047445 | Bacteria | 3114 |
| 563 | Ga0495677_0024474 | 3300047445 | Bacteria | 2190 |
| 564 | Ga0495677_0037947 | 3300047445 | Bacteria | 1760 |
| 565 | Ga0495679_002696 | 3300047446 | Bacteria | 8867 |
| 566 | Ga0495679_017637 | 3300047446 | Bacteria | 2552 |
| 567 | Ga0495679_030597 | 3300047446 | Bacteria | 1745 |
| 568 | Ga0495685_000088 | 3300047447 | Bacteria | 33952 |
| 569 | Ga0495685_011499 | 3300047447 | Bacteria | 2987 |
| 570 | Ga0495685_014285 | 3300047447 | Bacteria | 2698 |
| 571 | Ga0495673_0000179 | 3300047469 | Bacteria | 102128 |
| 572 | Ga0495673_0000201 | 3300047469 | Bacteria | 92885 |
| 573 | Ga0495673_0000248 | 3300047469 | Bacteria | 75224 |
| 574 | Ga0495681_0005506 | 3300047470 | Bacteria | 8465 |
| 575 | Ga0495681_0010017 | 3300047470 | Bacteria | 5772 |
| 576 | Ga0495681_0021685 | 3300047470 | Bacteria | 3454 |
| 577 | Ga0495681_0022753 | 3300047470 | Bacteria | 3346 |
| 578 | Ga0495686_0001233 | 3300047472 | Bacteria | 29192 |
| 579 | Ga0495686_0001635 | 3300047472 | Bacteria | 23409 |
| 580 | Ga0495686_0005028 | 3300047472 | Bacteria | 10620 |
| 581 | Ga0495686_0005717 | 3300047472 | Bacteria | 9714 |
| 582 | Ga0495686_0007524 | 3300047472 | Bacteria | 8155 |
| 583 | Ga0495686_0038847 | 3300047472 | Bacteria | 3043 |
| 584 | Ga0495593_0038046 | 3300047673 | Bacteria | 2599 |
| 585 | Ga0495602_0007222 | 3300048088 | Bacteria | 11638 |
| 586 | Ga0495602_0013945 | 3300048088 | Bacteria | 8188 |
| 587 | Ga0495626_0000105 | 3300048091 | Bacteria | 109725 |
| 588 | Ga0495626_0003195 | 3300048091 | Bacteria | 10652 |
| 589 | Ga0495626_0004624 | 3300048091 | Bacteria | 8377 |
| 590 | Ga0495626_0007526 | 3300048091 | Bacteria | 6048 |
| 591 | Ga0495626_0008438 | 3300048091 | Bacteria | 5646 |
| 592 | Ga0495626_0013805 | 3300048091 | Bacteria | 4189 |
| 593 | Ga0495626_0020787 | 3300048091 | Bacteria | 3266 |
| 594 | Ga0496100_0079681 | 3300048903 | Bacteria | 2207 |
| 595 | Ga0496101_0050820 | 3300048904 | Bacteria | 2985 |
| 596 | Ga0496101_0131960 | 3300048904 | Bacteria | 1897 |
| 597 | Ga0496102_0000074 | 3300048905 | Bacteria | 148938 |
| 598 | Ga0496102_0035650 | 3300048905 | Bacteria | 4478 |
| 599 | Ga0496102_0053103 | 3300048905 | Bacteria | 3695 |
| 600 | Ga0496103_0006538 | 3300048906 | Bacteria | 6951 |
| 601 | Ga0496103_0008145 | 3300048906 | Bacteria | 6224 |
| 602 | Ga0496103_0014695 | 3300048906 | Bacteria | 4651 |
| 603 | Ga0496104_0194987 | 3300048907 | Bacteria | 1938 |
| 604 | Ga0496106_0004887 | 3300048909 | Bacteria | 9924 |
| 605 | Ga0496107_0012263 | 3300048910 | Bacteria | 5982 |
| 606 | Ga0496109_0008098 | 3300048912 | Bacteria | 8910 |
| 607 | Ga0496110_0225442 | 3300048913 | Bacteria | 1704 |
| 608 | Ga0496112_0201043 | 3300048915 | Bacteria | 1952 |
| 609 | Ga0496114_0077089 | 3300048917 | Bacteria | 2810 |
| 610 | Ga0496115_0003466 | 3300048918 | Bacteria | 11339 |
| 611 | Ga0496115_0069468 | 3300048918 | Bacteria | 2853 |
| 612 | Ga0496115_0166843 | 3300048918 | Bacteria | 1821 |
| 613 | Ga0496115_0186331 | 3300048918 | Bacteria | 1715 |
| 614 | Ga0496116_0006192 | 3300048919 | Bacteria | 10929 |
| 615 | Ga0496116_0008873 | 3300048919 | Bacteria | 8651 |
| 616 | Ga0496116_0030804 | 3300048919 | Bacteria | 3850 |
| 617 | Ga0496116_0041864 | 3300048919 | Bacteria | 3138 |
| 618 | Ga0496116_0075259 | 3300048919 | Bacteria | 2120 |
| 619 | Ga0496117_0000005 | 3300048920 | Bacteria | 777468 |
| 620 | Ga0496118_0000031 | 3300048921 | Bacteria | 339329 |
| 621 | Ga0496120_0032282 | 3300048923 | Bacteria | 3159 |
| 622 | Ga0496121_0005140 | 3300048924 | Bacteria | 17033 |
| 623 | Ga0496121_0021381 | 3300048924 | Bacteria | 6339 |
| 624 | Ga0496121_0063402 | 3300048924 | Bacteria | 3020 |
| 625 | Ga0496122_0001099 | 3300048925 | Bacteria | 46763 |
| 626 | Ga0496122_0002483 | 3300048925 | Bacteria | 26065 |
| 627 | Ga0496122_0008145 | 3300048925 | Bacteria | 11412 |
| 628 | Ga0496122_0029016 | 3300048925 | Bacteria | 4678 |
| 629 | Ga0496122_0029365 | 3300048925 | Bacteria | 4639 |
| 630 | Ga0496122_0063214 | 3300048925 | Bacteria | 2703 |
| 631 | Ga0496123_0000953 | 3300048926 | Bacteria | 44958 |
| 632 | Ga0496123_0001525 | 3300048926 | Bacteria | 32004 |
| 633 | Ga0496123_0002484 | 3300048926 | Bacteria | 22768 |
| 634 | Ga0496123_0008730 | 3300048926 | Bacteria | 9252 |
| 635 | Ga0496123_0034932 | 3300048926 | Bacteria | 3592 |
| 636 | Ga0496123_0090250 | 3300048926 | Bacteria | 1823 |
| 637 | Ga0496124_0011035 | 3300048927 | Bacteria | 9071 |
| 638 | Ga0496124_0015786 | 3300048927 | Bacteria | 7216 |
| 639 | Ga0496124_0065544 | 3300048927 | Bacteria | 3028 |
| 640 | Ga0496124_0100008 | 3300048927 | Bacteria | 2351 |
| 641 | Ga0496124_0175953 | 3300048927 | Bacteria | 1652 |
| 642 | Ga0496125_0001223 | 3300048928 | Bacteria | 38519 |
| 643 | Ga0496125_0004256 | 3300048928 | Bacteria | 16667 |
| 644 | Ga0496125_0005020 | 3300048928 | Bacteria | 14939 |
| 645 | Ga0496125_0209664 | 3300048928 | Bacteria | 1266 |
| 646 | Ga0496125_0218857 | 3300048928 | Bacteria | 1229 |
| 647 | Ga0496126_0026304 | 3300048929 | Bacteria | 5581 |
| 648 | Ga0496126_0080496 | 3300048929 | Bacteria | 2883 |
| 649 | Ga0495678_000010 | 3300049459 | Bacteria | 357896 |
| 650 | Ga0495678_000323 | 3300049459 | Bacteria | 50951 |
| 651 | Ga0495678_002976 | 3300049459 | Bacteria | 10802 |
| 652 | Ga0495678_003554 | 3300049459 | Bacteria | 9556 |
| 653 | Ga0495678_005675 | 3300049459 | Bacteria | 6798 |
| 654 | Ga0495678_009409 | 3300049459 | Bacteria | 4836 |
| 655 | Ga0495682_0001031 | 3300049460 | Bacteria | 16453 |
| 656 | Ga0495682_0001462 | 3300049460 | Bacteria | 12666 |
| 657 | Ga0495682_0008902 | 3300049460 | Bacteria | 3939 |
| 658 | Ga0495682_0014460 | 3300049460 | Bacteria | 2992 |
| 659 | Ga0495682_0035157 | 3300049460 | Bacteria | 1846 |
| 660 | Ga0495682_0087443 | 3300049460 | Bacteria | 1120 |
| 661 | Ga0501227_005381 | 3300049665 | Bacteria | 2740 |
| 662 | Ga0501269_001283 | 3300049766 | Bacteria | 3364 |
| 663 | Ga0501279_000496 | 3300049775 | Bacteria | 5153 |
| 664 | Ga0501279_001155 | 3300049775 | Bacteria | 3464 |
| 665 | Ga0501280_000364 | 3300049776 | Bacteria | 11188 |
| 666 | Ga0501035_0010094 | 3300049822 | Bacteria | 8765 |
| 667 | Ga0495601_0001795 | 3300053077 | Bacteria | 11914 |
| 668 | Ga0500594_0004037 | 3300053118 | Bacteria | 3230 |
| 669 | Ga0500595_008802 | 3300053119 | Bacteria | 4102 |
| 670 | Ga0500618_000139 | 3300053125 | Bacteria | 60811 |
| 671 | Ga0500618_001387 | 3300053125 | Bacteria | 10914 |
| 672 | Ga0500618_002238 | 3300053125 | Bacteria | 7538 |
| 673 | Ga0500618_008663 | 3300053125 | Bacteria | 2823 |
| 674 | Ga0500574_000059 | 3300053141 | Bacteria | 12462 |
| 675 | Ga0500586_004334 | 3300053145 | Bacteria | 3461 |
| 676 | Ga0500619_001046 | 3300053154 | Bacteria | 4791 |
| 677 | Ga0466962_0084538 | 3300061719 | Bacteria | 1518 |
| 678 | 2511385238 | 2511231026 | Bacteria | 5225445 |
| 679 | 2521559847 | 2521172590 | Bacteria | 5047645 |
| 680 | 2553007017 | 2551306416 | Bacteria | 6152985 |
| 681 | 2574430277 | 2574179768 | Bacteria | 4907129 |
| 682 | 2601667057 | 2600255292 | Bacteria | 6300551 |
| 683 | 2643792035 | 2643221554 | Bacteria | 6603920 |
| 684 | 2644216483 | 2643221638 | Bacteria | 6579467 |
| 685 | 2644254772 | 2643221645 | Bacteria | 7207331 |
| 686 | 2644360324 | 2643221664 | Bacteria | 7272945 |
| 687 | 2738738079 | 2738541280 | Bacteria | 6630198 |
| 688 | 2738826829 | 2738541297 | Bacteria | 6549566 |
| 689 | 2738843130 | 2738541300 | Bacteria | 6675882 |
| 690 | 2739150626 | 2738541357 | Bacteria | 6549408 |
| 691 | 2739192545 | 2738543003 | Bacteria | 6549560 |
| 692 | 2739273881 | 2738543018 | Bacteria | 6718814 |
| 693 | 2739319022 | 2738543026 | Bacteria | 6549408 |
| 694 | 2739337263 | 2738543029 | Bacteria | 6549249 |
| 695 | 2739342925 | 2738543030 | Bacteria | 6719714 |
| 696 | 2765571106 | 2765235838 | Bacteria | 5445269 |
| 697 | 2808985014 | 2808606386 | Bacteria | 4471946 |
| 698 | 2809130146 | 2808606415 | Bacteria | 4576710 |
| 699 | 2809150377 | 2808606419 | Bacteria | 4576925 |
| 700 | 2819544636 | 2818991436 | Bacteria | 5376622 |
| 701 | 2819618242 | 2818991449 | Bacteria | 5518009 |
| 702 | 2821135837 | 2821131069 | Bacteria | 6108407 |
| 703 | 2839098990 | 2839094727 | Bacteria | 5534556 |
| 704 | 2842712301 | 2842711865 | Bacteria | 7155354 |
| 705 | 2852621399 | 2852618963 | Bacteria | 4577824 |
| 706 | 2857549102 | 2857547612 | Bacteria | 6179999 |
| 707 | 2857556238 | 2857553236 | Bacteria | 6166726 |
| 708 | 2857560838 | 2857558681 | Bacteria | 6617694 |
| 709 | 2857568039 | 2857564685 | Bacteria | 6290584 |
| 710 | 2885085000 | 2885080285 | Bacteria | 6355622 |
| 711 | 2891633872 | 2891633521 | Bacteria | 4602265 |
| 712 | 2904428822 | 2904424332 | Bacteria | 7633521 |
| 713 | 2904444416 | 2904439833 | Bacteria | 5931679 |
| 714 | 2904535569 | 2904530477 | Bacteria | 5876334 |
| 715 | 2904588140 | 2904584206 | Bacteria | 6028872 |
| 716 | 2904595176 | 2904589729 | Bacteria | 6113573 |
| 717 | 2904606089 | 2904601388 | Bacteria | 5884906 |
| 718 | 2919049232 | 2919046199 | Bacteria | 5567169 |
| 719 | 2919084287 | 2919079590 | Bacteria | 5946433 |
| 720 | 2919477004 | 2919476304 | Bacteria | 5888696 |
| 721 | 2923513617 | 2923510766 | Bacteria | 5926163 |
| 722 | 2928135267 | 2928130867 | Bacteria | 5467269 |
| 723 | Ga0055534_1009919 | |||
| 724 | JGI25158J39367_1002276 | |||
| 725 | JGI25158J39367_1006829 | |||
| 726 | JGI25152J39213_1000224 | |||
| 727 | JGI25159J45721_1003027 | |||
| 728 | JGI25151J46595_10002270 | |||
| 729 | JGI25151J46595_10004291 | |||
| 730 | JGI25165J46597_1000051 | |||
| 731 | rootL2_10029882 | |||
| 732 | rootL2_10183526 | |||
| 733 | rootH1_10075425 | |||
| 734 | JGI25161J50226_1000949 | |||
| 735 | Ga0007409J51694_1079496 | |||
| 736 | Ga0055538_1000025 | |||
| 737 | Ga0055538_1000062 | |||
| 738 | Ga0055539_1000032 | |||
| 739 | Ga0055539_1000093 | |||
| 740 | Ga0055533_1000042 | |||
| 741 | Ga0055533_1000105 | |||
| 742 | Ga0055525_1000018 | |||
| 743 | Ga0055525_1000050 | |||
| 744 | Ga0055525_1000137 | |||
| 745 | Ga0055529_1000079 | |||
| 746 | Ga0055526_1000211 | |||
| 747 | Ga0055526_1000272 | |||
| 748 | Ga0055526_1004035 | |||
| 749 | Ga0055526_1007275 | |||
| 750 | Ga0055526_1007509 | |||
| 751 | Ga0055526_1007814 | |||
| 752 | Ga0055526_1008251 | |||
| 753 | Ga0055537_1000038 | |||
| 754 | Ga0055537_1002750 | |||
| 755 | Ga0055524_1000024 | |||
| 756 | Ga0055524_1000728 | |||
| 757 | Ga0055524_1001031 | |||
| 758 | Ga0055524_1001453 | |||
| 759 | Ga0055524_1001929 | |||
| 760 | Ga0055536_1000134 | |||
| 761 | Ga0055534_1000074 | |||
| 762 | Ga0055534_1001413 | |||
| 763 | Ga0055528_1000231 | |||
| 764 | Ga0055528_1001043 | |||
| 765 | Ga0055530_10001965 | |||
| 766 | Ga0055530_10003946 | |||
| 767 | Ga0055531_10007726 | |||
| 768 | Ga0055541_1000023 | |||
| 769 | Ga0055541_1000063 | |||
| 770 | Ga0055543_1000924 | |||
| 771 | Ga0065165_1002806 | |||
| 772 | Ga0070660_100039087 | |||
| 773 | Ga0070660_100218844 | |||
| 774 | Ga0070673_100233069 | |||
| 775 | Ga0068853_100254777 | |||
| 776 | Ga0068855_100007118 | |||
| 777 | Ga0068855_100020379 | |||
| 778 | Ga0070664_100047821 | |||
| 779 | Ga0068854_100005433 | |||
| 780 | Ga0068856_100034024 | |||
| 781 | Ga0068851_10049041 | |||
| 782 | Ga0068863_100167702 | |||
| 783 | Ga0099826_10000007 | |||
| 784 | Ga0099826_10000010 | |||
| 785 | Ga0105244_10003379 | |||
| 786 | Ga0105240_10062674 | |||
| 787 | Ga0105240_10242754 | |||
| 788 | Ga0105245_10117468 | |||
| 789 | Ga0105241_10013339 | |||
| 790 | Ga0105242_10205817 | |||
| 791 | Ga0105237_10014347 | |||
| 792 | Ga0105238_10000763 | |||
| 793 | Ga0105239_10155414 | |||
| 794 | Ga0157371_10000018 | |||
| 795 | Ga0157380_10500275 | |||
| 796 | Ga0182008_10001672 | |||
| 797 | Ga0182008_10022614 | |||
| 798 | Ga0182006_1000141 | |||
| 799 | Ga0182006_1004639 | |||
| 800 | Ga0182006_1036812 | |||
| 801 | Ga0182007_10000144 | |||
| 802 | Ga0182007_10005958 | |||
| 803 | Ga0182005_1000016 | |||
| 804 | Ga0182005_1000024 | |||
| 805 | Ga0163161_10114153 | |||
| 806 | Ga0213872_10000005 | |||
| 807 | Ga0213872_10004614 | |||
| 808 | Ga0213872_10019006 | |||
| 809 | Ga0213872_10025486 | |||
| 810 | Ga0209760_103617 | |||
| 811 | Ga0209436_100797 | |||
| 812 | Ga0209784_100010 | |||
| 813 | Ga0209784_100021 | |||
| 814 | Ga0209566_100008 | |||
| 815 | Ga0209566_100119 | |||
| 816 | Ga0209674_100019 | |||
| 817 | Ga0209674_100036 | |||
| 818 | Ga0209563_100011 | |||
| 819 | Ga0209563_100021 | |||
| 820 | Ga0209563_100040 | |||
| 821 | Ga0207427_100596 | |||
| 822 | Ga0209437_100019 | |||
| 823 | Ga0209437_100332 | |||
| 824 | Ga0207425_1000021 | |||
| 825 | Ga0207425_1000223 | |||
| 826 | Ga0207425_1000640 | |||
| 827 | Ga0209646_1000068 | |||
| 828 | Ga0209026_1002283 | |||
| 829 | Ga0209677_100011 | |||
| 830 | Ga0209677_100023 | |||
| 831 | Ga0209677_104408 | |||
| 832 | Ga0209129_1000020 | |||
| 833 | Ga0209129_1004859 | |||
| 834 | Ga0209233_1000025 | |||
| 835 | Ga0209565_1000104 | |||
| 836 | Ga0209565_1000123 | |||
| 837 | Ga0209565_1001864 | |||
| 838 | Ga0209565_1002627 | |||
| 839 | Ga0209565_1008102 | |||
| 840 | Ga0209455_1000070 | |||
| 841 | Ga0209673_1000040 | |||
| 842 | Ga0209130_1001646 | |||
| 843 | Ga0209130_1002608 | |||
| 844 | Ga0209675_1000117 | |||
| 845 | Ga0209675_1001657 | |||
| 846 | Ga0209675_1002531 | |||
| 847 | Ga0209675_1022431 | |||
| 848 | Ga0209676_1000036 | |||
| 849 | Ga0209025_1001884 | |||
| 850 | Ga0209025_1002014 | |||
| 851 | Ga0209025_1003834 | |||
| 852 | Ga0209025_1018501 | |||
| 853 | Ga0209564_1000027 | |||
| 854 | Ga0209564_1000047 | |||
| 855 | Ga0209564_1000121 | |||
| 856 | Ga0209564_1000780 | |||
| 857 | Ga0209564_1001065 | |||
| 858 | Ga0209564_1001271 | |||
| 859 | Ga0209564_1002491 | |||
| 860 | Ga0209564_1002959 | |||
| 861 | Ga0209758_1000077 | |||
| 862 | Ga0209758_1000322 | |||
| 863 | Ga0209758_1006210 | |||
| 864 | Ga0209050_1000050 | |||
| 865 | Ga0209050_1000795 | |||
| 866 | Ga0209256_1000054 | |||
| 867 | Ga0209256_1000287 | |||
| 868 | Ga0209256_1000288 | |||
| 869 | Ga0209256_1000543 | |||
| 870 | Ga0209256_1000674 | |||
| 871 | Ga0209256_1001001 | |||
| 872 | Ga0209256_1002870 | |||
| 873 | Ga0209256_1003939 | |||
| 874 | Ga0207426_1001270 | |||
| 875 | Ga0209257_1000075 | |||
| 876 | Ga0209257_1007416 | |||
| 877 | Ga0207655_1000710 | |||
| 878 | Ga0207655_1008685 | |||
| 879 | Ga0207654_10008046 | |||
| 880 | Ga0207695_10002760 | |||
| 881 | Ga0207671_10006962 | |||
| 882 | Ga0207657_10027747 | |||
| 883 | Ga0207694_10000343 | |||
| 884 | Ga0207706_10215656 | |||
| 885 | Ga0207686_10075326 | |||
| 886 | Ga0207689_10188798 | |||
| 887 | Ga0207667_10000912 | |||
| 888 | Ga0207640_10014951 | |||
| 889 | Ga0207640_10206951 | |||
| 890 | Ga0207678_10339963 | |||
| 891 | Ga0207702_10032111 | |||
| 892 | Ga0207702_10094471 | |||
| 893 | Ga0209281_1005795 | |||
| 894 | Ga0209282_1000021 | |||
| 895 | Ga0209282_1000072 | |||
| 896 | Ga0316181_1091467 | |||
| 897 | Ga0307408_100000531 | |||
| 898 | Ga0307408_100002211 | |||
| 899 | Ga0307408_100004170 | |||
| 900 | Ga0307408_100005814 | |||
| 901 | Ga0316576_10003778 | |||
| 902 | Ga0316578_10052312 | |||
| 903 | Ga0307518_10111354 | |||
| 904 | Ga0307411_10162416 | |||
| 905 | Ga0316583_10011958 | |||
| 906 | Ga0316593_10005972 | |||
| 907 | Ga0316588_1000267 | |||
| 908 | Ga0373931_0060346 | |||
| 909 | Ga0395899_0000386 | |||
| 910 | Ga0395899_0010874 | |||
| 911 | Ga0395899_0011797 | |||
| 912 | Ga0395900_0000321 | |||
| 913 | Ga0395900_0007976 | |||
| 914 | Ga0395900_0066996 | |||
| 915 | Ga0395905_0018554 | |||
| 916 | Ga0395901_0000187 | |||
| 917 | Ga0395901_0131972 | |||
| 918 | Ga0395901_0314752 | |||
| 919 | Ga0395901_0441198 | |||
| 920 | Ga0436361_0145169 | |||
| 921 | Ga0436361_0235534 | |||
| 922 | Ga0436361_0240080 | |||
| 923 | Ga0436361_0252850 | |||
| 924 | Ga0436361_0820978 | |||
| 925 | Ga0436361_0977423 | |||
| 926 | Ga0436361_1067374 | |||
| 927 | Ga0436361_1218785 | |||
| 928 | Ga0439455_0003129 | |||
| 929 | Ga0450904_002589 | |||
| 930 | Ga0439458_0017629 | |||
| 931 | Ga0466969_0007789 | |||
| 932 | Ga0466982_0082226 | |||
| 933 | Ga0466965_0000671 | |||
| 934 | Ga0466965_0046171 | |||
| 935 | Ga0466966_0037526 | |||
| 936 | Ga0466966_0102541 | |||
| 937 | Ga0466964_0011002 | |||
| 938 | Ga0466964_0017789 | |||
| 939 | Ga0466964_0021221 | |||
| 940 | Ga0466968_0000456 | |||
| 941 | Ga0466968_0004653 | |||
| 942 | Ga0466968_0036872 | |||
| 943 | Ga0466970_0052782 | |||
| 944 | Ga0466957_0004109 | |||
| 945 | Ga0466957_0010939 | |||
| 946 | Ga0466957_0058623 | |||
| 947 | Ga0466957_0167320 | |||
| 948 | Ga0466957_0218924 | |||
| 949 | Ga0466959_0020062 | |||
| 950 | Ga0466958_0028973 | |||
| 951 | Ga0495617_000245 | |||
| 952 | Ga0495617_001194 | |||
| 953 | Ga0495617_001502 | |||
| 954 | Ga0495617_005346 | |||
| 955 | Ga0495627_011269 | |||
| 956 | Ga0495603_0128606 | |||
| 957 | Ga0495590_0000020 | |||
| 958 | Ga0495590_0000595 | |||
| 959 | Ga0495590_0005786 | |||
| 960 | Ga0495590_0014851 | |||
| 961 | Ga0495590_0041314 | |||
| 962 | Ga0495629_0011085 | |||
| 963 | Ga0495638_0000235 | |||
| 964 | Ga0495638_0001049 | |||
| 965 | Ga0495638_0005988 | |||
| 966 | Ga0495638_0067899 | |||
| 967 | Ga0495638_0108844 | |||
| 968 | Ga0495651_0159788 | |||
| 969 | Ga0495653_0000067 | |||
| 970 | Ga0495653_0051408 | |||
| 971 | Ga0495653_0214620 | |||
| 972 | Ga0495653_0227246 | |||
| 973 | Ga0495650_0000200 | |||
| 974 | Ga0495650_0000251 | |||
| 975 | Ga0495650_0000436 | |||
| 976 | Ga0495650_0000483 | |||
| 977 | Ga0495650_0000864 | |||
| 978 | Ga0495650_0005399 | |||
| 979 | Ga0495650_0005880 | |||
| 980 | Ga0495582_0059028 | |||
| 981 | Ga0495605_0000061 | |||
| 982 | Ga0495605_0003908 | |||
| 983 | Ga0495605_0010641 | |||
| 984 | Ga0495605_0016281 | |||
| 985 | Ga0495605_0065541 | |||
| 986 | Ga0495605_0066502 | |||
| 987 | Ga0495605_0068379 | |||
| 988 | Ga0495639_0025159 | |||
| 989 | Ga0495584_0000005 | |||
| 990 | Ga0495584_0000308 | |||
| 991 | Ga0495584_0007872 | |||
| 992 | Ga0495584_0017557 | |||
| 993 | Ga0495584_0027118 | |||
| 994 | Ga0495584_0041240 | |||
| 995 | Ga0495584_0078477 | |||
| 996 | Ga0495585_0001291 | |||
| 997 | Ga0495585_0002222 | |||
| 998 | Ga0495585_0003470 | |||
| 999 | Ga0495585_0004078 | |||
| 1000 | Ga0495585_0011431 | |||
| 1001 | Ga0495585_0012559 | |||
| 1002 | Ga0495585_0014579 | |||
| 1003 | Ga0495585_0014717 | |||
| 1004 | Ga0495585_0019383 | |||
| 1005 | Ga0495585_0032392 | |||
| 1006 | Ga0495585_0050534 | |||
| 1007 | Ga0495585_0070352 | |||
| 1008 | Ga0495585_0103435 | |||
| 1009 | Ga0495594_0030447 | |||
| 1010 | Ga0495594_0046406 | |||
| 1011 | Ga0495594_0063373 | |||
| 1012 | Ga0495594_0074022 | |||
| 1013 | Ga0495596_0000299 | |||
| 1014 | Ga0495596_0000435 | |||
| 1015 | Ga0495596_0000500 | |||
| 1016 | Ga0495596_0001709 | |||
| 1017 | Ga0495596_0002826 | |||
| 1018 | Ga0495596_0010550 | |||
| 1019 | Ga0495596_0012169 | |||
| 1020 | Ga0495596_0025399 | |||
| 1021 | Ga0495596_0082821 | |||
| 1022 | Ga0495607_0000514 | |||
| 1023 | Ga0495607_0006228 | |||
| 1024 | Ga0495607_0008009 | |||
| 1025 | Ga0495607_0010458 | |||
| 1026 | Ga0495607_0016220 | |||
| 1027 | Ga0495607_0019852 | |||
| 1028 | Ga0495607_0044523 | |||
| 1029 | Ga0495607_0048199 | |||
| 1030 | Ga0495607_0056988 | |||
| 1031 | Ga0495583_0000158 | |||
| 1032 | Ga0495583_0000214 | |||
| 1033 | Ga0495583_0000317 | |||
| 1034 | Ga0495583_0000817 | |||
| 1035 | Ga0495583_0002937 | |||
| 1036 | Ga0495583_0004418 | |||
| 1037 | Ga0495583_0004541 | |||
| 1038 | Ga0495583_0004572 | |||
| 1039 | Ga0495583_0009922 | |||
| 1040 | Ga0495583_0035926 | |||
| 1041 | Ga0495583_0040199 | |||
| 1042 | Ga0495583_0041718 | |||
| 1043 | Ga0495583_0070235 | |||
| 1044 | Ga0495583_0104038 | |||
| 1045 | Ga0495606_0000120 | |||
| 1046 | Ga0495606_0000262 | |||
| 1047 | Ga0495606_0000433 | |||
| 1048 | Ga0495606_0003347 | |||
| 1049 | Ga0495606_0003359 | |||
| 1050 | Ga0495606_0005585 | |||
| 1051 | Ga0495606_0007912 | |||
| 1052 | Ga0495606_0008104 | |||
| 1053 | Ga0495606_0008155 | |||
| 1054 | Ga0495606_0024893 | |||
| 1055 | Ga0495606_0032534 | |||
| 1056 | Ga0495606_0047463 | |||
| 1057 | Ga0495608_0001440 | |||
| 1058 | Ga0495608_0010752 | |||
| 1059 | Ga0495610_0000017 | |||
| 1060 | Ga0495610_0005990 | |||
| 1061 | Ga0495610_0006236 | |||
| 1062 | Ga0495610_0010999 | |||
| 1063 | Ga0495610_0016874 | |||
| 1064 | Ga0495610_0019833 | |||
| 1065 | Ga0495610_0029250 | |||
| 1066 | Ga0495616_0000968 | |||
| 1067 | Ga0495616_0003646 | |||
| 1068 | Ga0495616_0004117 | |||
| 1069 | Ga0495616_0008053 | |||
| 1070 | Ga0495616_0012210 | |||
| 1071 | Ga0495616_0014213 | |||
| 1072 | Ga0495616_0019686 | |||
| 1073 | Ga0495616_0020246 | |||
| 1074 | Ga0495616_0044097 | |||
| 1075 | Ga0495616_0111038 | |||
| 1076 | Ga0495618_0005745 | |||
| 1077 | Ga0495620_0001878 | |||
| 1078 | Ga0495628_0002346 | |||
| 1079 | Ga0495631_0002979 | |||
| 1080 | Ga0495631_0004446 | |||
| 1081 | Ga0495631_0014038 | |||
| 1082 | Ga0495631_0015576 | |||
| 1083 | Ga0495631_0052150 | |||
| 1084 | Ga0495631_0059700 | |||
| 1085 | Ga0495631_0062941 | |||
| 1086 | Ga0495632_0002504 | |||
| 1087 | Ga0495632_0006166 | |||
| 1088 | Ga0495632_0028547 | |||
| 1089 | Ga0495637_0000179 | |||
| 1090 | Ga0495637_0002381 | |||
| 1091 | Ga0495637_0057767 | |||
| 1092 | Ga0495643_0001515 | |||
| 1093 | Ga0495643_0003833 | |||
| 1094 | Ga0495643_0004577 | |||
| 1095 | Ga0495643_0008786 | |||
| 1096 | Ga0495643_0022557 | |||
| 1097 | Ga0495643_0022831 | |||
| 1098 | Ga0495643_0091662 | |||
| 1099 | Ga0495643_0111783 | |||
| 1100 | Ga0495644_0001273 | |||
| 1101 | Ga0495644_0002046 | |||
| 1102 | Ga0495644_0010549 | |||
| 1103 | Ga0495644_0038991 | |||
| 1104 | Ga0495648_0000183 | |||
| 1105 | Ga0495648_0000350 | |||
| 1106 | Ga0495648_0004377 | |||
| 1107 | Ga0495648_0006400 | |||
| 1108 | Ga0495648_0008929 | |||
| 1109 | Ga0495648_0010395 | |||
| 1110 | Ga0495648_0011915 | |||
| 1111 | Ga0495648_0016470 | |||
| 1112 | Ga0495648_0019269 | |||
| 1113 | Ga0495648_0026508 | |||
| 1114 | Ga0495648_0045451 | |||
| 1115 | Ga0495648_0096526 | |||
| 1116 | Ga0495648_0108041 | |||
| 1117 | Ga0495663_0017336 | |||
| 1118 | Ga0495666_0002304 | |||
| 1119 | Ga0495666_0003839 | |||
| 1120 | Ga0495666_0027086 | |||
| 1121 | Ga0495642_0001394 | |||
| 1122 | Ga0495642_0002375 | |||
| 1123 | Ga0495642_0008501 | |||
| 1124 | Ga0495642_0008897 | |||
| 1125 | Ga0495642_0011049 | |||
| 1126 | Ga0495642_0013848 | |||
| 1127 | Ga0495642_0021316 | |||
| 1128 | Ga0495642_0031048 | |||
| 1129 | Ga0495642_0096715 | |||
| 1130 | Ga0495652_0034764 | |||
| 1131 | Ga0495654_0000060 | |||
| 1132 | Ga0495654_0001159 | |||
| 1133 | Ga0495654_0005774 | |||
| 1134 | Ga0495654_0016211 | |||
| 1135 | Ga0495665_0015384 | |||
| 1136 | Ga0495587_0028066 | |||
| 1137 | Ga0495587_0071587 | |||
| 1138 | Ga0495609_0000314 | |||
| 1139 | Ga0495609_0001512 | |||
| 1140 | Ga0495609_0001993 | |||
| 1141 | Ga0495609_0003500 | |||
| 1142 | Ga0495609_0004793 | |||
| 1143 | Ga0495609_0006945 | |||
| 1144 | Ga0495609_0010694 | |||
| 1145 | Ga0495609_0014295 | |||
| 1146 | Ga0495609_0014512 | |||
| 1147 | Ga0495597_0001017 | |||
| 1148 | Ga0495597_0001024 | |||
| 1149 | Ga0495597_0001027 | |||
| 1150 | Ga0495597_0002718 | |||
| 1151 | Ga0495597_0003136 | |||
| 1152 | Ga0495597_0003813 | |||
| 1153 | Ga0495597_0012946 | |||
| 1154 | Ga0495597_0020801 | |||
| 1155 | Ga0495597_0021173 | |||
| 1156 | Ga0495597_0023809 | |||
| 1157 | Ga0495645_0058669 | |||
| 1158 | Ga0495622_0000488 | |||
| 1159 | Ga0495622_0001922 | |||
| 1160 | Ga0495622_0013368 | |||
| 1161 | Ga0495622_0017669 | |||
| 1162 | Ga0495633_0003504 | |||
| 1163 | Ga0495633_0003677 | |||
| 1164 | Ga0495633_0004606 | |||
| 1165 | Ga0495633_0005099 | |||
| 1166 | Ga0495633_0008760 | |||
| 1167 | Ga0495633_0010011 | |||
| 1168 | Ga0495633_0015948 | |||
| 1169 | Ga0495633_0018108 | |||
| 1170 | Ga0495633_0040530 | |||
| 1171 | Ga0495633_0042766 | |||
| 1172 | Ga0495633_0048390 | |||
| 1173 | Ga0495656_0008532 | |||
| 1174 | Ga0495668_0000162 | |||
| 1175 | Ga0495668_0000427 | |||
| 1176 | Ga0495668_0002105 | |||
| 1177 | Ga0495668_0002232 | |||
| 1178 | Ga0495668_0004696 | |||
| 1179 | Ga0495668_0007960 | |||
| 1180 | Ga0495668_0011146 | |||
| 1181 | Ga0495668_0031864 | |||
| 1182 | Ga0495668_0039173 | |||
| 1183 | Ga0495611_0002762 | |||
| 1184 | Ga0495611_0003285 | |||
| 1185 | Ga0495611_0006211 | |||
| 1186 | Ga0495625_0001192 | |||
| 1187 | Ga0495625_0007112 | |||
| 1188 | Ga0495625_0012748 | |||
| 1189 | Ga0495625_0016783 | |||
| 1190 | Ga0495625_0032343 | |||
| 1191 | Ga0495625_0040242 | |||
| 1192 | Ga0495625_0148623 | |||
| 1193 | Ga0495625_0151161 | |||
| 1194 | Ga0495659_0000127 | |||
| 1195 | Ga0495659_0000721 | |||
| 1196 | Ga0495659_0003375 | |||
| 1197 | Ga0495661_0000490 | |||
| 1198 | Ga0495661_0002987 | |||
| 1199 | Ga0495661_0003261 | |||
| 1200 | Ga0495661_0008306 | |||
| 1201 | Ga0495661_0016109 | |||
| 1202 | Ga0495661_0020630 | |||
| 1203 | Ga0495661_0022899 | |||
| 1204 | Ga0495661_0026903 | |||
| 1205 | Ga0495661_0059339 | |||
| 1206 | Ga0495661_0069284 | |||
| 1207 | Ga0495661_0076269 | |||
| 1208 | Ga0495661_0080054 | |||
| 1209 | Ga0495661_0101486 | |||
| 1210 | Ga0495588_0000199 | |||
| 1211 | Ga0495599_0001957 | |||
| 1212 | Ga0495623_0004092 | |||
| 1213 | Ga0495646_0003630 | |||
| 1214 | Ga0495669_0000844 | |||
| 1215 | Ga0495669_0001832 | |||
| 1216 | Ga0495669_0004619 | |||
| 1217 | Ga0495669_0015545 | |||
| 1218 | Ga0495669_0042112 | |||
| 1219 | Ga0495669_0062005 | |||
| 1220 | Ga0495613_0124142 | |||
| 1221 | Ga0495624_0007612 | |||
| 1222 | Ga0495624_0035957 | |||
| 1223 | Ga0495670_0000952 | |||
| 1224 | Ga0495670_0002230 | |||
| 1225 | Ga0495670_0017515 | |||
| 1226 | Ga0495670_0060273 | |||
| 1227 | Ga0495671_0000037 | |||
| 1228 | Ga0495671_0000266 | |||
| 1229 | Ga0495671_0001588 | |||
| 1230 | Ga0495671_0021170 | |||
| 1231 | Ga0495671_0031973 | |||
| 1232 | Ga0495671_0038570 | |||
| 1233 | Ga0495671_0060337 | |||
| 1234 | Ga0495671_0082603 | |||
| 1235 | Ga0495649_0005779 | |||
| 1236 | Ga0495649_0014891 | |||
| 1237 | Ga0495649_0015065 | |||
| 1238 | Ga0495649_0035786 | |||
| 1239 | Ga0495649_0042129 | |||
| 1240 | Ga0495649_0062254 | |||
| 1241 | Ga0495649_0076532 | |||
| 1242 | Ga0495589_0028246 | |||
| 1243 | Ga0495589_0047304 | |||
| 1244 | Ga0495600_0001939 | |||
| 1245 | Ga0495660_0002471 | |||
| 1246 | Ga0495660_0003717 | |||
| 1247 | Ga0495660_0007910 | |||
| 1248 | Ga0495660_0016480 | |||
| 1249 | Ga0495660_0042667 | |||
| 1250 | Ga0495660_0047139 | |||
| 1251 | Ga0495660_0050070 | |||
| 1252 | Ga0495604_0018828 | |||
| 1253 | Ga0495604_0022591 | |||
| 1254 | Ga0495636_0003200 | |||
| 1255 | Ga0495674_0000762 | |||
| 1256 | Ga0495672_0000013 | |||
| 1257 | Ga0495672_0000297 | |||
| 1258 | Ga0495672_0000353 | |||
| 1259 | Ga0495672_0000528 | |||
| 1260 | Ga0495672_0005338 | |||
| 1261 | Ga0495672_0011050 | |||
| 1262 | Ga0495672_0026668 | |||
| 1263 | Ga0495672_0032578 | |||
| 1264 | Ga0495672_0084496 | |||
| 1265 | Ga0495672_0084888 | |||
| 1266 | Ga0495676_0035724 | |||
| 1267 | Ga0495676_0051856 | |||
| 1268 | Ga0495676_0087306 | |||
| 1269 | Ga0495676_0114962 | |||
| 1270 | Ga0495676_0175399 | |||
| 1271 | Ga0495683_0000717 | |||
| 1272 | Ga0495683_0000773 | |||
| 1273 | Ga0495683_0016868 | |||
| 1274 | Ga0495683_0018685 | |||
| 1275 | Ga0495683_0039873 | |||
| 1276 | Ga0495687_000342 | |||
| 1277 | Ga0495687_004513 | |||
| 1278 | Ga0495687_004776 | |||
| 1279 | Ga0495675_0007299 | |||
| 1280 | Ga0495677_0001477 | |||
| 1281 | Ga0495677_0006592 | |||
| 1282 | Ga0495677_0006999 | |||
| 1283 | Ga0495677_0010091 | |||
| 1284 | Ga0495677_0012355 | |||
| 1285 | Ga0495677_0024474 | |||
| 1286 | Ga0495677_0037947 | |||
| 1287 | Ga0495679_002696 | |||
| 1288 | Ga0495679_017637 | |||
| 1289 | Ga0495679_030597 | |||
| 1290 | Ga0495685_000088 | |||
| 1291 | Ga0495685_011499 | |||
| 1292 | Ga0495685_014285 | |||
| 1293 | Ga0495673_0000179 | |||
| 1294 | Ga0495673_0000201 | |||
| 1295 | Ga0495673_0000248 | |||
| 1296 | Ga0495681_0005506 | |||
| 1297 | Ga0495681_0010017 | |||
| 1298 | Ga0495681_0021685 | |||
| 1299 | Ga0495681_0022753 | |||
| 1300 | Ga0495686_0001233 | |||
| 1301 | Ga0495686_0001635 | |||
| 1302 | Ga0495686_0005028 | |||
| 1303 | Ga0495686_0005717 | |||
| 1304 | Ga0495686_0007524 | |||
| 1305 | Ga0495686_0038847 | |||
| 1306 | Ga0495593_0038046 | |||
| 1307 | Ga0495602_0007222 | |||
| 1308 | Ga0495602_0013945 | |||
| 1309 | Ga0495626_0000105 | |||
| 1310 | Ga0495626_0003195 | |||
| 1311 | Ga0495626_0004624 | |||
| 1312 | Ga0495626_0007526 | |||
| 1313 | Ga0495626_0008438 | |||
| 1314 | Ga0495626_0013805 | |||
| 1315 | Ga0495626_0020787 | |||
| 1316 | Ga0496100_0079681 | |||
| 1317 | Ga0496101_0050820 | |||
| 1318 | Ga0496101_0131960 | |||
| 1319 | Ga0496102_0000074 | |||
| 1320 | Ga0496102_0035650 | |||
| 1321 | Ga0496102_0053103 | |||
| 1322 | Ga0496103_0006538 | |||
| 1323 | Ga0496103_0008145 | |||
| 1324 | Ga0496103_0014695 | |||
| 1325 | Ga0496104_0194987 | |||
| 1326 | Ga0496106_0004887 | |||
| 1327 | Ga0496107_0012263 | |||
| 1328 | Ga0496109_0008098 | |||
| 1329 | Ga0496110_0225442 | |||
| 1330 | Ga0496112_0201043 | |||
| 1331 | Ga0496114_0077089 | |||
| 1332 | Ga0496115_0003466 | |||
| 1333 | Ga0496115_0069468 | |||
| 1334 | Ga0496115_0166843 | |||
| 1335 | Ga0496115_0186331 | |||
| 1336 | Ga0496116_0006192 | |||
| 1337 | Ga0496116_0008873 | |||
| 1338 | Ga0496116_0030804 | |||
| 1339 | Ga0496116_0041864 | |||
| 1340 | Ga0496116_0075259 | |||
| 1341 | Ga0496117_0000005 | |||
| 1342 | Ga0496118_0000031 | |||
| 1343 | Ga0496120_0032282 | |||
| 1344 | Ga0496121_0005140 | |||
| 1345 | Ga0496121_0021381 | |||
| 1346 | Ga0496121_0063402 | |||
| 1347 | Ga0496122_0001099 | |||
| 1348 | Ga0496122_0002483 | |||
| 1349 | Ga0496122_0008145 | |||
| 1350 | Ga0496122_0029016 | |||
| 1351 | Ga0496122_0029365 | |||
| 1352 | Ga0496122_0063214 | |||
| 1353 | Ga0496123_0000953 | |||
| 1354 | Ga0496123_0001525 | |||
| 1355 | Ga0496123_0002484 | |||
| 1356 | Ga0496123_0008730 | |||
| 1357 | Ga0496123_0034932 | |||
| 1358 | Ga0496123_0090250 | |||
| 1359 | Ga0496124_0011035 | |||
| 1360 | Ga0496124_0015786 | |||
| 1361 | Ga0496124_0065544 | |||
| 1362 | Ga0496124_0100008 | |||
| 1363 | Ga0496124_0175953 | |||
| 1364 | Ga0496125_0001223 | |||
| 1365 | Ga0496125_0004256 | |||
| 1366 | Ga0496125_0005020 | |||
| 1367 | Ga0496125_0209664 | |||
| 1368 | Ga0496125_0218857 | |||
| 1369 | Ga0496126_0026304 | |||
| 1370 | Ga0496126_0080496 | |||
| 1371 | Ga0495678_000010 | |||
| 1372 | Ga0495678_000323 | |||
| 1373 | Ga0495678_002976 | |||
| 1374 | Ga0495678_003554 | |||
| 1375 | Ga0495678_005675 | |||
| 1376 | Ga0495678_009409 | |||
| 1377 | Ga0495682_0001031 | |||
| 1378 | Ga0495682_0001462 | |||
| 1379 | Ga0495682_0008902 | |||
| 1380 | Ga0495682_0014460 | |||
| 1381 | Ga0495682_0035157 | |||
| 1382 | Ga0495682_0087443 | |||
| 1383 | Ga0501227_005381 | |||
| 1384 | Ga0501269_001283 | |||
| 1385 | Ga0501279_000496 | |||
| 1386 | Ga0501279_001155 | |||
| 1387 | Ga0501280_000364 | |||
| 1388 | Ga0501035_0010094 | |||
| 1389 | Ga0495601_0001795 | |||
| 1390 | Ga0500594_0004037 | |||
| 1391 | Ga0500595_008802 | |||
| 1392 | Ga0500618_000139 | |||
| 1393 | Ga0500618_001387 | |||
| 1394 | Ga0500618_002238 | |||
| 1395 | Ga0500618_008663 | |||
| 1396 | Ga0500574_000059 | |||
| 1397 | Ga0500586_004334 | |||
| 1398 | Ga0500619_001046 | |||
| 1399 | Ga0466962_0084538 | |||
| 1400 | 2511385238 | |||
| 1401 | 2521559847 | |||
| 1402 | 2553007017 | |||
| 1403 | 2574430277 | |||
| 1404 | 2601667057 | |||
| 1405 | 2643792035 | |||
| 1406 | 2644216483 | |||
| 1407 | 2644254772 | |||
| 1408 | 2644360324 | |||
| 1409 | 2738738079 | |||
| 1410 | 2738826829 | |||
| 1411 | 2738843130 | |||
| 1412 | 2739150626 | |||
| 1413 | 2739192545 | |||
| 1414 | 2739273881 | |||
| 1415 | 2739319022 | |||
| 1416 | 2739337263 | |||
| 1417 | 2739342925 | |||
| 1418 | 2765571106 | |||
| 1419 | 2808985014 | |||
| 1420 | 2809130146 | |||
| 1421 | 2809150377 | |||
| 1422 | 2819544636 | |||
| 1423 | 2819618242 | |||
| 1424 | 2821135837 | |||
| 1425 | 2839098990 | |||
| 1426 | 2842712301 | |||
| 1427 | 2852621399 | |||
| 1428 | 2857549102 | |||
| 1429 | 2857556238 | |||
| 1430 | 2857560838 | |||
| 1431 | 2857568039 | |||
| 1432 | 2885085000 | |||
| 1433 | 2891633872 | |||
| 1434 | 2904428822 | |||
| 1435 | 2904444416 | |||
| 1436 | 2904535569 | |||
| 1437 | 2904588140 | |||
| 1438 | 2904595176 | |||
| 1439 | 2904606089 | |||
| 1440 | 2919049232 | |||
| 1441 | 2919084287 | |||
| 1442 | 2919477004 | |||
| 1443 | 2923513617 | |||
| 1444 | 2928135267 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1kg6-assembly1.cif.gz_A | crystal structure of the k142r mutant of e.coli muty (core fragment) | 0.9671 | 8 | 226 |
| 1muy-assembly1.cif.gz_A-2 | catalytic domain of muty from escherichia coli | 0.967 | 4 | 227 |
| 1weg-assembly1.cif.gz_A | catalytic domain of muty from escherichia coli k142a mutant | 0.9669 | 8 | 227 |
| 1kg7-assembly1.cif.gz_A | crystal structure of the e161a mutant of e.coli muty (core fragment) | 0.9666 | 6 | 226 |
| 1mun-assembly1.cif.gz_A-2 | catalytic domain of muty from escherichia coli d138n mutant | 0.9666 | 4 | 227 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1rrqA02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9729 | 23 | 134 | 1.10.340.30 |
| 1rrqA02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9644 | 23 | 134 | 1.10.340.30 |
| 1kg2A02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9629 | 23 | 134 | 1.10.340.30 |
| 1kg2A02 | Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 | 0.9547 | 23 | 134 | 1.10.340.30 |
| 1weiA01 | Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) | 0.9518 | 137 | 226 | 1.10.1670.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L5DGX0-F1-model_v4 | deleted | 0.9761 | 59 | 160 |
|
| AF-A0A4U9V3Q8-F1-model_v4 | Adenine DNA glycosylase (EC 3.2.2.31) | 0.9738 | 8 | 228 |
GO:0000701
GO:0006284 GO:0006298 GO:0032357 GO:0034039 GO:0035485 GO:0046872 GO:0051539 |
| AF-A0A353Y599-F1-model_v4 | Adenine DNA glycosylase (EC 3.2.2.31) | 0.9729 | 43 | 152 |
GO:0000701
GO:0006284 GO:0006298 GO:0032357 GO:0034039 GO:0035485 GO:0046872 GO:0051536 |
| AF-T1BBA5-F1-model_v4 | Adenine DNA glycosylase | 0.9723 | 53 | 216 |
GO:0000701
GO:0006284 GO:0006298 GO:0032357 GO:0034039 GO:0035485 GO:0046872 GO:0051539 |
| AF-A0A3M9ZLM4-F1-model_v4 | A/G-specific adenine glycosylase | 0.9722 | 121 | 219 |
GO:0000701
GO:0006284 GO:0006298 GO:0032357 GO:0034039 GO:0035485 GO:0046872 GO:0051536 |