F477407
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 722 | 317 | 1444 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100037958|Ga0068853_10003795813 |
| Length | 187 |
| Sequence | MLKGASPLSPLQRTNAGKQKVKNKTMETDQQQWRKLNGQKITRPIEDEVRAAIVREKEMDHELKVCIGTDSQVKGKETEFATVIVFIRKGKGGFMYINNETTLQKMSIKQRMLTEVARSIDIAYALCKIFTVYNVDMEVHADINTNPNFKSNDALKEAMGYIMGMGFVFKAKPEAFASSSCANKIVH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 14 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 17 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 18 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 19 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 20 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 21 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 26 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 38 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 117 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 118 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 121 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 182 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 183 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 184 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 187 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 188 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 189 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 190 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 191 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 192 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 193 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 194 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 195 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 196 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 197 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 203 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 204 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 205 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 209 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 210 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 213 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 214 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 215 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 216 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 217 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 218 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 255 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 256 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 264 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 265 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 271 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 273 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 274 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 276 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 277 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 278 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 279 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 280 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 281 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 282 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 285 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 286 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 287 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 288 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 289 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 291 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 292 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 293 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 294 | 2738541302 | Pedobacter sp. CF074 | Isolate | Unclassified |
| 295 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 296 | 2739367651 | Pedobacter sp. OK291 | Isolate | Unclassified |
| 297 | 2739367663 | Pedobacter sp. YR510 | Isolate | Unclassified |
| 298 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 299 | 2842722452 | Pedobacter sp. R-72249 | Isolate | Unclassified |
| 300 | 2842909656 | Pedobacter sp. R-72393 | Isolate | Unclassified |
| 301 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 302 | 2852627209 | Pedobacter sp. AK017 | Isolate | Rhizosphere |
| 303 | 2857627736 | Pedobacter sp. R-74587 | Isolate | Unclassified |
| 304 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 305 | 2904445276 | Pedobacter terrae 1734 | Isolate | Rhizosphere |
| 306 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 307 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 308 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 309 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 310 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 311 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 312 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 313 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 314 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 315 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 316 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 317 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.26 |
| Metatranscriptomes | 0 |
| Isolates | 3.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.16 |
| Nodule | 0 |
| Rhizoplane | 1.25 |
| Rhizosphere | 76.87 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.4 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068853_100037958 | 3300005539 | Bacteria | 4102 |
| 2 | JGI24740J21852_10013638 | 3300001979 | Bacteria | 3024 |
| 3 | JGI24739J22299_10001281 | 3300001989 | Bacteria | 9459 |
| 4 | JGI24739J22299_10087730 | 3300001989 | Bacteria | 950 |
| 5 | JGI24737J22298_10004450 | 3300001990 | Bacteria | 4883 |
| 6 | JGI24735J21928_10000032 | 3300002067 | Bacteria | 72360 |
| 7 | JGI24744J21845_10019382 | 3300002077 | Bacteria | 1345 |
| 8 | JGI24744J21845_10023239 | 3300002077 | Bacteria | 1214 |
| 9 | JGI24751J29686_10000489 | 3300002459 | Bacteria | 11686 |
| 10 | JGI25162J39368_1000158 | 3300002737 | Bacteria | 74916 |
| 11 | JGI25162J39368_1000435 | 3300002737 | Bacteria | 33619 |
| 12 | JGI25154J39366_1000006 | 3300002738 | Bacteria | 336396 |
| 13 | JGI25157J39369_1003261 | 3300002741 | Bacteria | 3401 |
| 14 | JGI25164J39214_1001299 | 3300002772 | Bacteria | 6315 |
| 15 | JGI25150J39212_1000014 | 3300002774 | Bacteria | 170955 |
| 16 | JGI25151J46595_10000042 | 3300003187 | Bacteria | 170955 |
| 17 | JGI25165J46597_1002884 | 3300003214 | Bacteria | 4886 |
| 18 | JGI25153J46596_10000009 | 3300003215 | Bacteria | 340925 |
| 19 | JGI25153J46596_10003411 | 3300003215 | Bacteria | 8898 |
| 20 | rootH1_10025723 | 3300003316 | Bacteria | 3472 |
| 21 | rootH1_10041946 | 3300003316 | Bacteria | 8448 |
| 22 | rootH1_10045725 | 3300003316 | Bacteria | 1118 |
| 23 | rootH1_10114745 | 3300003316 | Bacteria | 2933 |
| 24 | rootH2_10031022 | 3300003320 | Bacteria | 2690 |
| 25 | rootH2_10094649 | 3300003320 | Bacteria | 8408 |
| 26 | rootH2_10095057 | 3300003320 | Bacteria | 1836 |
| 27 | rootH2_10173572 | 3300003320 | Bacteria | 2846 |
| 28 | rootH2_10209960 | 3300003320 | Bacteria | 6332 |
| 29 | rootL2_10010324 | 3300003322 | Bacteria | 2656 |
| 30 | rootL2_10029471 | 3300003322 | Bacteria | 2469 |
| 31 | rootL2_10059009 | 3300003322 | Bacteria | 1101 |
| 32 | rootL2_10172648 | 3300003322 | Bacteria | 3005 |
| 33 | rootL2_10251193 | 3300003322 | Bacteria | 1763 |
| 34 | rootH1_10003362 | 3300003323 | Bacteria | 34489 |
| 35 | rootH1_10012358 | 3300003323 | Bacteria | 8070 |
| 36 | rootH1_10037051 | 3300003323 | Bacteria | 5243 |
| 37 | rootH1_10063965 | 3300003323 | Bacteria | 1347 |
| 38 | rootH1_10069949 | 3300003323 | Bacteria | 3689 |
| 39 | rootH1_10104896 | 3300003323 | Bacteria | 12365 |
| 40 | JGI25160J50197_1000806 | 3300003354 | Bacteria | 16872 |
| 41 | JGI25160J50197_1003360 | 3300003354 | Bacteria | 7176 |
| 42 | JGI25160J50197_1005685 | 3300003354 | Bacteria | 5152 |
| 43 | JGI25160J50197_1039641 | 3300003354 | Bacteria | 1100 |
| 44 | JGI25160J50197_1043904 | 3300003354 | Bacteria | 1002 |
| 45 | Ga0055526_1017324 | 3300003771 | Bacteria | 2758 |
| 46 | Ga0055526_1024237 | 3300003771 | Bacteria | 1993 |
| 47 | Ga0055526_1034695 | 3300003771 | Bacteria | 1373 |
| 48 | Ga0055528_1000052 | 3300003790 | Bacteria | 91910 |
| 49 | Ga0055530_10000023 | 3300003791 | Bacteria | 135890 |
| 50 | Ga0055530_10010067 | 3300003791 | Bacteria | 3549 |
| 51 | Ga0055531_10000040 | 3300003794 | Bacteria | 139402 |
| 52 | Ga0055531_10035538 | 3300003794 | Bacteria | 1557 |
| 53 | Ga0065165_1000110 | 3300005262 | Bacteria | 137063 |
| 54 | Ga0065165_1003612 | 3300005262 | Bacteria | 10618 |
| 55 | Ga0065714_10002229 | 3300005288 | Bacteria | 47210 |
| 56 | Ga0065714_10003993 | 3300005288 | Bacteria | 5656 |
| 57 | Ga0065714_10004377 | 3300005288 | Bacteria | 14563 |
| 58 | Ga0065714_10082544 | 3300005288 | Bacteria | 2292 |
| 59 | Ga0065714_10166844 | 3300005288 | Bacteria | 1015 |
| 60 | Ga0065714_10173024 | 3300005288 | Bacteria | 996 |
| 61 | Ga0065714_10264010 | 3300005288 | Bacteria | 751 |
| 62 | Ga0065704_10092843 | 3300005289 | Bacteria | 2591 |
| 63 | Ga0065704_10397011 | 3300005289 | Bacteria | 756 |
| 64 | Ga0065715_10581084 | 3300005293 | Bacteria | 720 |
| 65 | Ga0065715_10787153 | 3300005293 | Unclassified | 589 |
| 66 | Ga0065707_10184170 | 3300005295 | Bacteria | 1352 |
| 67 | Ga0070658_10052753 | 3300005327 | Bacteria | 3299 |
| 68 | Ga0070658_10173127 | 3300005327 | Bacteria | 1814 |
| 69 | Ga0070658_10279342 | 3300005327 | Bacteria | 1421 |
| 70 | Ga0070676_10407028 | 3300005328 | Bacteria | 948 |
| 71 | Ga0070683_100790721 | 3300005329 | Bacteria | 909 |
| 72 | Ga0070683_101078088 | 3300005329 | Bacteria | 772 |
| 73 | Ga0070670_100059687 | 3300005331 | Bacteria | 3274 |
| 74 | Ga0070670_100139591 | 3300005331 | Bacteria | 2095 |
| 75 | Ga0070670_100152364 | 3300005331 | Bacteria | 2001 |
| 76 | Ga0070670_100466832 | 3300005331 | Bacteria | 1120 |
| 77 | Ga0070670_100504246 | 3300005331 | Bacteria | 1076 |
| 78 | Ga0068869_100023535 | 3300005334 | Bacteria | 4255 |
| 79 | Ga0068869_100149797 | 3300005334 | Bacteria | 1808 |
| 80 | Ga0070666_10000055 | 3300005335 | Bacteria | 92269 |
| 81 | Ga0070666_10065717 | 3300005335 | Bacteria | 2461 |
| 82 | Ga0070666_10666825 | 3300005335 | Unclassified | 761 |
| 83 | Ga0070682_100000019 | 3300005337 | Bacteria | 220844 |
| 84 | Ga0068868_100019587 | 3300005338 | Bacteria | 5072 |
| 85 | Ga0068868_100225963 | 3300005338 | Bacteria | 1569 |
| 86 | Ga0068868_100921998 | 3300005338 | Bacteria | 795 |
| 87 | Ga0068868_101680884 | 3300005338 | Unclassified | 598 |
| 88 | Ga0070689_101327875 | 3300005340 | Bacteria | 648 |
| 89 | Ga0070691_10153463 | 3300005341 | Bacteria | 1182 |
| 90 | Ga0070687_100030318 | 3300005343 | Bacteria | 2643 |
| 91 | Ga0070668_100072146 | 3300005347 | Bacteria | 2690 |
| 92 | Ga0070668_100885682 | 3300005347 | Bacteria | 797 |
| 93 | Ga0070668_100978830 | 3300005347 | Bacteria | 759 |
| 94 | Ga0070669_100085582 | 3300005353 | Bacteria | 2354 |
| 95 | Ga0070675_100158160 | 3300005354 | Bacteria | 1947 |
| 96 | Ga0070675_101040608 | 3300005354 | Bacteria | 752 |
| 97 | Ga0070671_100158298 | 3300005355 | Bacteria | 1914 |
| 98 | Ga0070674_100251396 | 3300005356 | Bacteria | 1388 |
| 99 | Ga0070673_100134367 | 3300005364 | Bacteria | 2080 |
| 100 | Ga0070673_100753405 | 3300005364 | Bacteria | 897 |
| 101 | Ga0070688_100044820 | 3300005365 | Bacteria | 2730 |
| 102 | Ga0070667_100025668 | 3300005367 | Bacteria | 4899 |
| 103 | Ga0070667_100065423 | 3300005367 | Bacteria | 3087 |
| 104 | Ga0070667_101107613 | 3300005367 | Bacteria | 740 |
| 105 | Ga0070678_100014684 | 3300005456 | Bacteria | 4951 |
| 106 | Ga0070678_100075233 | 3300005456 | Bacteria | 2540 |
| 107 | Ga0070662_100309303 | 3300005457 | Bacteria | 1286 |
| 108 | Ga0068867_100003103 | 3300005459 | Bacteria | 11709 |
| 109 | Ga0068867_100060521 | 3300005459 | Bacteria | 2809 |
| 110 | Ga0068867_100399880 | 3300005459 | Bacteria | 1158 |
| 111 | Ga0068867_100654793 | 3300005459 | Unclassified | 922 |
| 112 | Ga0068867_101098934 | 3300005459 | Unclassified | 726 |
| 113 | Ga0070698_100089438 | 3300005471 | Bacteria | 3063 |
| 114 | Ga0070698_100230697 | 3300005471 | Unclassified | 1784 |
| 115 | Ga0070684_100130010 | 3300005535 | Bacteria | 2271 |
| 116 | Ga0068853_100013083 | 3300005539 | Bacteria | 6768 |
| 117 | Ga0068853_100043617 | 3300005539 | Bacteria | 3837 |
| 118 | Ga0068853_100063772 | 3300005539 | Bacteria | 3192 |
| 119 | Ga0068853_100240331 | 3300005539 | Bacteria | 1660 |
| 120 | Ga0068853_100294305 | 3300005539 | Bacteria | 1499 |
| 121 | Ga0068853_100790472 | 3300005539 | Unclassified | 908 |
| 122 | Ga0070672_100206141 | 3300005543 | Bacteria | 1645 |
| 123 | Ga0070672_101002507 | 3300005543 | Unclassified | 740 |
| 124 | Ga0070686_100730822 | 3300005544 | Bacteria | 792 |
| 125 | Ga0070665_100000002 | 3300005548 | Bacteria | 849037 |
| 126 | Ga0070665_100130946 | 3300005548 | Bacteria | 2511 |
| 127 | Ga0070665_100446258 | 3300005548 | Bacteria | 1303 |
| 128 | Ga0070665_100857818 | 3300005548 | Bacteria | 921 |
| 129 | Ga0068855_100048269 | 3300005563 | Bacteria | 5026 |
| 130 | Ga0068855_100164340 | 3300005563 | Bacteria | 2517 |
| 131 | Ga0068855_100483889 | 3300005563 | Bacteria | 1347 |
| 132 | Ga0068855_100718664 | 3300005563 | Bacteria | 1067 |
| 133 | Ga0070664_100090728 | 3300005564 | Bacteria | 2645 |
| 134 | Ga0070664_100504324 | 3300005564 | Bacteria | 1115 |
| 135 | Ga0068857_100102026 | 3300005577 | Bacteria | 2575 |
| 136 | Ga0068857_100702014 | 3300005577 | Bacteria | 961 |
| 137 | Ga0068857_101439214 | 3300005577 | Unclassified | 671 |
| 138 | Ga0068857_102199457 | 3300005577 | Bacteria | 541 |
| 139 | Ga0068854_100109787 | 3300005578 | Bacteria | 2079 |
| 140 | Ga0068854_100204872 | 3300005578 | Bacteria | 1553 |
| 141 | Ga0068854_100464903 | 3300005578 | Unclassified | 1059 |
| 142 | Ga0068856_100057255 | 3300005614 | Bacteria | 3848 |
| 143 | Ga0068856_101144695 | 3300005614 | Bacteria | 795 |
| 144 | Ga0068852_100141906 | 3300005616 | Bacteria | 2224 |
| 145 | Ga0068859_100000277 | 3300005617 | Bacteria | 51115 |
| 146 | Ga0068859_100009053 | 3300005617 | Bacteria | 10058 |
| 147 | Ga0068859_100015656 | 3300005617 | Bacteria | 7621 |
| 148 | Ga0068859_100032442 | 3300005617 | Bacteria | 5246 |
| 149 | Ga0068859_101123365 | 3300005617 | Unclassified | 865 |
| 150 | Ga0068864_100005341 | 3300005618 | Bacteria | 10523 |
| 151 | Ga0068866_10050384 | 3300005718 | Bacteria | 2114 |
| 152 | Ga0068861_100053131 | 3300005719 | Bacteria | 3082 |
| 153 | Ga0068861_100089084 | 3300005719 | Bacteria | 2432 |
| 154 | Ga0068851_10016333 | 3300005834 | Bacteria | 3551 |
| 155 | Ga0068851_10925510 | 3300005834 | Bacteria | 547 |
| 156 | Ga0068870_10057996 | 3300005840 | Bacteria | 2072 |
| 157 | Ga0068870_10254097 | 3300005840 | Bacteria | 1091 |
| 158 | Ga0068863_100002942 | 3300005841 | Bacteria | 16829 |
| 159 | Ga0068863_100116563 | 3300005841 | Bacteria | 2545 |
| 160 | Ga0068858_100018346 | 3300005842 | Bacteria | 6552 |
| 161 | Ga0068858_100461264 | 3300005842 | Bacteria | 1225 |
| 162 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 163 | Ga0068860_100003395 | 3300005843 | Bacteria | 16381 |
| 164 | Ga0068860_100019995 | 3300005843 | Bacteria | 6489 |
| 165 | Ga0068860_100042420 | 3300005843 | Bacteria | 4345 |
| 166 | Ga0068860_100044983 | 3300005843 | Bacteria | 4208 |
| 167 | Ga0068862_100291784 | 3300005844 | Bacteria | 1498 |
| 168 | Ga0068862_100350383 | 3300005844 | Bacteria | 1370 |
| 169 | Ga0075366_10001459 | 3300006195 | Bacteria | 11776 |
| 170 | Ga0075366_10002138 | 3300006195 | Bacteria | 10053 |
| 171 | Ga0075366_10045092 | 3300006195 | Bacteria | 2613 |
| 172 | Ga0075366_10058126 | 3300006195 | Bacteria | 2297 |
| 173 | Ga0075366_10109626 | 3300006195 | Bacteria | 1660 |
| 174 | Ga0075366_10176600 | 3300006195 | Bacteria | 1297 |
| 175 | Ga0075366_10233428 | 3300006195 | Bacteria | 1121 |
| 176 | Ga0097621_100021186 | 3300006237 | Bacteria | 5023 |
| 177 | Ga0097621_100325358 | 3300006237 | Bacteria | 1362 |
| 178 | Ga0075370_10023668 | 3300006353 | Bacteria | 3385 |
| 179 | Ga0075370_10579866 | 3300006353 | Bacteria | 679 |
| 180 | Ga0068871_100046191 | 3300006358 | Bacteria | 3507 |
| 181 | Ga0068871_100492709 | 3300006358 | Bacteria | 1104 |
| 182 | Ga0068871_100635137 | 3300006358 | Unclassified | 973 |
| 183 | Ga0075428_100056428 | 3300006844 | Bacteria | 4302 |
| 184 | Ga0075430_100020139 | 3300006846 | Bacteria | 5676 |
| 185 | Ga0075431_100016909 | 3300006847 | Bacteria | 7407 |
| 186 | Ga0068865_100002887 | 3300006881 | Bacteria | 10243 |
| 187 | Ga0068865_100153508 | 3300006881 | Bacteria | 1749 |
| 188 | Ga0097620_100000277 | 3300006931 | Bacteria | 51115 |
| 189 | Ga0097620_100009053 | 3300006931 | Bacteria | 10058 |
| 190 | Ga0097620_100015656 | 3300006931 | Bacteria | 7621 |
| 191 | Ga0097620_100032444 | 3300006931 | Bacteria | 5246 |
| 192 | Ga0097620_101123294 | 3300006931 | Unclassified | 865 |
| 193 | Ga0099795_10313134 | 3300007788 | Bacteria | 693 |
| 194 | Ga0105240_10000723 | 3300009093 | Bacteria | 60353 |
| 195 | Ga0105240_10000888 | 3300009093 | Bacteria | 53670 |
| 196 | Ga0105240_10004520 | 3300009093 | Bacteria | 21135 |
| 197 | Ga0105240_10049583 | 3300009093 | Bacteria | 5299 |
| 198 | Ga0105240_10053221 | 3300009093 | Bacteria | 5083 |
| 199 | Ga0105240_10082611 | 3300009093 | Bacteria | 3945 |
| 200 | Ga0105240_10112028 | 3300009093 | Bacteria | 3299 |
| 201 | Ga0105240_10220456 | 3300009093 | Bacteria | 2210 |
| 202 | Ga0105240_10685136 | 3300009093 | Bacteria | 1120 |
| 203 | Ga0105240_10810021 | 3300009093 | Bacteria | 1014 |
| 204 | Ga0111539_10059063 | 3300009094 | Bacteria | 4549 |
| 205 | Ga0105245_10558755 | 3300009098 | Bacteria | 1167 |
| 206 | Ga0105247_10073113 | 3300009101 | Bacteria | 2148 |
| 207 | Ga0105247_10945001 | 3300009101 | Bacteria | 669 |
| 208 | Ga0114129_10014572 | 3300009147 | Bacteria | 11202 |
| 209 | Ga0114129_10065823 | 3300009147 | Bacteria | 5057 |
| 210 | Ga0114129_10080867 | 3300009147 | Bacteria | 4517 |
| 211 | Ga0114129_11192296 | 3300009147 | Bacteria | 949 |
| 212 | Ga0105243_10143189 | 3300009148 | Bacteria | 2042 |
| 213 | Ga0105243_10482600 | 3300009148 | Bacteria | 1170 |
| 214 | Ga0105241_10000649 | 3300009174 | Bacteria | 26087 |
| 215 | Ga0105241_10002426 | 3300009174 | Bacteria | 13985 |
| 216 | Ga0105241_10051301 | 3300009174 | Bacteria | 3146 |
| 217 | Ga0105241_10102014 | 3300009174 | Bacteria | 2282 |
| 218 | Ga0105241_11504267 | 3300009174 | Bacteria | 648 |
| 219 | Ga0105242_10023238 | 3300009176 | Bacteria | 4887 |
| 220 | Ga0105242_10207894 | 3300009176 | Bacteria | 1742 |
| 221 | Ga0105242_10805262 | 3300009176 | Unclassified | 930 |
| 222 | Ga0105242_11041709 | 3300009176 | Unclassified | 829 |
| 223 | Ga0105242_11716770 | 3300009176 | Bacteria | 664 |
| 224 | Ga0105237_10000553 | 3300009545 | Bacteria | 52367 |
| 225 | Ga0105237_10001954 | 3300009545 | Bacteria | 26242 |
| 226 | Ga0105237_10018290 | 3300009545 | Bacteria | 7252 |
| 227 | Ga0105237_10022267 | 3300009545 | Bacteria | 6501 |
| 228 | Ga0105237_10025917 | 3300009545 | Bacteria | 5995 |
| 229 | Ga0105237_10037526 | 3300009545 | Bacteria | 4897 |
| 230 | Ga0105237_10296433 | 3300009545 | Bacteria | 1620 |
| 231 | Ga0105237_10306290 | 3300009545 | Bacteria | 1592 |
| 232 | Ga0105237_10318167 | 3300009545 | Bacteria | 1559 |
| 233 | Ga0105237_10370010 | 3300009545 | Bacteria | 1438 |
| 234 | Ga0105237_10371511 | 3300009545 | Bacteria | 1435 |
| 235 | Ga0105237_11327854 | 3300009545 | Bacteria | 725 |
| 236 | Ga0105237_11401232 | 3300009545 | Bacteria | 705 |
| 237 | Ga0105237_11413473 | 3300009545 | Bacteria | 702 |
| 238 | Ga0105237_11670683 | 3300009545 | Bacteria | 644 |
| 239 | Ga0105237_11997389 | 3300009545 | Unclassified | 588 |
| 240 | Ga0105238_10000195 | 3300009551 | Bacteria | 67049 |
| 241 | Ga0105238_10187799 | 3300009551 | Bacteria | 2043 |
| 242 | Ga0105238_10372469 | 3300009551 | Bacteria | 1418 |
| 243 | Ga0105238_10446326 | 3300009551 | Bacteria | 1290 |
| 244 | Ga0105238_12768677 | 3300009551 | Bacteria | 527 |
| 245 | Ga0105249_10008697 | 3300009553 | Bacteria | 8851 |
| 246 | Ga0105249_10032972 | 3300009553 | Bacteria | 4687 |
| 247 | Ga0105249_10068403 | 3300009553 | Bacteria | 3275 |
| 248 | Ga0105249_10279659 | 3300009553 | Bacteria | 1666 |
| 249 | Ga0105249_10538590 | 3300009553 | Bacteria | 1217 |
| 250 | Ga0105249_10621456 | 3300009553 | Bacteria | 1136 |
| 251 | Ga0105239_10000278 | 3300010375 | Bacteria | 75485 |
| 252 | Ga0105239_10000639 | 3300010375 | Bacteria | 49788 |
| 253 | Ga0105239_10001670 | 3300010375 | Bacteria | 29256 |
| 254 | Ga0105239_10008470 | 3300010375 | Bacteria | 11690 |
| 255 | Ga0105239_10010943 | 3300010375 | Bacteria | 10133 |
| 256 | Ga0105239_10032524 | 3300010375 | Bacteria | 5730 |
| 257 | Ga0105239_10053011 | 3300010375 | Bacteria | 4449 |
| 258 | Ga0105239_10109375 | 3300010375 | Bacteria | 3063 |
| 259 | Ga0105239_10160283 | 3300010375 | Bacteria | 2513 |
| 260 | Ga0105239_10173338 | 3300010375 | Bacteria | 2413 |
| 261 | Ga0105239_10447365 | 3300010375 | Bacteria | 1465 |
| 262 | Ga0105239_10521939 | 3300010375 | Bacteria | 1351 |
| 263 | Ga0105246_10006385 | 3300011119 | Bacteria | 7197 |
| 264 | Ga0105246_10206230 | 3300011119 | Bacteria | 1532 |
| 265 | Ga0105246_10920588 | 3300011119 | Bacteria | 786 |
| 266 | Ga0157373_10000129 | 3300013100 | Bacteria | 59252 |
| 267 | Ga0157373_10096567 | 3300013100 | Bacteria | 2080 |
| 268 | Ga0157371_10000434 | 3300013102 | Bacteria | 51244 |
| 269 | Ga0157371_10004094 | 3300013102 | Bacteria | 12889 |
| 270 | Ga0157371_10024033 | 3300013102 | Bacteria | 4452 |
| 271 | Ga0157371_10042906 | 3300013102 | Bacteria | 3223 |
| 272 | Ga0157371_10384683 | 3300013102 | Bacteria | 1025 |
| 273 | Ga0157370_10075719 | 3300013104 | Bacteria | 3172 |
| 274 | Ga0157370_10080617 | 3300013104 | Bacteria | 3064 |
| 275 | Ga0157370_10205070 | 3300013104 | Bacteria | 1828 |
| 276 | Ga0157370_10663765 | 3300013104 | Bacteria | 953 |
| 277 | Ga0157369_10000897 | 3300013105 | Bacteria | 37997 |
| 278 | Ga0157369_10012221 | 3300013105 | Bacteria | 9749 |
| 279 | Ga0157369_10068299 | 3300013105 | Bacteria | 3818 |
| 280 | Ga0157369_10153961 | 3300013105 | Bacteria | 2429 |
| 281 | Ga0157369_10533412 | 3300013105 | Bacteria | 1214 |
| 282 | Ga0157374_10055399 | 3300013296 | Bacteria | 3701 |
| 283 | Ga0157374_10152653 | 3300013296 | Bacteria | 2246 |
| 284 | Ga0157374_10473867 | 3300013296 | Bacteria | 1255 |
| 285 | Ga0157378_10029953 | 3300013297 | Bacteria | 4806 |
| 286 | Ga0157378_10152500 | 3300013297 | Bacteria | 2154 |
| 287 | Ga0157378_10543237 | 3300013297 | Bacteria | 1166 |
| 288 | Ga0157378_10690216 | 3300013297 | Unclassified | 1039 |
| 289 | Ga0163162_10000172 | 3300013306 | Bacteria | 59926 |
| 290 | Ga0163162_10000712 | 3300013306 | Bacteria | 30828 |
| 291 | Ga0163162_10000903 | 3300013306 | Bacteria | 27662 |
| 292 | Ga0163162_10005458 | 3300013306 | Bacteria | 12284 |
| 293 | Ga0163162_10164814 | 3300013306 | Bacteria | 2340 |
| 294 | Ga0163162_10333231 | 3300013306 | Bacteria | 1650 |
| 295 | Ga0163162_10550122 | 3300013306 | Bacteria | 1282 |
| 296 | Ga0163162_11435622 | 3300013306 | Bacteria | 785 |
| 297 | Ga0163162_12921275 | 3300013306 | Bacteria | 550 |
| 298 | Ga0157372_10008541 | 3300013307 | Bacteria | 10877 |
| 299 | Ga0157372_10013468 | 3300013307 | Bacteria | 8739 |
| 300 | Ga0157372_10054609 | 3300013307 | Bacteria | 4457 |
| 301 | Ga0157372_10253236 | 3300013307 | Bacteria | 2044 |
| 302 | Ga0157372_10299249 | 3300013307 | Bacteria | 1871 |
| 303 | Ga0157372_11570845 | 3300013307 | Unclassified | 757 |
| 304 | Ga0157372_12494068 | 3300013307 | Unclassified | 594 |
| 305 | Ga0157375_10038327 | 3300013308 | Bacteria | 4602 |
| 306 | Ga0157375_10061278 | 3300013308 | Bacteria | 3735 |
| 307 | Ga0157375_10414216 | 3300013308 | Bacteria | 1514 |
| 308 | Ga0157375_10750951 | 3300013308 | Bacteria | 1127 |
| 309 | Ga0157375_11638056 | 3300013308 | Bacteria | 761 |
| 310 | Ga0163163_10092940 | 3300014325 | Bacteria | 3032 |
| 311 | Ga0163163_10414991 | 3300014325 | Bacteria | 1405 |
| 312 | Ga0163163_11309213 | 3300014325 | Bacteria | 787 |
| 313 | Ga0163163_12017212 | 3300014325 | Bacteria | 637 |
| 314 | Ga0182008_10001962 | 3300014497 | Bacteria | 13209 |
| 315 | Ga0182008_10043480 | 3300014497 | Bacteria | 2236 |
| 316 | Ga0182008_10050682 | 3300014497 | Bacteria | 2060 |
| 317 | Ga0182008_10100613 | 3300014497 | Bacteria | 1428 |
| 318 | Ga0182008_10120148 | 3300014497 | Bacteria | 1306 |
| 319 | Ga0157379_10136297 | 3300014968 | Bacteria | 2212 |
| 320 | Ga0157379_10745387 | 3300014968 | Bacteria | 922 |
| 321 | Ga0157379_11181385 | 3300014968 | Bacteria | 735 |
| 322 | Ga0157376_10003160 | 3300014969 | Bacteria | 11316 |
| 323 | Ga0157376_10061623 | 3300014969 | Bacteria | 3154 |
| 324 | Ga0157376_10410196 | 3300014969 | Bacteria | 1312 |
| 325 | Ga0157376_11181469 | 3300014969 | Unclassified | 793 |
| 326 | Ga0182006_1000424 | 3300015261 | Bacteria | 33825 |
| 327 | Ga0182006_1000933 | 3300015261 | Bacteria | 19497 |
| 328 | Ga0182006_1009585 | 3300015261 | Unclassified | 4334 |
| 329 | Ga0182007_10000002 | 3300015262 | Bacteria | 564661 |
| 330 | Ga0182007_10003829 | 3300015262 | Bacteria | 7000 |
| 331 | Ga0182007_10010931 | 3300015262 | Bacteria | 3559 |
| 332 | Ga0182007_10011075 | 3300015262 | Bacteria | 3526 |
| 333 | Ga0183373_1004 | 3300015682 | Bacteria | 537398 |
| 334 | Ga0163161_10003475 | 3300017792 | Bacteria | 11043 |
| 335 | Ga0163161_10028373 | 3300017792 | Bacteria | 3975 |
| 336 | Ga0163161_10048666 | 3300017792 | Bacteria | 3062 |
| 337 | Ga0163161_10187053 | 3300017792 | Bacteria | 1590 |
| 338 | Ga0207427_100644 | 3300025231 | Bacteria | 16924 |
| 339 | Ga0209437_100112 | 3300025233 | Bacteria | 214292 |
| 340 | Ga0209437_100280 | 3300025233 | Bacteria | 74968 |
| 341 | Ga0207425_1000023 | 3300025245 | Bacteria | 341339 |
| 342 | Ga0209646_1000031 | 3300025246 | Bacteria | 381260 |
| 343 | Ga0209646_1000367 | 3300025246 | Bacteria | 29985 |
| 344 | Ga0209026_1000019 | 3300025250 | Bacteria | 381260 |
| 345 | Ga0209026_1004926 | 3300025250 | Bacteria | 3762 |
| 346 | Ga0209129_1000032 | 3300025258 | Bacteria | 341150 |
| 347 | Ga0209129_1006753 | 3300025258 | Bacteria | 3612 |
| 348 | Ga0209233_1000126 | 3300025261 | Bacteria | 214298 |
| 349 | Ga0209673_1000153 | 3300025273 | Bacteria | 146821 |
| 350 | Ga0209673_1081494 | 3300025273 | Unclassified | 740 |
| 351 | Ga0209130_1021066 | 3300025284 | Bacteria | 1479 |
| 352 | Ga0209675_1026200 | 3300025291 | Bacteria | 1456 |
| 353 | Ga0209676_1000009 | 3300025292 | Bacteria | 981719 |
| 354 | Ga0209025_1000047 | 3300025294 | Bacteria | 341150 |
| 355 | Ga0209564_1003629 | 3300025295 | Bacteria | 10258 |
| 356 | Ga0209564_1004828 | 3300025295 | Bacteria | 8026 |
| 357 | Ga0209758_1000145 | 3300025297 | Bacteria | 170553 |
| 358 | Ga0209758_1011031 | 3300025297 | Bacteria | 5294 |
| 359 | Ga0209758_1012964 | 3300025297 | Bacteria | 4601 |
| 360 | Ga0209050_1000094 | 3300025298 | Bacteria | 242893 |
| 361 | Ga0209050_1000377 | 3300025298 | Bacteria | 84222 |
| 362 | Ga0207426_1000189 | 3300025302 | Bacteria | 153457 |
| 363 | Ga0207426_1000327 | 3300025302 | Bacteria | 90905 |
| 364 | Ga0207426_1000774 | 3300025302 | Bacteria | 35182 |
| 365 | Ga0207426_1024631 | 3300025302 | Bacteria | 2039 |
| 366 | Ga0207426_1033757 | 3300025302 | Bacteria | 1647 |
| 367 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 368 | Ga0209257_1000939 | 3300025304 | Bacteria | 40250 |
| 369 | Ga0207656_10033475 | 3300025321 | Bacteria | 2141 |
| 370 | Ga0207682_10149825 | 3300025893 | Bacteria | 1051 |
| 371 | Ga0207682_10446636 | 3300025893 | Bacteria | 612 |
| 372 | Ga0207642_10112818 | 3300025899 | Bacteria | 1387 |
| 373 | Ga0207710_10116912 | 3300025900 | Bacteria | 1270 |
| 374 | Ga0207680_10000021 | 3300025903 | Bacteria | 87712 |
| 375 | Ga0207680_10079032 | 3300025903 | Bacteria | 2062 |
| 376 | Ga0207647_10508702 | 3300025904 | Bacteria | 671 |
| 377 | Ga0207645_10007782 | 3300025907 | Bacteria | 7540 |
| 378 | Ga0207645_10031443 | 3300025907 | Bacteria | 3415 |
| 379 | Ga0207645_10362258 | 3300025907 | Bacteria | 971 |
| 380 | Ga0207643_10050279 | 3300025908 | Bacteria | 2363 |
| 381 | Ga0207643_10074708 | 3300025908 | Bacteria | 1955 |
| 382 | Ga0207643_10216983 | 3300025908 | Bacteria | 1169 |
| 383 | Ga0207705_10040526 | 3300025909 | Bacteria | 3341 |
| 384 | Ga0207705_10399538 | 3300025909 | Bacteria | 1063 |
| 385 | Ga0207654_10000998 | 3300025911 | Bacteria | 15507 |
| 386 | Ga0207654_10001359 | 3300025911 | Bacteria | 12986 |
| 387 | Ga0207654_10005512 | 3300025911 | Bacteria | 6405 |
| 388 | Ga0207654_10445991 | 3300025911 | Bacteria | 907 |
| 389 | Ga0207654_10881501 | 3300025911 | Bacteria | 648 |
| 390 | Ga0207695_10000066 | 3300025913 | Bacteria | 334103 |
| 391 | Ga0207695_10000584 | 3300025913 | Bacteria | 73948 |
| 392 | Ga0207695_10002206 | 3300025913 | Bacteria | 29287 |
| 393 | Ga0207695_10023469 | 3300025913 | Bacteria | 6968 |
| 394 | Ga0207695_10045274 | 3300025913 | Bacteria | 4671 |
| 395 | Ga0207695_10054596 | 3300025913 | Bacteria | 4170 |
| 396 | Ga0207695_10067185 | 3300025913 | Bacteria | 3678 |
| 397 | Ga0207695_10138440 | 3300025913 | Bacteria | 2386 |
| 398 | Ga0207695_10152696 | 3300025913 | Bacteria | 2247 |
| 399 | Ga0207695_10249444 | 3300025913 | Bacteria | 1675 |
| 400 | Ga0207671_10001334 | 3300025914 | Bacteria | 28837 |
| 401 | Ga0207671_10001523 | 3300025914 | Bacteria | 26590 |
| 402 | Ga0207671_10001555 | 3300025914 | Bacteria | 26264 |
| 403 | Ga0207671_10002227 | 3300025914 | Bacteria | 21018 |
| 404 | Ga0207671_10008405 | 3300025914 | Bacteria | 8762 |
| 405 | Ga0207671_10025287 | 3300025914 | Bacteria | 4459 |
| 406 | Ga0207671_10032955 | 3300025914 | Bacteria | 3856 |
| 407 | Ga0207671_10183657 | 3300025914 | Bacteria | 1628 |
| 408 | Ga0207671_10521911 | 3300025914 | Bacteria | 947 |
| 409 | Ga0207671_10847824 | 3300025914 | Bacteria | 724 |
| 410 | Ga0207671_10871985 | 3300025914 | Bacteria | 712 |
| 411 | Ga0207662_10285354 | 3300025918 | Bacteria | 1094 |
| 412 | Ga0207649_10717916 | 3300025920 | Bacteria | 776 |
| 413 | Ga0207681_10072538 | 3300025923 | Bacteria | 2405 |
| 414 | Ga0207681_10994845 | 3300025923 | Bacteria | 703 |
| 415 | Ga0207694_10003880 | 3300025924 | Bacteria | 11819 |
| 416 | Ga0207694_10315185 | 3300025924 | Bacteria | 1290 |
| 417 | Ga0207694_10721828 | 3300025924 | Unclassified | 841 |
| 418 | Ga0207694_10773197 | 3300025924 | Bacteria | 811 |
| 419 | Ga0207650_10071007 | 3300025925 | Bacteria | 2618 |
| 420 | Ga0207650_10084800 | 3300025925 | Bacteria | 2409 |
| 421 | Ga0207650_10157349 | 3300025925 | Bacteria | 1798 |
| 422 | Ga0207650_10193185 | 3300025925 | Bacteria | 1627 |
| 423 | Ga0207650_10261752 | 3300025925 | Bacteria | 1403 |
| 424 | Ga0207650_10512997 | 3300025925 | Bacteria | 1003 |
| 425 | Ga0207659_10222240 | 3300025926 | Bacteria | 1519 |
| 426 | Ga0207659_10698447 | 3300025926 | Bacteria | 868 |
| 427 | Ga0207659_11269168 | 3300025926 | Bacteria | 633 |
| 428 | Ga0207687_10146612 | 3300025927 | Bacteria | 1796 |
| 429 | Ga0207644_10069491 | 3300025931 | Bacteria | 2572 |
| 430 | Ga0207644_10562253 | 3300025931 | Bacteria | 945 |
| 431 | Ga0207644_10764547 | 3300025931 | Bacteria | 807 |
| 432 | Ga0207706_10273070 | 3300025933 | Bacteria | 1475 |
| 433 | Ga0207686_10048430 | 3300025934 | Bacteria | 2633 |
| 434 | Ga0207686_10783325 | 3300025934 | Unclassified | 763 |
| 435 | Ga0207686_11172099 | 3300025934 | Bacteria | 628 |
| 436 | Ga0207709_10653989 | 3300025935 | Bacteria | 837 |
| 437 | Ga0207670_10559598 | 3300025936 | Unclassified | 935 |
| 438 | Ga0207669_11223826 | 3300025937 | Bacteria | 636 |
| 439 | Ga0207704_10400779 | 3300025938 | Bacteria | 1083 |
| 440 | Ga0207704_10785479 | 3300025938 | Bacteria | 794 |
| 441 | Ga0207704_11152740 | 3300025938 | Bacteria | 660 |
| 442 | Ga0207691_10030848 | 3300025940 | Bacteria | 5007 |
| 443 | Ga0207689_10003569 | 3300025942 | Bacteria | 14211 |
| 444 | Ga0207689_10004792 | 3300025942 | Bacteria | 12199 |
| 445 | Ga0207689_10061587 | 3300025942 | Bacteria | 3086 |
| 446 | Ga0207661_10178323 | 3300025944 | Bacteria | 1854 |
| 447 | Ga0207679_10303682 | 3300025945 | Bacteria | 1377 |
| 448 | Ga0207667_10045224 | 3300025949 | Bacteria | 4664 |
| 449 | Ga0207667_10258630 | 3300025949 | Bacteria | 1780 |
| 450 | Ga0207667_10741936 | 3300025949 | Bacteria | 982 |
| 451 | Ga0207667_11031842 | 3300025949 | Bacteria | 808 |
| 452 | Ga0207651_10216206 | 3300025960 | Bacteria | 1546 |
| 453 | Ga0207712_10039537 | 3300025961 | Bacteria | 3232 |
| 454 | Ga0207712_10063573 | 3300025961 | Bacteria | 2628 |
| 455 | Ga0207712_10237463 | 3300025961 | Bacteria | 1466 |
| 456 | Ga0207712_10438831 | 3300025961 | Bacteria | 1105 |
| 457 | Ga0207668_10210003 | 3300025972 | Bacteria | 1556 |
| 458 | Ga0207668_10419762 | 3300025972 | Unclassified | 1135 |
| 459 | Ga0207668_10614998 | 3300025972 | Bacteria | 948 |
| 460 | Ga0207640_10098919 | 3300025981 | Bacteria | 2041 |
| 461 | Ga0207640_10978358 | 3300025981 | Bacteria | 743 |
| 462 | Ga0207640_10981619 | 3300025981 | Unclassified | 742 |
| 463 | Ga0207658_10072295 | 3300025986 | Bacteria | 2614 |
| 464 | Ga0207658_10158923 | 3300025986 | Bacteria | 1850 |
| 465 | Ga0207658_10354617 | 3300025986 | Bacteria | 1278 |
| 466 | Ga0207658_10509362 | 3300025986 | Bacteria | 1073 |
| 467 | Ga0207658_10999760 | 3300025986 | Unclassified | 763 |
| 468 | Ga0207677_10515599 | 3300026023 | Bacteria | 1036 |
| 469 | Ga0207677_11051486 | 3300026023 | Bacteria | 740 |
| 470 | Ga0207703_10020234 | 3300026035 | Bacteria | 5204 |
| 471 | Ga0207639_10009954 | 3300026041 | Bacteria | 6570 |
| 472 | Ga0207639_10019123 | 3300026041 | Bacteria | 4879 |
| 473 | Ga0207639_10100567 | 3300026041 | Bacteria | 2336 |
| 474 | Ga0207639_10989130 | 3300026041 | Bacteria | 788 |
| 475 | Ga0207702_10089284 | 3300026078 | Bacteria | 2695 |
| 476 | Ga0207702_10851182 | 3300026078 | Bacteria | 903 |
| 477 | Ga0207641_10000442 | 3300026088 | Bacteria | 47467 |
| 478 | Ga0207648_10013029 | 3300026089 | Bacteria | 7755 |
| 479 | Ga0207648_10013798 | 3300026089 | Bacteria | 7495 |
| 480 | Ga0207648_10039298 | 3300026089 | Bacteria | 4161 |
| 481 | Ga0207648_10460033 | 3300026089 | Bacteria | 1160 |
| 482 | Ga0207676_10035648 | 3300026095 | Bacteria | 3778 |
| 483 | Ga0207674_10186682 | 3300026116 | Bacteria | 2023 |
| 484 | Ga0207674_10298966 | 3300026116 | Bacteria | 1559 |
| 485 | Ga0207674_10801592 | 3300026116 | Bacteria | 909 |
| 486 | Ga0207674_10819584 | 3300026116 | Bacteria | 898 |
| 487 | Ga0207675_100019149 | 3300026118 | Bacteria | 6389 |
| 488 | Ga0207675_100057704 | 3300026118 | Bacteria | 3622 |
| 489 | Ga0207683_10003429 | 3300026121 | Bacteria | 13817 |
| 490 | Ga0207683_10214089 | 3300026121 | Unclassified | 1754 |
| 491 | Ga0207698_10008108 | 3300026142 | Bacteria | 6621 |
| 492 | Ga0207698_10261550 | 3300026142 | Bacteria | 1590 |
| 493 | Ga0207698_10543695 | 3300026142 | Unclassified | 1137 |
| 494 | Ga0207698_10894005 | 3300026142 | Unclassified | 895 |
| 495 | Ga0207428_10398877 | 3300027907 | Bacteria | 1007 |
| 496 | Ga0268266_10000073 | 3300028379 | Bacteria | 232074 |
| 497 | Ga0268266_10169232 | 3300028379 | Bacteria | 1982 |
| 498 | Ga0268266_11202050 | 3300028379 | Bacteria | 733 |
| 499 | Ga0268265_10158250 | 3300028380 | Bacteria | 1920 |
| 500 | Ga0268265_10217316 | 3300028380 | Bacteria | 1670 |
| 501 | Ga0268264_10000063 | 3300028381 | Bacteria | 301702 |
| 502 | Ga0268264_10002719 | 3300028381 | Bacteria | 15431 |
| 503 | Ga0268264_10041539 | 3300028381 | Bacteria | 3805 |
| 504 | Ga0307517_10000977 | 3300028786 | Bacteria | 48466 |
| 505 | Ga0307517_10061770 | 3300028786 | Bacteria | 3538 |
| 506 | Ga0307517_10379227 | 3300028786 | Bacteria | 756 |
| 507 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 508 | Ga0307515_10000226 | 3300028794 | Bacteria | 139533 |
| 509 | Ga0307515_10001233 | 3300028794 | Bacteria | 58397 |
| 510 | Ga0307515_10001257 | 3300028794 | Bacteria | 57814 |
| 511 | Ga0307515_10142160 | 3300028794 | Bacteria | 2567 |
| 512 | Ga0316181_1215835 | 3300030744 | Bacteria | 1369 |
| 513 | Ga0265327_10000207 | 3300031251 | Bacteria | 123193 |
| 514 | Ga0265327_10222317 | 3300031251 | Bacteria | 849 |
| 515 | Ga0265327_10233669 | 3300031251 | Unclassified | 823 |
| 516 | Ga0307513_10025829 | 3300031456 | Bacteria | 6791 |
| 517 | Ga0307513_10618909 | 3300031456 | Bacteria | 791 |
| 518 | Ga0307509_10049214 | 3300031507 | Bacteria | 4521 |
| 519 | Ga0307516_10001351 | 3300031730 | Bacteria | 34045 |
| 520 | Ga0307516_10234883 | 3300031730 | Bacteria | 1535 |
| 521 | Ga0307516_10498652 | 3300031730 | Bacteria | 872 |
| 522 | Ga0307405_10000015 | 3300031731 | Bacteria | 206299 |
| 523 | Ga0307518_10164697 | 3300031838 | Bacteria | 1519 |
| 524 | Ga0307407_10000054 | 3300031903 | Bacteria | 49850 |
| 525 | Ga0307412_10060106 | 3300031911 | Bacteria | 2550 |
| 526 | Ga0307412_10078268 | 3300031911 | Bacteria | 2277 |
| 527 | Ga0307409_100096415 | 3300031995 | Bacteria | 2440 |
| 528 | Ga0307416_100000002 | 3300032002 | Bacteria | 509907 |
| 529 | Ga0307416_100337582 | 3300032002 | Bacteria | 1518 |
| 530 | Ga0307414_10015327 | 3300032004 | Bacteria | 4627 |
| 531 | Ga0307414_10272503 | 3300032004 | Unclassified | 1418 |
| 532 | Ga0307414_10526878 | 3300032004 | Bacteria | 1049 |
| 533 | Ga0307414_10682354 | 3300032004 | Bacteria | 929 |
| 534 | Ga0307414_10720626 | 3300032004 | Bacteria | 904 |
| 535 | Ga0307414_10737524 | 3300032004 | Bacteria | 894 |
| 536 | Ga0307411_10107157 | 3300032005 | Bacteria | 1991 |
| 537 | Ga0307411_10569660 | 3300032005 | Bacteria | 969 |
| 538 | Ga0307507_10000071 | 3300033179 | Bacteria | 158391 |
| 539 | Ga0307507_10076866 | 3300033179 | Bacteria | 2974 |
| 540 | Ga0307510_10137642 | 3300033180 | Bacteria | 2095 |
| 541 | Ga0395899_0255750 | 3300037312 | Bacteria | 1200 |
| 542 | Ga0395900_0218744 | 3300037418 | Bacteria | 1921 |
| 543 | Ga0395905_0000587 | 3300037471 | Bacteria | 48840 |
| 544 | Ga0395901_0074078 | 3300038443 | Bacteria | 3552 |
| 545 | Ga0395901_1055859 | 3300038443 | Bacteria | 785 |
| 546 | Ga0439436_0006956 | 3300041404 | Bacteria | 3479 |
| 547 | Ga0439436_0030120 | 3300041404 | Bacteria | 1578 |
| 548 | Ga0439439_0015934 | 3300041406 | Bacteria | 1837 |
| 549 | Ga0439465_0119785 | 3300041413 | Bacteria | 922 |
| 550 | Ga0451789_0865262 | 3300041443 | Bacteria | 669 |
| 551 | Ga0451793_0312842 | 3300041452 | Bacteria | 1012 |
| 552 | Ga0451802_0156129 | 3300041460 | Bacteria | 812 |
| 553 | Ga0451802_1657172 | 3300041460 | Unclassified | 785 |
| 554 | Ga0451833_0715189 | 3300041491 | Bacteria | 819 |
| 555 | Ga0451841_1051963 | 3300041498 | Bacteria | 626 |
| 556 | Ga0451843_0589972 | 3300041509 | Bacteria | 606 |
| 557 | Ga0451853_0732439 | 3300041512 | Bacteria | 605 |
| 558 | Ga0439449_0083369 | 3300042007 | Bacteria | 1179 |
| 559 | Ga0439449_0140358 | 3300042007 | Bacteria | 899 |
| 560 | Ga0439449_0142576 | 3300042007 | Bacteria | 892 |
| 561 | Ga0439454_048827 | 3300042011 | Bacteria | 710 |
| 562 | Ga0439457_017524 | 3300042014 | Bacteria | 1590 |
| 563 | Ga0439462_0007680 | 3300042015 | Bacteria | 2705 |
| 564 | Ga0466972_0000047 | 3300044658 | Bacteria | 122901 |
| 565 | Ga0466972_0014023 | 3300044658 | Bacteria | 4018 |
| 566 | Ga0466972_0165266 | 3300044658 | Bacteria | 1039 |
| 567 | Ga0453683_0913869 | 3300044673 | Bacteria | 580 |
| 568 | Ga0466957_0053539 | 3300044842 | Bacteria | 2461 |
| 569 | Ga0466959_0208363 | 3300045049 | Bacteria | 1359 |
| 570 | Ga0451576_0379460 | 3300045051 | Bacteria | 1482 |
| 571 | Ga0495638_0223679 | 3300046460 | Bacteria | 1051 |
| 572 | Ga0495638_0224002 | 3300046460 | Bacteria | 1050 |
| 573 | Ga0495651_0238071 | 3300046462 | Bacteria | 1250 |
| 574 | Ga0495650_0000231 | 3300046471 | Bacteria | 113969 |
| 575 | Ga0495650_0061456 | 3300046471 | Bacteria | 1505 |
| 576 | Ga0495650_0134795 | 3300046471 | Bacteria | 898 |
| 577 | Ga0495585_0000037 | 3300046492 | Bacteria | 133335 |
| 578 | Ga0495585_0036583 | 3300046492 | Bacteria | 2767 |
| 579 | Ga0495583_0024158 | 3300046506 | Bacteria | 3060 |
| 580 | Ga0495583_0050433 | 3300046506 | Bacteria | 1902 |
| 581 | Ga0495606_0000060 | 3300046507 | Bacteria | 185907 |
| 582 | Ga0495606_0006447 | 3300046507 | Bacteria | 10820 |
| 583 | Ga0495606_0015551 | 3300046507 | Bacteria | 5854 |
| 584 | Ga0495606_0015896 | 3300046507 | Bacteria | 5774 |
| 585 | Ga0495606_0048673 | 3300046507 | Bacteria | 2786 |
| 586 | Ga0495606_0189450 | 3300046507 | Bacteria | 1180 |
| 587 | Ga0495606_0207278 | 3300046507 | Bacteria | 1113 |
| 588 | Ga0495610_0002646 | 3300046512 | Bacteria | 14803 |
| 589 | Ga0495610_0005229 | 3300046512 | Bacteria | 9287 |
| 590 | Ga0495610_0123835 | 3300046512 | Bacteria | 1130 |
| 591 | Ga0495616_0001826 | 3300046513 | Bacteria | 14422 |
| 592 | Ga0495616_0267664 | 3300046513 | Bacteria | 729 |
| 593 | Ga0495618_0456515 | 3300046514 | Bacteria | 775 |
| 594 | Ga0495631_0149088 | 3300046518 | Bacteria | 1004 |
| 595 | Ga0495632_0209510 | 3300046519 | Bacteria | 885 |
| 596 | Ga0495637_0053299 | 3300046520 | Bacteria | 1684 |
| 597 | Ga0495637_0139350 | 3300046520 | Bacteria | 921 |
| 598 | Ga0495648_0005678 | 3300046524 | Bacteria | 10323 |
| 599 | Ga0495648_0033309 | 3300046524 | Bacteria | 3366 |
| 600 | Ga0495648_0073670 | 3300046524 | Bacteria | 1970 |
| 601 | Ga0495652_0643463 | 3300046529 | Bacteria | 719 |
| 602 | Ga0495652_0703701 | 3300046529 | Bacteria | 680 |
| 603 | Ga0495654_0024364 | 3300046530 | Bacteria | 3128 |
| 604 | Ga0495609_0024317 | 3300046538 | Bacteria | 2779 |
| 605 | Ga0495609_0062437 | 3300046538 | Bacteria | 1645 |
| 606 | Ga0495609_0196532 | 3300046538 | Bacteria | 844 |
| 607 | Ga0495609_0275331 | 3300046538 | Bacteria | 689 |
| 608 | Ga0495622_0105799 | 3300046557 | Bacteria | 1289 |
| 609 | Ga0495633_0000072 | 3300046558 | Bacteria | 131197 |
| 610 | Ga0495633_0014130 | 3300046558 | Bacteria | 4184 |
| 611 | Ga0495633_0062664 | 3300046558 | Bacteria | 1741 |
| 612 | Ga0495668_0000075 | 3300046616 | Bacteria | 163092 |
| 613 | Ga0495668_0000202 | 3300046616 | Bacteria | 87083 |
| 614 | Ga0495668_0003041 | 3300046616 | Bacteria | 13056 |
| 615 | Ga0495668_0702833 | 3300046616 | Bacteria | 559 |
| 616 | Ga0495611_0000037 | 3300046648 | Bacteria | 101602 |
| 617 | Ga0495611_0031426 | 3300046648 | Bacteria | 2337 |
| 618 | Ga0495625_0000191 | 3300046660 | Bacteria | 97363 |
| 619 | Ga0495625_0000456 | 3300046660 | Bacteria | 61289 |
| 620 | Ga0495625_0000647 | 3300046660 | Bacteria | 50043 |
| 621 | Ga0495625_0145010 | 3300046660 | Unclassified | 1599 |
| 622 | Ga0495625_0188031 | 3300046660 | Bacteria | 1369 |
| 623 | Ga0495625_0245557 | 3300046660 | Bacteria | 1164 |
| 624 | Ga0495661_0005895 | 3300046665 | Bacteria | 8658 |
| 625 | Ga0495658_0075575 | 3300046683 | Bacteria | 1966 |
| 626 | Ga0495671_0040970 | 3300046692 | Bacteria | 2334 |
| 627 | Ga0495649_0000061 | 3300046694 | Bacteria | 97338 |
| 628 | Ga0495660_0031991 | 3300046810 | Bacteria | 2956 |
| 629 | Ga0495660_0164422 | 3300046810 | Bacteria | 1086 |
| 630 | Ga0495687_000040 | 3300047443 | Bacteria | 230786 |
| 631 | Ga0495687_026691 | 3300047443 | Bacteria | 2714 |
| 632 | Ga0495679_022042 | 3300047446 | Bacteria | 2187 |
| 633 | Ga0495673_0058384 | 3300047469 | Bacteria | 1663 |
| 634 | Ga0495686_0008285 | 3300047472 | Bacteria | 7649 |
| 635 | Ga0495686_0090771 | 3300047472 | Bacteria | 1855 |
| 636 | Ga0495686_0097072 | 3300047472 | Bacteria | 1782 |
| 637 | Ga0495686_0190399 | 3300047472 | Bacteria | 1183 |
| 638 | Ga0495686_0252711 | 3300047472 | Bacteria | 990 |
| 639 | Ga0495686_0276818 | 3300047472 | Unclassified | 934 |
| 640 | Ga0496101_0136559 | 3300048904 | Bacteria | 1866 |
| 641 | Ga0496104_1413479 | 3300048907 | Bacteria | 599 |
| 642 | Ga0496108_0554322 | 3300048911 | Bacteria | 1003 |
| 643 | Ga0496115_0887871 | 3300048918 | Bacteria | 688 |
| 644 | Ga0496126_0041489 | 3300048929 | Bacteria | 4258 |
| 645 | Ga0496126_1067745 | 3300048929 | Bacteria | 602 |
| 646 | Ga0495682_0016218 | 3300049460 | Bacteria | 2820 |
| 647 | Ga0501033_0392167 | 3300049570 | Bacteria | 969 |
| 648 | Ga0501034_1552981 | 3300049571 | Bacteria | 535 |
| 649 | Ga0501043_0505350 | 3300049579 | Bacteria | 903 |
| 650 | Ga0501043_0772173 | 3300049579 | Bacteria | 697 |
| 651 | Ga0501047_0059811 | 3300049581 | Bacteria | 3679 |
| 652 | Ga0501225_0004953 | 3300049705 | Bacteria | 3934 |
| 653 | Ga0501083_0363763 | 3300049744 | Bacteria | 941 |
| 654 | nmdc:mga0k408_12291_c1 | 3300050493 | Bacteria | 4678 |
| 655 | nmdc:mga0k408_12445_c1 | 3300050493 | Bacteria | 4651 |
| 656 | nmdc:mga0k408_32355_c1 | 3300050493 | Bacteria | 2988 |
| 657 | nmdc:mga0k408_339240_c1 | 3300050493 | Bacteria | 896 |
| 658 | nmdc:mga0k408_34488_c1 | 3300050493 | Bacteria | 2897 |
| 659 | nmdc:mga0k408_378_c2 | 3300050493 | Bacteria | 19990 |
| 660 | nmdc:mga0k408_418_c1 | 3300050493 | Bacteria | 23203 |
| 661 | nmdc:mga07m45_516504_c1 | 3300050496 | Bacteria | 691 |
| 662 | nmdc:mga07m45_553369_c1 | 3300050496 | Bacteria | 665 |
| 663 | nmdc:mga05p37_12431_c1 | 3300050507 | Bacteria | 10168 |
| 664 | nmdc:mga05p37_55446_c1 | 3300050507 | Bacteria | 4877 |
| 665 | nmdc:mga09592_273717_c1 | 3300050508 | Bacteria | 1465 |
| 666 | nmdc:mga0qj67_103683_c1 | 3300050509 | Bacteria | 2295 |
| 667 | nmdc:mga06r32_206037_c1 | 3300050510 | Bacteria | 1955 |
| 668 | nmdc:mga08y16_254570_c1 | 3300050511 | Bacteria | 1814 |
| 669 | Ga0500578_0000060 | 3300053086 | Bacteria | 118274 |
| 670 | Ga0500644_0000236 | 3300053088 | Bacteria | 31387 |
| 671 | Ga0500646_0045888 | 3300053090 | Bacteria | 1245 |
| 672 | Ga0500583_0000003 | 3300053092 | Bacteria | 229587 |
| 673 | Ga0500583_0010030 | 3300053092 | Bacteria | 3493 |
| 674 | Ga0500555_020857 | 3300053103 | Bacteria | 1888 |
| 675 | Ga0500556_0296305 | 3300053104 | Bacteria | 633 |
| 676 | Ga0500594_0063601 | 3300053118 | Bacteria | 1069 |
| 677 | Ga0500608_073061 | 3300053122 | Bacteria | 1629 |
| 678 | Ga0500618_000005 | 3300053125 | Bacteria | 253092 |
| 679 | Ga0500642_0435949 | 3300053130 | Unclassified | 565 |
| 680 | Ga0500652_000379 | 3300053131 | Bacteria | 16007 |
| 681 | Ga0500652_055935 | 3300053131 | Bacteria | 1618 |
| 682 | Ga0500655_020531 | 3300053133 | Bacteria | 1235 |
| 683 | Ga0500658_0545022 | 3300053134 | Bacteria | 522 |
| 684 | Ga0500564_085137 | 3300053138 | Bacteria | 1413 |
| 685 | Ga0500588_0083659 | 3300053146 | Unclassified | 1072 |
| 686 | Ga0500588_0161721 | 3300053146 | Bacteria | 815 |
| 687 | Ga0500616_0318500 | 3300053153 | Unclassified | 641 |
| 688 | Ga0500622_0000414 | 3300053156 | Bacteria | 40619 |
| 689 | Ga0500622_0001836 | 3300053156 | Bacteria | 16083 |
| 690 | Ga0500622_0002735 | 3300053156 | Bacteria | 12450 |
| 691 | Ga0500622_0140036 | 3300053156 | Bacteria | 1154 |
| 692 | Ga0500633_0000217 | 3300053160 | Bacteria | 8097 |
| 693 | Ga0500639_317878 | 3300053163 | Bacteria | 573 |
| 694 | Ga0500636_0111725 | 3300053177 | Bacteria | 1543 |
| 695 | Ga0500637_0315568 | 3300053178 | Bacteria | 847 |
| 696 | 2586206326 | 2585427687 | Bacteria | 5544917 |
| 697 | 2599481455 | 2599185184 | Bacteria | 6430550 |
| 698 | 2738725761 | 2738541278 | Bacteria | 9755573 |
| 699 | 2738856119 | 2738541302 | Bacteria | 5944758 |
| 700 | 2739303127 | 2738543023 | Bacteria | 6767879 |
| 701 | 2739588310 | 2739367651 | Bacteria | 6359826 |
| 702 | 2739648593 | 2739367663 | Bacteria | 5040914 |
| 703 | 2819546292 | 2818991437 | Bacteria | 5805520 |
| 704 | 2842723870 | 2842722452 | Bacteria | 6263924 |
| 705 | 2842912399 | 2842909656 | Bacteria | 6185908 |
| 706 | 2849282818 | 2849281842 | Bacteria | 6065644 |
| 707 | 2852631914 | 2852627209 | Bacteria | 5896285 |
| 708 | 2857629255 | 2857627736 | Bacteria | 5625397 |
| 709 | 2902053072 | 2902048731 | Bacteria | 4976191 |
| 710 | 2904446571 | 2904445276 | Bacteria | 5310396 |
| 711 | 2904783819 | 2904780799 | Bacteria | 5840761 |
| 712 | 2919181933 | 2919177583 | Bacteria | 5641607 |
| 713 | 2919190210 | 2919186247 | Bacteria | 6244071 |
| 714 | 2928083241 | 2928078545 | Bacteria | 6534839 |
| 715 | 2928152705 | 2928147474 | Bacteria | 6512076 |
| 716 | 2929921596 | 2929921140 | Bacteria | 8649150 |
| 717 | 2932086489 | 2932082852 | Bacteria | 6563563 |
| 718 | 2939668491 | 2939664404 | Bacteria | 6364494 |
| 719 | 2945999374 | 2945997725 | Bacteria | 6404843 |
| 720 | 2954021782 | 2954016120 | Bacteria | 6446024 |
| 721 | 8003152940 | 8003151029 | Bacteria | 8187759 |
| 722 | 8055591995 | 8055588893 | Bacteria | 3619545 |
| 723 | Ga0068853_100037958 | |||
| 724 | JGI24740J21852_10013638 | |||
| 725 | JGI24739J22299_10001281 | |||
| 726 | JGI24739J22299_10087730 | |||
| 727 | JGI24737J22298_10004450 | |||
| 728 | JGI24735J21928_10000032 | |||
| 729 | JGI24744J21845_10019382 | |||
| 730 | JGI24744J21845_10023239 | |||
| 731 | JGI24751J29686_10000489 | |||
| 732 | JGI25162J39368_1000158 | |||
| 733 | JGI25162J39368_1000435 | |||
| 734 | JGI25154J39366_1000006 | |||
| 735 | JGI25157J39369_1003261 | |||
| 736 | JGI25164J39214_1001299 | |||
| 737 | JGI25150J39212_1000014 | |||
| 738 | JGI25151J46595_10000042 | |||
| 739 | JGI25165J46597_1002884 | |||
| 740 | JGI25153J46596_10000009 | |||
| 741 | JGI25153J46596_10003411 | |||
| 742 | rootH1_10025723 | |||
| 743 | rootH1_10041946 | |||
| 744 | rootH1_10045725 | |||
| 745 | rootH1_10114745 | |||
| 746 | rootH2_10031022 | |||
| 747 | rootH2_10094649 | |||
| 748 | rootH2_10095057 | |||
| 749 | rootH2_10173572 | |||
| 750 | rootH2_10209960 | |||
| 751 | rootL2_10010324 | |||
| 752 | rootL2_10029471 | |||
| 753 | rootL2_10059009 | |||
| 754 | rootL2_10172648 | |||
| 755 | rootL2_10251193 | |||
| 756 | rootH1_10003362 | |||
| 757 | rootH1_10012358 | |||
| 758 | rootH1_10037051 | |||
| 759 | rootH1_10063965 | |||
| 760 | rootH1_10069949 | |||
| 761 | rootH1_10104896 | |||
| 762 | JGI25160J50197_1000806 | |||
| 763 | JGI25160J50197_1003360 | |||
| 764 | JGI25160J50197_1005685 | |||
| 765 | JGI25160J50197_1039641 | |||
| 766 | JGI25160J50197_1043904 | |||
| 767 | Ga0055526_1017324 | |||
| 768 | Ga0055526_1024237 | |||
| 769 | Ga0055526_1034695 | |||
| 770 | Ga0055528_1000052 | |||
| 771 | Ga0055530_10000023 | |||
| 772 | Ga0055530_10010067 | |||
| 773 | Ga0055531_10000040 | |||
| 774 | Ga0055531_10035538 | |||
| 775 | Ga0065165_1000110 | |||
| 776 | Ga0065165_1003612 | |||
| 777 | Ga0065714_10002229 | |||
| 778 | Ga0065714_10003993 | |||
| 779 | Ga0065714_10004377 | |||
| 780 | Ga0065714_10082544 | |||
| 781 | Ga0065714_10166844 | |||
| 782 | Ga0065714_10173024 | |||
| 783 | Ga0065714_10264010 | |||
| 784 | Ga0065704_10092843 | |||
| 785 | Ga0065704_10397011 | |||
| 786 | Ga0065715_10581084 | |||
| 787 | Ga0065715_10787153 | |||
| 788 | Ga0065707_10184170 | |||
| 789 | Ga0070658_10052753 | |||
| 790 | Ga0070658_10173127 | |||
| 791 | Ga0070658_10279342 | |||
| 792 | Ga0070676_10407028 | |||
| 793 | Ga0070683_100790721 | |||
| 794 | Ga0070683_101078088 | |||
| 795 | Ga0070670_100059687 | |||
| 796 | Ga0070670_100139591 | |||
| 797 | Ga0070670_100152364 | |||
| 798 | Ga0070670_100466832 | |||
| 799 | Ga0070670_100504246 | |||
| 800 | Ga0068869_100023535 | |||
| 801 | Ga0068869_100149797 | |||
| 802 | Ga0070666_10000055 | |||
| 803 | Ga0070666_10065717 | |||
| 804 | Ga0070666_10666825 | |||
| 805 | Ga0070682_100000019 | |||
| 806 | Ga0068868_100019587 | |||
| 807 | Ga0068868_100225963 | |||
| 808 | Ga0068868_100921998 | |||
| 809 | Ga0068868_101680884 | |||
| 810 | Ga0070689_101327875 | |||
| 811 | Ga0070691_10153463 | |||
| 812 | Ga0070687_100030318 | |||
| 813 | Ga0070668_100072146 | |||
| 814 | Ga0070668_100885682 | |||
| 815 | Ga0070668_100978830 | |||
| 816 | Ga0070669_100085582 | |||
| 817 | Ga0070675_100158160 | |||
| 818 | Ga0070675_101040608 | |||
| 819 | Ga0070671_100158298 | |||
| 820 | Ga0070674_100251396 | |||
| 821 | Ga0070673_100134367 | |||
| 822 | Ga0070673_100753405 | |||
| 823 | Ga0070688_100044820 | |||
| 824 | Ga0070667_100025668 | |||
| 825 | Ga0070667_100065423 | |||
| 826 | Ga0070667_101107613 | |||
| 827 | Ga0070678_100014684 | |||
| 828 | Ga0070678_100075233 | |||
| 829 | Ga0070662_100309303 | |||
| 830 | Ga0068867_100003103 | |||
| 831 | Ga0068867_100060521 | |||
| 832 | Ga0068867_100399880 | |||
| 833 | Ga0068867_100654793 | |||
| 834 | Ga0068867_101098934 | |||
| 835 | Ga0070698_100089438 | |||
| 836 | Ga0070698_100230697 | |||
| 837 | Ga0070684_100130010 | |||
| 838 | Ga0068853_100013083 | |||
| 839 | Ga0068853_100043617 | |||
| 840 | Ga0068853_100063772 | |||
| 841 | Ga0068853_100240331 | |||
| 842 | Ga0068853_100294305 | |||
| 843 | Ga0068853_100790472 | |||
| 844 | Ga0070672_100206141 | |||
| 845 | Ga0070672_101002507 | |||
| 846 | Ga0070686_100730822 | |||
| 847 | Ga0070665_100000002 | |||
| 848 | Ga0070665_100130946 | |||
| 849 | Ga0070665_100446258 | |||
| 850 | Ga0070665_100857818 | |||
| 851 | Ga0068855_100048269 | |||
| 852 | Ga0068855_100164340 | |||
| 853 | Ga0068855_100483889 | |||
| 854 | Ga0068855_100718664 | |||
| 855 | Ga0070664_100090728 | |||
| 856 | Ga0070664_100504324 | |||
| 857 | Ga0068857_100102026 | |||
| 858 | Ga0068857_100702014 | |||
| 859 | Ga0068857_101439214 | |||
| 860 | Ga0068857_102199457 | |||
| 861 | Ga0068854_100109787 | |||
| 862 | Ga0068854_100204872 | |||
| 863 | Ga0068854_100464903 | |||
| 864 | Ga0068856_100057255 | |||
| 865 | Ga0068856_101144695 | |||
| 866 | Ga0068852_100141906 | |||
| 867 | Ga0068859_100000277 | |||
| 868 | Ga0068859_100009053 | |||
| 869 | Ga0068859_100015656 | |||
| 870 | Ga0068859_100032442 | |||
| 871 | Ga0068859_101123365 | |||
| 872 | Ga0068864_100005341 | |||
| 873 | Ga0068866_10050384 | |||
| 874 | Ga0068861_100053131 | |||
| 875 | Ga0068861_100089084 | |||
| 876 | Ga0068851_10016333 | |||
| 877 | Ga0068851_10925510 | |||
| 878 | Ga0068870_10057996 | |||
| 879 | Ga0068870_10254097 | |||
| 880 | Ga0068863_100002942 | |||
| 881 | Ga0068863_100116563 | |||
| 882 | Ga0068858_100018346 | |||
| 883 | Ga0068858_100461264 | |||
| 884 | Ga0068860_100000003 | |||
| 885 | Ga0068860_100003395 | |||
| 886 | Ga0068860_100019995 | |||
| 887 | Ga0068860_100042420 | |||
| 888 | Ga0068860_100044983 | |||
| 889 | Ga0068862_100291784 | |||
| 890 | Ga0068862_100350383 | |||
| 891 | Ga0075366_10001459 | |||
| 892 | Ga0075366_10002138 | |||
| 893 | Ga0075366_10045092 | |||
| 894 | Ga0075366_10058126 | |||
| 895 | Ga0075366_10109626 | |||
| 896 | Ga0075366_10176600 | |||
| 897 | Ga0075366_10233428 | |||
| 898 | Ga0097621_100021186 | |||
| 899 | Ga0097621_100325358 | |||
| 900 | Ga0075370_10023668 | |||
| 901 | Ga0075370_10579866 | |||
| 902 | Ga0068871_100046191 | |||
| 903 | Ga0068871_100492709 | |||
| 904 | Ga0068871_100635137 | |||
| 905 | Ga0075428_100056428 | |||
| 906 | Ga0075430_100020139 | |||
| 907 | Ga0075431_100016909 | |||
| 908 | Ga0068865_100002887 | |||
| 909 | Ga0068865_100153508 | |||
| 910 | Ga0097620_100000277 | |||
| 911 | Ga0097620_100009053 | |||
| 912 | Ga0097620_100015656 | |||
| 913 | Ga0097620_100032444 | |||
| 914 | Ga0097620_101123294 | |||
| 915 | Ga0099795_10313134 | |||
| 916 | Ga0105240_10000723 | |||
| 917 | Ga0105240_10000888 | |||
| 918 | Ga0105240_10004520 | |||
| 919 | Ga0105240_10049583 | |||
| 920 | Ga0105240_10053221 | |||
| 921 | Ga0105240_10082611 | |||
| 922 | Ga0105240_10112028 | |||
| 923 | Ga0105240_10220456 | |||
| 924 | Ga0105240_10685136 | |||
| 925 | Ga0105240_10810021 | |||
| 926 | Ga0111539_10059063 | |||
| 927 | Ga0105245_10558755 | |||
| 928 | Ga0105247_10073113 | |||
| 929 | Ga0105247_10945001 | |||
| 930 | Ga0114129_10014572 | |||
| 931 | Ga0114129_10065823 | |||
| 932 | Ga0114129_10080867 | |||
| 933 | Ga0114129_11192296 | |||
| 934 | Ga0105243_10143189 | |||
| 935 | Ga0105243_10482600 | |||
| 936 | Ga0105241_10000649 | |||
| 937 | Ga0105241_10002426 | |||
| 938 | Ga0105241_10051301 | |||
| 939 | Ga0105241_10102014 | |||
| 940 | Ga0105241_11504267 | |||
| 941 | Ga0105242_10023238 | |||
| 942 | Ga0105242_10207894 | |||
| 943 | Ga0105242_10805262 | |||
| 944 | Ga0105242_11041709 | |||
| 945 | Ga0105242_11716770 | |||
| 946 | Ga0105237_10000553 | |||
| 947 | Ga0105237_10001954 | |||
| 948 | Ga0105237_10018290 | |||
| 949 | Ga0105237_10022267 | |||
| 950 | Ga0105237_10025917 | |||
| 951 | Ga0105237_10037526 | |||
| 952 | Ga0105237_10296433 | |||
| 953 | Ga0105237_10306290 | |||
| 954 | Ga0105237_10318167 | |||
| 955 | Ga0105237_10370010 | |||
| 956 | Ga0105237_10371511 | |||
| 957 | Ga0105237_11327854 | |||
| 958 | Ga0105237_11401232 | |||
| 959 | Ga0105237_11413473 | |||
| 960 | Ga0105237_11670683 | |||
| 961 | Ga0105237_11997389 | |||
| 962 | Ga0105238_10000195 | |||
| 963 | Ga0105238_10187799 | |||
| 964 | Ga0105238_10372469 | |||
| 965 | Ga0105238_10446326 | |||
| 966 | Ga0105238_12768677 | |||
| 967 | Ga0105249_10008697 | |||
| 968 | Ga0105249_10032972 | |||
| 969 | Ga0105249_10068403 | |||
| 970 | Ga0105249_10279659 | |||
| 971 | Ga0105249_10538590 | |||
| 972 | Ga0105249_10621456 | |||
| 973 | Ga0105239_10000278 | |||
| 974 | Ga0105239_10000639 | |||
| 975 | Ga0105239_10001670 | |||
| 976 | Ga0105239_10008470 | |||
| 977 | Ga0105239_10010943 | |||
| 978 | Ga0105239_10032524 | |||
| 979 | Ga0105239_10053011 | |||
| 980 | Ga0105239_10109375 | |||
| 981 | Ga0105239_10160283 | |||
| 982 | Ga0105239_10173338 | |||
| 983 | Ga0105239_10447365 | |||
| 984 | Ga0105239_10521939 | |||
| 985 | Ga0105246_10006385 | |||
| 986 | Ga0105246_10206230 | |||
| 987 | Ga0105246_10920588 | |||
| 988 | Ga0157373_10000129 | |||
| 989 | Ga0157373_10096567 | |||
| 990 | Ga0157371_10000434 | |||
| 991 | Ga0157371_10004094 | |||
| 992 | Ga0157371_10024033 | |||
| 993 | Ga0157371_10042906 | |||
| 994 | Ga0157371_10384683 | |||
| 995 | Ga0157370_10075719 | |||
| 996 | Ga0157370_10080617 | |||
| 997 | Ga0157370_10205070 | |||
| 998 | Ga0157370_10663765 | |||
| 999 | Ga0157369_10000897 | |||
| 1000 | Ga0157369_10012221 | |||
| 1001 | Ga0157369_10068299 | |||
| 1002 | Ga0157369_10153961 | |||
| 1003 | Ga0157369_10533412 | |||
| 1004 | Ga0157374_10055399 | |||
| 1005 | Ga0157374_10152653 | |||
| 1006 | Ga0157374_10473867 | |||
| 1007 | Ga0157378_10029953 | |||
| 1008 | Ga0157378_10152500 | |||
| 1009 | Ga0157378_10543237 | |||
| 1010 | Ga0157378_10690216 | |||
| 1011 | Ga0163162_10000172 | |||
| 1012 | Ga0163162_10000712 | |||
| 1013 | Ga0163162_10000903 | |||
| 1014 | Ga0163162_10005458 | |||
| 1015 | Ga0163162_10164814 | |||
| 1016 | Ga0163162_10333231 | |||
| 1017 | Ga0163162_10550122 | |||
| 1018 | Ga0163162_11435622 | |||
| 1019 | Ga0163162_12921275 | |||
| 1020 | Ga0157372_10008541 | |||
| 1021 | Ga0157372_10013468 | |||
| 1022 | Ga0157372_10054609 | |||
| 1023 | Ga0157372_10253236 | |||
| 1024 | Ga0157372_10299249 | |||
| 1025 | Ga0157372_11570845 | |||
| 1026 | Ga0157372_12494068 | |||
| 1027 | Ga0157375_10038327 | |||
| 1028 | Ga0157375_10061278 | |||
| 1029 | Ga0157375_10414216 | |||
| 1030 | Ga0157375_10750951 | |||
| 1031 | Ga0157375_11638056 | |||
| 1032 | Ga0163163_10092940 | |||
| 1033 | Ga0163163_10414991 | |||
| 1034 | Ga0163163_11309213 | |||
| 1035 | Ga0163163_12017212 | |||
| 1036 | Ga0182008_10001962 | |||
| 1037 | Ga0182008_10043480 | |||
| 1038 | Ga0182008_10050682 | |||
| 1039 | Ga0182008_10100613 | |||
| 1040 | Ga0182008_10120148 | |||
| 1041 | Ga0157379_10136297 | |||
| 1042 | Ga0157379_10745387 | |||
| 1043 | Ga0157379_11181385 | |||
| 1044 | Ga0157376_10003160 | |||
| 1045 | Ga0157376_10061623 | |||
| 1046 | Ga0157376_10410196 | |||
| 1047 | Ga0157376_11181469 | |||
| 1048 | Ga0182006_1000424 | |||
| 1049 | Ga0182006_1000933 | |||
| 1050 | Ga0182006_1009585 | |||
| 1051 | Ga0182007_10000002 | |||
| 1052 | Ga0182007_10003829 | |||
| 1053 | Ga0182007_10010931 | |||
| 1054 | Ga0182007_10011075 | |||
| 1055 | Ga0183373_1004 | |||
| 1056 | Ga0163161_10003475 | |||
| 1057 | Ga0163161_10028373 | |||
| 1058 | Ga0163161_10048666 | |||
| 1059 | Ga0163161_10187053 | |||
| 1060 | Ga0207427_100644 | |||
| 1061 | Ga0209437_100112 | |||
| 1062 | Ga0209437_100280 | |||
| 1063 | Ga0207425_1000023 | |||
| 1064 | Ga0209646_1000031 | |||
| 1065 | Ga0209646_1000367 | |||
| 1066 | Ga0209026_1000019 | |||
| 1067 | Ga0209026_1004926 | |||
| 1068 | Ga0209129_1000032 | |||
| 1069 | Ga0209129_1006753 | |||
| 1070 | Ga0209233_1000126 | |||
| 1071 | Ga0209673_1000153 | |||
| 1072 | Ga0209673_1081494 | |||
| 1073 | Ga0209130_1021066 | |||
| 1074 | Ga0209675_1026200 | |||
| 1075 | Ga0209676_1000009 | |||
| 1076 | Ga0209025_1000047 | |||
| 1077 | Ga0209564_1003629 | |||
| 1078 | Ga0209564_1004828 | |||
| 1079 | Ga0209758_1000145 | |||
| 1080 | Ga0209758_1011031 | |||
| 1081 | Ga0209758_1012964 | |||
| 1082 | Ga0209050_1000094 | |||
| 1083 | Ga0209050_1000377 | |||
| 1084 | Ga0207426_1000189 | |||
| 1085 | Ga0207426_1000327 | |||
| 1086 | Ga0207426_1000774 | |||
| 1087 | Ga0207426_1024631 | |||
| 1088 | Ga0207426_1033757 | |||
| 1089 | Ga0209257_1000004 | |||
| 1090 | Ga0209257_1000939 | |||
| 1091 | Ga0207656_10033475 | |||
| 1092 | Ga0207682_10149825 | |||
| 1093 | Ga0207682_10446636 | |||
| 1094 | Ga0207642_10112818 | |||
| 1095 | Ga0207710_10116912 | |||
| 1096 | Ga0207680_10000021 | |||
| 1097 | Ga0207680_10079032 | |||
| 1098 | Ga0207647_10508702 | |||
| 1099 | Ga0207645_10007782 | |||
| 1100 | Ga0207645_10031443 | |||
| 1101 | Ga0207645_10362258 | |||
| 1102 | Ga0207643_10050279 | |||
| 1103 | Ga0207643_10074708 | |||
| 1104 | Ga0207643_10216983 | |||
| 1105 | Ga0207705_10040526 | |||
| 1106 | Ga0207705_10399538 | |||
| 1107 | Ga0207654_10000998 | |||
| 1108 | Ga0207654_10001359 | |||
| 1109 | Ga0207654_10005512 | |||
| 1110 | Ga0207654_10445991 | |||
| 1111 | Ga0207654_10881501 | |||
| 1112 | Ga0207695_10000066 | |||
| 1113 | Ga0207695_10000584 | |||
| 1114 | Ga0207695_10002206 | |||
| 1115 | Ga0207695_10023469 | |||
| 1116 | Ga0207695_10045274 | |||
| 1117 | Ga0207695_10054596 | |||
| 1118 | Ga0207695_10067185 | |||
| 1119 | Ga0207695_10138440 | |||
| 1120 | Ga0207695_10152696 | |||
| 1121 | Ga0207695_10249444 | |||
| 1122 | Ga0207671_10001334 | |||
| 1123 | Ga0207671_10001523 | |||
| 1124 | Ga0207671_10001555 | |||
| 1125 | Ga0207671_10002227 | |||
| 1126 | Ga0207671_10008405 | |||
| 1127 | Ga0207671_10025287 | |||
| 1128 | Ga0207671_10032955 | |||
| 1129 | Ga0207671_10183657 | |||
| 1130 | Ga0207671_10521911 | |||
| 1131 | Ga0207671_10847824 | |||
| 1132 | Ga0207671_10871985 | |||
| 1133 | Ga0207662_10285354 | |||
| 1134 | Ga0207649_10717916 | |||
| 1135 | Ga0207681_10072538 | |||
| 1136 | Ga0207681_10994845 | |||
| 1137 | Ga0207694_10003880 | |||
| 1138 | Ga0207694_10315185 | |||
| 1139 | Ga0207694_10721828 | |||
| 1140 | Ga0207694_10773197 | |||
| 1141 | Ga0207650_10071007 | |||
| 1142 | Ga0207650_10084800 | |||
| 1143 | Ga0207650_10157349 | |||
| 1144 | Ga0207650_10193185 | |||
| 1145 | Ga0207650_10261752 | |||
| 1146 | Ga0207650_10512997 | |||
| 1147 | Ga0207659_10222240 | |||
| 1148 | Ga0207659_10698447 | |||
| 1149 | Ga0207659_11269168 | |||
| 1150 | Ga0207687_10146612 | |||
| 1151 | Ga0207644_10069491 | |||
| 1152 | Ga0207644_10562253 | |||
| 1153 | Ga0207644_10764547 | |||
| 1154 | Ga0207706_10273070 | |||
| 1155 | Ga0207686_10048430 | |||
| 1156 | Ga0207686_10783325 | |||
| 1157 | Ga0207686_11172099 | |||
| 1158 | Ga0207709_10653989 | |||
| 1159 | Ga0207670_10559598 | |||
| 1160 | Ga0207669_11223826 | |||
| 1161 | Ga0207704_10400779 | |||
| 1162 | Ga0207704_10785479 | |||
| 1163 | Ga0207704_11152740 | |||
| 1164 | Ga0207691_10030848 | |||
| 1165 | Ga0207689_10003569 | |||
| 1166 | Ga0207689_10004792 | |||
| 1167 | Ga0207689_10061587 | |||
| 1168 | Ga0207661_10178323 | |||
| 1169 | Ga0207679_10303682 | |||
| 1170 | Ga0207667_10045224 | |||
| 1171 | Ga0207667_10258630 | |||
| 1172 | Ga0207667_10741936 | |||
| 1173 | Ga0207667_11031842 | |||
| 1174 | Ga0207651_10216206 | |||
| 1175 | Ga0207712_10039537 | |||
| 1176 | Ga0207712_10063573 | |||
| 1177 | Ga0207712_10237463 | |||
| 1178 | Ga0207712_10438831 | |||
| 1179 | Ga0207668_10210003 | |||
| 1180 | Ga0207668_10419762 | |||
| 1181 | Ga0207668_10614998 | |||
| 1182 | Ga0207640_10098919 | |||
| 1183 | Ga0207640_10978358 | |||
| 1184 | Ga0207640_10981619 | |||
| 1185 | Ga0207658_10072295 | |||
| 1186 | Ga0207658_10158923 | |||
| 1187 | Ga0207658_10354617 | |||
| 1188 | Ga0207658_10509362 | |||
| 1189 | Ga0207658_10999760 | |||
| 1190 | Ga0207677_10515599 | |||
| 1191 | Ga0207677_11051486 | |||
| 1192 | Ga0207703_10020234 | |||
| 1193 | Ga0207639_10009954 | |||
| 1194 | Ga0207639_10019123 | |||
| 1195 | Ga0207639_10100567 | |||
| 1196 | Ga0207639_10989130 | |||
| 1197 | Ga0207702_10089284 | |||
| 1198 | Ga0207702_10851182 | |||
| 1199 | Ga0207641_10000442 | |||
| 1200 | Ga0207648_10013029 | |||
| 1201 | Ga0207648_10013798 | |||
| 1202 | Ga0207648_10039298 | |||
| 1203 | Ga0207648_10460033 | |||
| 1204 | Ga0207676_10035648 | |||
| 1205 | Ga0207674_10186682 | |||
| 1206 | Ga0207674_10298966 | |||
| 1207 | Ga0207674_10801592 | |||
| 1208 | Ga0207674_10819584 | |||
| 1209 | Ga0207675_100019149 | |||
| 1210 | Ga0207675_100057704 | |||
| 1211 | Ga0207683_10003429 | |||
| 1212 | Ga0207683_10214089 | |||
| 1213 | Ga0207698_10008108 | |||
| 1214 | Ga0207698_10261550 | |||
| 1215 | Ga0207698_10543695 | |||
| 1216 | Ga0207698_10894005 | |||
| 1217 | Ga0207428_10398877 | |||
| 1218 | Ga0268266_10000073 | |||
| 1219 | Ga0268266_10169232 | |||
| 1220 | Ga0268266_11202050 | |||
| 1221 | Ga0268265_10158250 | |||
| 1222 | Ga0268265_10217316 | |||
| 1223 | Ga0268264_10000063 | |||
| 1224 | Ga0268264_10002719 | |||
| 1225 | Ga0268264_10041539 | |||
| 1226 | Ga0307517_10000977 | |||
| 1227 | Ga0307517_10061770 | |||
| 1228 | Ga0307517_10379227 | |||
| 1229 | Ga0307515_10000001 | |||
| 1230 | Ga0307515_10000226 | |||
| 1231 | Ga0307515_10001233 | |||
| 1232 | Ga0307515_10001257 | |||
| 1233 | Ga0307515_10142160 | |||
| 1234 | Ga0316181_1215835 | |||
| 1235 | Ga0265327_10000207 | |||
| 1236 | Ga0265327_10222317 | |||
| 1237 | Ga0265327_10233669 | |||
| 1238 | Ga0307513_10025829 | |||
| 1239 | Ga0307513_10618909 | |||
| 1240 | Ga0307509_10049214 | |||
| 1241 | Ga0307516_10001351 | |||
| 1242 | Ga0307516_10234883 | |||
| 1243 | Ga0307516_10498652 | |||
| 1244 | Ga0307405_10000015 | |||
| 1245 | Ga0307518_10164697 | |||
| 1246 | Ga0307407_10000054 | |||
| 1247 | Ga0307412_10060106 | |||
| 1248 | Ga0307412_10078268 | |||
| 1249 | Ga0307409_100096415 | |||
| 1250 | Ga0307416_100000002 | |||
| 1251 | Ga0307416_100337582 | |||
| 1252 | Ga0307414_10015327 | |||
| 1253 | Ga0307414_10272503 | |||
| 1254 | Ga0307414_10526878 | |||
| 1255 | Ga0307414_10682354 | |||
| 1256 | Ga0307414_10720626 | |||
| 1257 | Ga0307414_10737524 | |||
| 1258 | Ga0307411_10107157 | |||
| 1259 | Ga0307411_10569660 | |||
| 1260 | Ga0307507_10000071 | |||
| 1261 | Ga0307507_10076866 | |||
| 1262 | Ga0307510_10137642 | |||
| 1263 | Ga0395899_0255750 | |||
| 1264 | Ga0395900_0218744 | |||
| 1265 | Ga0395905_0000587 | |||
| 1266 | Ga0395901_0074078 | |||
| 1267 | Ga0395901_1055859 | |||
| 1268 | Ga0439436_0006956 | |||
| 1269 | Ga0439436_0030120 | |||
| 1270 | Ga0439439_0015934 | |||
| 1271 | Ga0439465_0119785 | |||
| 1272 | Ga0451789_0865262 | |||
| 1273 | Ga0451793_0312842 | |||
| 1274 | Ga0451802_0156129 | |||
| 1275 | Ga0451802_1657172 | |||
| 1276 | Ga0451833_0715189 | |||
| 1277 | Ga0451841_1051963 | |||
| 1278 | Ga0451843_0589972 | |||
| 1279 | Ga0451853_0732439 | |||
| 1280 | Ga0439449_0083369 | |||
| 1281 | Ga0439449_0140358 | |||
| 1282 | Ga0439449_0142576 | |||
| 1283 | Ga0439454_048827 | |||
| 1284 | Ga0439457_017524 | |||
| 1285 | Ga0439462_0007680 | |||
| 1286 | Ga0466972_0000047 | |||
| 1287 | Ga0466972_0014023 | |||
| 1288 | Ga0466972_0165266 | |||
| 1289 | Ga0453683_0913869 | |||
| 1290 | Ga0466957_0053539 | |||
| 1291 | Ga0466959_0208363 | |||
| 1292 | Ga0451576_0379460 | |||
| 1293 | Ga0495638_0223679 | |||
| 1294 | Ga0495638_0224002 | |||
| 1295 | Ga0495651_0238071 | |||
| 1296 | Ga0495650_0000231 | |||
| 1297 | Ga0495650_0061456 | |||
| 1298 | Ga0495650_0134795 | |||
| 1299 | Ga0495585_0000037 | |||
| 1300 | Ga0495585_0036583 | |||
| 1301 | Ga0495583_0024158 | |||
| 1302 | Ga0495583_0050433 | |||
| 1303 | Ga0495606_0000060 | |||
| 1304 | Ga0495606_0006447 | |||
| 1305 | Ga0495606_0015551 | |||
| 1306 | Ga0495606_0015896 | |||
| 1307 | Ga0495606_0048673 | |||
| 1308 | Ga0495606_0189450 | |||
| 1309 | Ga0495606_0207278 | |||
| 1310 | Ga0495610_0002646 | |||
| 1311 | Ga0495610_0005229 | |||
| 1312 | Ga0495610_0123835 | |||
| 1313 | Ga0495616_0001826 | |||
| 1314 | Ga0495616_0267664 | |||
| 1315 | Ga0495618_0456515 | |||
| 1316 | Ga0495631_0149088 | |||
| 1317 | Ga0495632_0209510 | |||
| 1318 | Ga0495637_0053299 | |||
| 1319 | Ga0495637_0139350 | |||
| 1320 | Ga0495648_0005678 | |||
| 1321 | Ga0495648_0033309 | |||
| 1322 | Ga0495648_0073670 | |||
| 1323 | Ga0495652_0643463 | |||
| 1324 | Ga0495652_0703701 | |||
| 1325 | Ga0495654_0024364 | |||
| 1326 | Ga0495609_0024317 | |||
| 1327 | Ga0495609_0062437 | |||
| 1328 | Ga0495609_0196532 | |||
| 1329 | Ga0495609_0275331 | |||
| 1330 | Ga0495622_0105799 | |||
| 1331 | Ga0495633_0000072 | |||
| 1332 | Ga0495633_0014130 | |||
| 1333 | Ga0495633_0062664 | |||
| 1334 | Ga0495668_0000075 | |||
| 1335 | Ga0495668_0000202 | |||
| 1336 | Ga0495668_0003041 | |||
| 1337 | Ga0495668_0702833 | |||
| 1338 | Ga0495611_0000037 | |||
| 1339 | Ga0495611_0031426 | |||
| 1340 | Ga0495625_0000191 | |||
| 1341 | Ga0495625_0000456 | |||
| 1342 | Ga0495625_0000647 | |||
| 1343 | Ga0495625_0145010 | |||
| 1344 | Ga0495625_0188031 | |||
| 1345 | Ga0495625_0245557 | |||
| 1346 | Ga0495661_0005895 | |||
| 1347 | Ga0495658_0075575 | |||
| 1348 | Ga0495671_0040970 | |||
| 1349 | Ga0495649_0000061 | |||
| 1350 | Ga0495660_0031991 | |||
| 1351 | Ga0495660_0164422 | |||
| 1352 | Ga0495687_000040 | |||
| 1353 | Ga0495687_026691 | |||
| 1354 | Ga0495679_022042 | |||
| 1355 | Ga0495673_0058384 | |||
| 1356 | Ga0495686_0008285 | |||
| 1357 | Ga0495686_0090771 | |||
| 1358 | Ga0495686_0097072 | |||
| 1359 | Ga0495686_0190399 | |||
| 1360 | Ga0495686_0252711 | |||
| 1361 | Ga0495686_0276818 | |||
| 1362 | Ga0496101_0136559 | |||
| 1363 | Ga0496104_1413479 | |||
| 1364 | Ga0496108_0554322 | |||
| 1365 | Ga0496115_0887871 | |||
| 1366 | Ga0496126_0041489 | |||
| 1367 | Ga0496126_1067745 | |||
| 1368 | Ga0495682_0016218 | |||
| 1369 | Ga0501033_0392167 | |||
| 1370 | Ga0501034_1552981 | |||
| 1371 | Ga0501043_0505350 | |||
| 1372 | Ga0501043_0772173 | |||
| 1373 | Ga0501047_0059811 | |||
| 1374 | Ga0501225_0004953 | |||
| 1375 | Ga0501083_0363763 | |||
| 1376 | nmdc:mga0k408_12291_c1 | |||
| 1377 | nmdc:mga0k408_12445_c1 | |||
| 1378 | nmdc:mga0k408_32355_c1 | |||
| 1379 | nmdc:mga0k408_339240_c1 | |||
| 1380 | nmdc:mga0k408_34488_c1 | |||
| 1381 | nmdc:mga0k408_378_c2 | |||
| 1382 | nmdc:mga0k408_418_c1 | |||
| 1383 | nmdc:mga07m45_516504_c1 | |||
| 1384 | nmdc:mga07m45_553369_c1 | |||
| 1385 | nmdc:mga05p37_12431_c1 | |||
| 1386 | nmdc:mga05p37_55446_c1 | |||
| 1387 | nmdc:mga09592_273717_c1 | |||
| 1388 | nmdc:mga0qj67_103683_c1 | |||
| 1389 | nmdc:mga06r32_206037_c1 | |||
| 1390 | nmdc:mga08y16_254570_c1 | |||
| 1391 | Ga0500578_0000060 | |||
| 1392 | Ga0500644_0000236 | |||
| 1393 | Ga0500646_0045888 | |||
| 1394 | Ga0500583_0000003 | |||
| 1395 | Ga0500583_0010030 | |||
| 1396 | Ga0500555_020857 | |||
| 1397 | Ga0500556_0296305 | |||
| 1398 | Ga0500594_0063601 | |||
| 1399 | Ga0500608_073061 | |||
| 1400 | Ga0500618_000005 | |||
| 1401 | Ga0500642_0435949 | |||
| 1402 | Ga0500652_000379 | |||
| 1403 | Ga0500652_055935 | |||
| 1404 | Ga0500655_020531 | |||
| 1405 | Ga0500658_0545022 | |||
| 1406 | Ga0500564_085137 | |||
| 1407 | Ga0500588_0083659 | |||
| 1408 | Ga0500588_0161721 | |||
| 1409 | Ga0500616_0318500 | |||
| 1410 | Ga0500622_0000414 | |||
| 1411 | Ga0500622_0001836 | |||
| 1412 | Ga0500622_0002735 | |||
| 1413 | Ga0500622_0140036 | |||
| 1414 | Ga0500633_0000217 | |||
| 1415 | Ga0500639_317878 | |||
| 1416 | Ga0500636_0111725 | |||
| 1417 | Ga0500637_0315568 | |||
| 1418 | 2586206326 | |||
| 1419 | 2599481455 | |||
| 1420 | 2738725761 | |||
| 1421 | 2738856119 | |||
| 1422 | 2739303127 | |||
| 1423 | 2739588310 | |||
| 1424 | 2739648593 | |||
| 1425 | 2819546292 | |||
| 1426 | 2842723870 | |||
| 1427 | 2842912399 | |||
| 1428 | 2849282818 | |||
| 1429 | 2852631914 | |||
| 1430 | 2857629255 | |||
| 1431 | 2902053072 | |||
| 1432 | 2904446571 | |||
| 1433 | 2904783819 | |||
| 1434 | 2919181933 | |||
| 1435 | 2919190210 | |||
| 1436 | 2928083241 | |||
| 1437 | 2928152705 | |||
| 1438 | 2929921596 | |||
| 1439 | 2932086489 | |||
| 1440 | 2939668491 | |||
| 1441 | 2945999374 | |||
| 1442 | 2954021782 | |||
| 1443 | 8003152940 | |||
| 1444 | 8055591995 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ft1-assembly1.cif.gz_A | crystal structure of gp37(dip) from bacteriophage phikz bound to rnase e of pseudomonas aeruginosa | 0.7585 | 40 | 74 |
| 5ft1-assembly3.cif.gz_I | crystal structure of gp37(dip) from bacteriophage phikz bound to rnase e of pseudomonas aeruginosa | 0.7473 | 40 | 74 |
| 5ft1-assembly3.cif.gz_K | crystal structure of gp37(dip) from bacteriophage phikz bound to rnase e of pseudomonas aeruginosa | 0.7371 | 40 | 78 |
| 5ft0-assembly1.cif.gz_A | crystal structure of gp37(dip) from bacteriophage phikz | 0.7232 | 40 | 78 |
| 5ft0-assembly1.cif.gz_B | crystal structure of gp37(dip) from bacteriophage phikz | 0.7166 | 40 | 79 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A2R8Y4Y8_8_104_2.60.40.3210 | Mainly Beta;Sandwich;Immunoglobulin-like;Zona pellucida, ZP-N domain | 0.6887 | 42 | 80 | 2.60.40.3210 |
| af_Q9EPX0_93_177_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.66 | 42 | 78 | 2.60.40.790 |
| af_E7F146_107_201_2.60.40.10 | Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins | 0.6443 | 36 | 74 | 2.60.40.10 |
| af_A3C7W7_57_154_3.30.70.260 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain | 0.6407 | 37 | 100 | 3.30.70.260 |
| af_A2BHS1_88_182_2.60.40.790 | Mainly Beta;Sandwich;Immunoglobulin-like; | 0.6382 | 42 | 79 | 2.60.40.790 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N4EAF4-F1-model_v4 | deleted | 0.979 | 1 | 112 |
|
| AF-A0A6N4EAF4-F1-model_v4 | deleted | 0.9704 | 1 | 112 |
|
| AF-A0A7R9LJ36-F1-model_v4 | Deoxyribonuclease TATDN1 | 0.9602 | 11 | 141 |
GO:0004518
|
| AF-A0A519W9W3-F1-model_v4 | Uncharacterized protein | 0.9499 | 5 | 69 |
|
| AF-A0A520GSC2-F1-model_v4 | TPM domain-containing protein | 0.9432 | 5 | 80 |
|