F477409

General Info

Members Datasets Scaffolds Average Seq Length
722 301 1444 163

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100218371|Ga0070696_1002183712
Length 190
Sequence VAKLKLKKALKKLVRKAVPSKKAVVRKANGAGHHETQHAVEQFLFRQAELLDAKQWQDYIDLFTPEGVYWMPPEPSHTHWDGMPAIFAEDKNLMTVRMKRILHPDAWSQRPLWETNHVVSNIIVEKETADEVQVRSRFHMLELRRDDVRHFAGAYRHTLTRTPEGFRIKLQRVDMTNAQAAYDYVIQAWV

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
159 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
162 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
187 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
188 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
193 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
194 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
195 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
196 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
197 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
240 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
241 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
249 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
257 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
258 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
276 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
277 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
278 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
279 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
280 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
283 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
284 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
287 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
288 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
289 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
290 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
291 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
292 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
293 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
294 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
295 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.14
Rhizosphere 99.72
Stem 0
Stem Tuber 0
Unclassified 15.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100218371 3300005546 Bacteria 1430
2 Ga0065707_10020436 3300005295 Bacteria 1752
3 Ga0065707_10104294 3300005295 Bacteria 2703
4 Ga0070676_10060495 3300005328 Bacteria 2249
5 Ga0070683_100103896 3300005329 Bacteria 2678
6 Ga0070683_101282509 3300005329 Bacteria 704
7 Ga0070690_100000398 3300005330 Bacteria 21982
8 Ga0070690_100138389 3300005330 Unclassified 1651
9 Ga0068869_100001796 3300005334 Bacteria 12871
10 Ga0068869_100034494 3300005334 Unclassified 3580
11 Ga0070680_100001167 3300005336 Bacteria 18875
12 Ga0070680_100098560 3300005336 Bacteria 2424
13 Ga0070680_100118801 3300005336 Bacteria 2205
14 Ga0070680_100132431 3300005336 Bacteria 2087
15 Ga0070680_101115375 3300005336 Bacteria 682
16 Ga0070682_100001096 3300005337 Bacteria 15544
17 Ga0068868_100005562 3300005338 Bacteria 8862
18 Ga0070689_100000188 3300005340 Bacteria 37400
19 Ga0070689_100024102 3300005340 Unclassified 4563
20 Ga0070689_100097747 3300005340 Bacteria 2322
21 Ga0070689_100109570 3300005340 Bacteria 2194
22 Ga0070689_100701409 3300005340 Bacteria 884
23 Ga0070691_10022630 3300005341 Unclassified 2917
24 Ga0070687_100000069 3300005343 Bacteria 33055
25 Ga0070687_100232332 3300005343 Bacteria 1136
26 Ga0070692_10010076 3300005345 Bacteria 4287
27 Ga0070692_10303448 3300005345 Bacteria 976
28 Ga0070668_100022871 3300005347 Bacteria 4726
29 Ga0070669_100013309 3300005353 Bacteria 5847
30 Ga0070669_100364818 3300005353 Archaea 1175
31 Ga0070675_100230481 3300005354 Bacteria 1615
32 Ga0070671_100579148 3300005355 Archaea 969
33 Ga0070673_100269484 3300005364 Bacteria 1490
34 Ga0070673_100461768 3300005364 Bacteria 1143
35 Ga0070688_100146232 3300005365 Unclassified 1611
36 Ga0070688_100214206 3300005365 Bacteria 1354
37 Ga0070688_101090354 3300005365 Bacteria 638
38 Ga0070659_101147652 3300005366 Unclassified 686
39 Ga0070667_100761048 3300005367 Bacteria 898
40 Ga0070703_10083362 3300005406 Unclassified 1094
41 Ga0070714_100100787 3300005435 Bacteria 2544
42 Ga0070713_100195808 3300005436 Unclassified 1823
43 Ga0070710_10152865 3300005437 Bacteria 1425
44 Ga0070701_10000603 3300005438 Bacteria 12535
45 Ga0070711_100422986 3300005439 Bacteria 1086
46 Ga0070705_100001149 3300005440 Bacteria 14607
47 Ga0070705_100010469 3300005440 Bacteria 4644
48 Ga0070705_100024627 3300005440 Bacteria 3252
49 Ga0070705_100168798 3300005440 Bacteria 1471
50 Ga0070705_100234559 3300005440 Bacteria 1279
51 Ga0070700_100008466 3300005441 Bacteria 5600
52 Ga0070700_100023110 3300005441 Bacteria 3635
53 Ga0070700_101036391 3300005441 Unclassified 676
54 Ga0070694_100001966 3300005444 Bacteria 12184
55 Ga0070694_100038605 3300005444 Bacteria 3174
56 Ga0070694_100102411 3300005444 Bacteria 2027
57 Ga0070694_100154825 3300005444 Bacteria 1677
58 Ga0070694_100240387 3300005444 Bacteria 1366
59 Ga0070694_100319385 3300005444 Bacteria 1195
60 Ga0070694_100519864 3300005444 Unclassified 949
61 Ga0070694_100754982 3300005444 Unclassified 795
62 Ga0070694_100915354 3300005444 Bacteria 725
63 Ga0070708_100623349 3300005445 Bacteria 1017
64 Ga0070681_10035955 3300005458 Bacteria 4975
65 Ga0070681_10120479 3300005458 Bacteria 2559
66 Ga0070681_10229224 3300005458 Bacteria 1772
67 Ga0068867_100000296 3300005459 Bacteria 32704
68 Ga0068867_100011080 3300005459 Bacteria 6361
69 Ga0068867_100899274 3300005459 Unclassified 796
70 Ga0068867_101254362 3300005459 Bacteria 683
71 Ga0070706_100768166 3300005467 Bacteria 893
72 Ga0070706_101373514 3300005467 Bacteria 647
73 Ga0070707_100573127 3300005468 Bacteria 1091
74 Ga0070698_100052274 3300005471 Bacteria 4157
75 Ga0070698_100092149 3300005471 Bacteria 3011
76 Ga0070698_100490415 3300005471 Bacteria 1166
77 Ga0070699_100100337 3300005518 Bacteria 2537
78 Ga0070699_100234972 3300005518 Bacteria 1635
79 Ga0070699_100690030 3300005518 Bacteria 933
80 Ga0070699_101002427 3300005518 Bacteria 766
81 Ga0070679_100003737 3300005530 Bacteria 13955
82 Ga0070679_100112749 3300005530 Bacteria 2705
83 Ga0070679_100256385 3300005530 Bacteria 1704
84 Ga0070684_100212309 3300005535 Bacteria 1764
85 Ga0070697_100009252 3300005536 Bacteria 7699
86 Ga0070697_100396270 3300005536 Bacteria 1197
87 Ga0068853_100072412 3300005539 Unclassified 3003
88 Ga0070672_101561865 3300005543 Unclassified 592
89 Ga0070686_100000090 3300005544 Bacteria 63246
90 Ga0070686_100267793 3300005544 Bacteria 1255
91 Ga0070686_100358380 3300005544 Bacteria 1098
92 Ga0070686_100429094 3300005544 Bacteria 1011
93 Ga0070686_100434628 3300005544 Bacteria 1005
94 Ga0070686_101194839 3300005544 Unclassified 631
95 Ga0070695_100000188 3300005545 Bacteria 29840
96 Ga0070695_100004474 3300005545 Bacteria 8213
97 Ga0070695_100022517 3300005545 Bacteria 3866
98 Ga0070695_100119152 3300005545 Unclassified 1803
99 Ga0070695_100226764 3300005545 Bacteria 1349
100 Ga0070695_100443880 3300005545 Bacteria 993
101 Ga0070695_100465393 3300005545 Unclassified 971
102 Ga0070696_100000719 3300005546 Bacteria 21155
103 Ga0070696_100002632 3300005546 Bacteria 11903
104 Ga0070696_100036360 3300005546 Bacteria 3395
105 Ga0070696_100039245 3300005546 Bacteria 3270
106 Ga0070696_100461964 3300005546 Bacteria 1004
107 Ga0070693_100000525 3300005547 Bacteria 17212
108 Ga0070704_100000168 3300005549 Bacteria 26018
109 Ga0070704_100000545 3300005549 Bacteria 18048
110 Ga0070704_100006984 3300005549 Bacteria 6696
111 Ga0070704_100037205 3300005549 Bacteria 3323
112 Ga0070704_100099034 3300005549 Bacteria 2192
113 Ga0070704_100466991 3300005549 Unclassified 1090
114 Ga0070704_100622522 3300005549 Bacteria 950
115 Ga0070704_101053583 3300005549 Unclassified 737
116 Ga0068855_100000833 3300005563 Bacteria 38155
117 Ga0068854_100000657 3300005578 Bacteria 20579
118 Ga0068854_100764757 3300005578 Bacteria 839
119 Ga0068856_100003103 3300005614 Bacteria 16966
120 Ga0070702_100000002 3300005615 Bacteria 83999
121 Ga0070702_100004543 3300005615 Bacteria 6350
122 Ga0070702_100595670 3300005615 Bacteria 828
123 Ga0068852_100439119 3300005616 Bacteria 1290
124 Ga0068859_100000195 3300005617 Bacteria 59015
125 Ga0068859_100115984 3300005617 Unclassified 2743
126 Ga0068859_100345673 3300005617 Bacteria 1582
127 Ga0068859_100719125 3300005617 Unclassified 1089
128 Ga0068864_100319590 3300005618 Bacteria 1458
129 Ga0068864_100666633 3300005618 Bacteria 1014
130 Ga0068866_10002071 3300005718 Bacteria 8341
131 Ga0068866_10089292 3300005718 Bacteria 1675
132 Ga0068861_100000043 3300005719 Bacteria 57807
133 Ga0068861_100062821 3300005719 Bacteria 2853
134 Ga0068858_100005138 3300005842 Bacteria 12824
135 Ga0068858_100199292 3300005842 Unclassified 1893
136 Ga0068860_100002559 3300005843 Bacteria 19020
137 Ga0068860_100083022 3300005843 Bacteria 3047
138 Ga0068862_100002188 3300005844 Bacteria 17538
139 Ga0068862_100070855 3300005844 Bacteria 3010
140 Ga0068862_100132940 3300005844 Bacteria 2202
141 Ga0068862_101635017 3300005844 Unclassified 652
142 Ga0081538_10125963 3300005981 Bacteria 1217
143 Ga0081539_10000233 3300005985 Bacteria 130647
144 Ga0070715_10050628 3300006163 Bacteria 1784
145 Ga0070716_100007311 3300006173 Bacteria 5433
146 Ga0070716_100059116 3300006173 Unclassified 2209
147 Ga0097621_100000045 3300006237 Bacteria 65278
148 Ga0097621_100016034 3300006237 Bacteria 5653
149 Ga0097621_100167247 3300006237 Bacteria 1894
150 Ga0097621_100350612 3300006237 Unclassified 1312
151 Ga0068871_100000040 3300006358 Bacteria 69044
152 Ga0068871_100012220 3300006358 Bacteria 6321
153 Ga0075428_100000047 3300006844 Bacteria 96882
154 Ga0075428_100043245 3300006844 Bacteria 4952
155 Ga0075428_100050115 3300006844 Bacteria 4580
156 Ga0075428_100097885 3300006844 Bacteria 3198
157 Ga0075428_100253105 3300006844 Unclassified 1897
158 Ga0075428_100530864 3300006844 Bacteria 1258
159 Ga0075428_101074348 3300006844 Bacteria 850
160 Ga0075430_100004392 3300006846 Bacteria 11904
161 Ga0075430_100018834 3300006846 Bacteria 5873
162 Ga0075430_100023346 3300006846 Bacteria 5263
163 Ga0075430_100058324 3300006846 Bacteria 3245
164 Ga0075430_100147024 3300006846 Unclassified 1963
165 Ga0075430_100164839 3300006846 Bacteria 1844
166 Ga0075431_100014374 3300006847 Bacteria 8006
167 Ga0075431_100101199 3300006847 Bacteria 2973
168 Ga0075431_100120534 3300006847 Bacteria 2707
169 Ga0075431_100237297 3300006847 Bacteria 1856
170 Ga0075433_10000605 3300006852 Bacteria 23895
171 Ga0075433_10071751 3300006852 Bacteria 3044
172 Ga0075434_100000006 3300006871 Bacteria 96966
173 Ga0075434_100000554 3300006871 Bacteria 28632
174 Ga0075434_100047891 3300006871 Bacteria 4241
175 Ga0075434_101456026 3300006871 Bacteria 694
176 Ga0075434_101813977 3300006871 Unclassified 617
177 Ga0075434_102044309 3300006871 Bacteria 578
178 Ga0075429_100000008 3300006880 Bacteria 86739
179 Ga0075429_100000067 3300006880 Bacteria 51949
180 Ga0075429_100052460 3300006880 Bacteria 3548
181 Ga0075429_100177709 3300006880 Bacteria 1865
182 Ga0075429_100298831 3300006880 Unclassified 1410
183 Ga0075429_101293697 3300006880 Unclassified 636
184 Ga0068865_100001956 3300006881 Bacteria 12156
185 Ga0075436_100000174 3300006914 Bacteria 40099
186 Ga0075436_100001082 3300006914 Bacteria 18349
187 Ga0075436_100009225 3300006914 Bacteria 6751
188 Ga0075436_100022044 3300006914 Bacteria 4374
189 Ga0075436_100072304 3300006914 Bacteria 2386
190 Ga0075436_100090296 3300006914 Bacteria 2129
191 Ga0075436_100127289 3300006914 Bacteria 1785
192 Ga0075436_100349398 3300006914 Bacteria 1065
193 Ga0075436_100466701 3300006914 Bacteria 921
194 Ga0097620_100000195 3300006931 Bacteria 59015
195 Ga0097620_100115982 3300006931 Unclassified 2743
196 Ga0097620_100345671 3300006931 Bacteria 1582
197 Ga0097620_100719110 3300006931 Unclassified 1089
198 Ga0075435_100020896 3300007076 Bacteria 5026
199 Ga0075435_100039691 3300007076 Bacteria 3757
200 Ga0075435_100058248 3300007076 Bacteria 3128
201 Ga0075435_100433430 3300007076 Bacteria 1133
202 Ga0099794_10501479 3300007265 Unclassified 639
203 Ga0105250_10073498 3300009092 Bacteria 1383
204 Ga0105250_10375435 3300009092 Bacteria 626
205 Ga0111539_10219068 3300009094 Bacteria 2217
206 Ga0111539_10226278 3300009094 Bacteria 2179
207 Ga0111539_10663354 3300009094 Bacteria 1214
208 Ga0111539_11002257 3300009094 Unclassified 971
209 Ga0111539_11198955 3300009094 Bacteria 882
210 Ga0111539_11293948 3300009094 Bacteria 846
211 Ga0105245_10000306 3300009098 Bacteria 47026
212 Ga0105245_10048544 3300009098 Bacteria 3798
213 Ga0105245_10536166 3300009098 Bacteria 1191
214 Ga0105245_11794603 3300009098 Bacteria 666
215 Ga0114129_10000040 3300009147 Bacteria 107971
216 Ga0114129_10021807 3300009147 Bacteria 9092
217 Ga0114129_10210929 3300009147 Bacteria 2625
218 Ga0114129_10298916 3300009147 Bacteria 2146
219 Ga0114129_10710863 3300009147 Bacteria 1290
220 Ga0114129_10897341 3300009147 Bacteria 1123
221 Ga0114129_10981008 3300009147 Bacteria 1065
222 Ga0114129_12239374 3300009147 Bacteria 657
223 Ga0105243_10000035 3300009148 Bacteria 177598
224 Ga0105243_10002936 3300009148 Bacteria 14105
225 Ga0105241_10070539 3300009174 Unclassified 2711
226 Ga0105242_10004996 3300009176 Bacteria 10258
227 Ga0105242_10039137 3300009176 Bacteria 3815
228 Ga0105242_10258541 3300009176 Bacteria 1572
229 Ga0105242_11735615 3300009176 Bacteria 661
230 Ga0105249_10007943 3300009553 Bacteria 9249
231 Ga0105249_10055112 3300009553 Bacteria 3636
232 Ga0105249_10189440 3300009553 Bacteria 2007
233 Ga0105239_10048386 3300010375 Bacteria 4663
234 Ga0157316_1019378 3300012510 Bacteria 729
235 Ga0157378_10001996 3300013297 Bacteria 18243
236 Ga0157378_10686009 3300013297 Bacteria 1043
237 Ga0163162_10347688 3300013306 Unclassified 1615
238 Ga0157372_11047746 3300013307 Bacteria 944
239 Ga0157372_11048349 3300013307 Unclassified 944
240 Ga0157375_10133322 3300013308 Bacteria 2605
241 Ga0157375_10546244 3300013308 Bacteria 1320
242 Ga0157380_10018970 3300014326 Bacteria 5119
243 Ga0157380_10106095 3300014326 Bacteria 2350
244 Ga0157380_10154190 3300014326 Bacteria 1989
245 Ga0157380_11415728 3300014326 Bacteria 746
246 Ga0157377_10049229 3300014745 Bacteria 2368
247 Ga0157377_10286936 3300014745 Unclassified 1081
248 Ga0157379_10978035 3300014968 Bacteria 806
249 Ga0157376_10000403 3300014969 Bacteria 28093
250 Ga0157376_10022959 3300014969 Bacteria 4873
251 Ga0163161_10225180 3300017792 Bacteria 1454
252 Ga0207692_10117272 3300025898 Unclassified 1485
253 Ga0207642_10003118 3300025899 Bacteria 5199
254 Ga0207642_10052050 3300025899 Bacteria 1856
255 Ga0207685_10260991 3300025905 Bacteria 842
256 Ga0207645_10414579 3300025907 Unclassified 907
257 Ga0207643_10044298 3300025908 Bacteria 2512
258 Ga0207643_10084606 3300025908 Bacteria 1841
259 Ga0207684_10682965 3300025910 Bacteria 873
260 Ga0207654_10034497 3300025911 Unclassified 2812
261 Ga0207707_10028946 3300025912 Bacteria 4841
262 Ga0207707_10048467 3300025912 Bacteria 3700
263 Ga0207707_10476037 3300025912 Unclassified 1067
264 Ga0207693_10462161 3300025915 Bacteria 991
265 Ga0207663_10133508 3300025916 Unclassified 1719
266 Ga0207660_10006506 3300025917 Bacteria 7582
267 Ga0207660_10047673 3300025917 Bacteria 3031
268 Ga0207660_10088771 3300025917 Bacteria 2287
269 Ga0207660_10155707 3300025917 Bacteria 1759
270 Ga0207660_10914922 3300025917 Unclassified 716
271 Ga0207662_10000006 3300025918 Bacteria 105457
272 Ga0207662_10039730 3300025918 Bacteria 2761
273 Ga0207652_10088081 3300025921 Bacteria 2723
274 Ga0207646_10280400 3300025922 Bacteria 1506
275 Ga0207681_10025231 3300025923 Bacteria 3821
276 Ga0207687_10003249 3300025927 Bacteria 11009
277 Ga0207687_10027525 3300025927 Bacteria 3815
278 Ga0207664_10036885 3300025929 Bacteria 3780
279 Ga0207644_10540261 3300025931 Unclassified 964
280 Ga0207686_10003499 3300025934 Bacteria 8434
281 Ga0207686_10016405 3300025934 Bacteria 4158
282 Ga0207686_11024912 3300025934 Bacteria 670
283 Ga0207709_10007469 3300025935 Bacteria 6084
284 Ga0207709_10015032 3300025935 Bacteria 4286
285 Ga0207670_10001617 3300025936 Bacteria 11751
286 Ga0207670_10020433 3300025936 Unclassified 4069
287 Ga0207670_10117777 3300025936 Bacteria 1925
288 Ga0207670_10594479 3300025936 Bacteria 908
289 Ga0207669_10021023 3300025937 Bacteria 3436
290 Ga0207665_10007350 3300025939 Bacteria 7284
291 Ga0207665_10081009 3300025939 Unclassified 2234
292 Ga0207665_10663647 3300025939 Unclassified 818
293 Ga0207711_10530941 3300025941 Bacteria 1097
294 Ga0207711_11559720 3300025941 Bacteria 604
295 Ga0207689_10000082 3300025942 Bacteria 76708
296 Ga0207689_10010692 3300025942 Bacteria 7895
297 Ga0207689_10097302 3300025942 Unclassified 2417
298 Ga0207689_10229664 3300025942 Unclassified 1534
299 Ga0207661_10010666 3300025944 Bacteria 6623
300 Ga0207667_10012981 3300025949 Bacteria 9561
301 Ga0207651_10048965 3300025960 Unclassified 2860
302 Ga0207712_10033486 3300025961 Bacteria 3474
303 Ga0207712_10096830 3300025961 Bacteria 2185
304 Ga0207640_10001404 3300025981 Bacteria 13006
305 Ga0207677_10005887 3300026023 Bacteria 6671
306 Ga0207703_10017112 3300026035 Bacteria 5653
307 Ga0207703_11678154 3300026035 Bacteria 611
308 Ga0207639_10203879 3300026041 Unclassified 1698
309 Ga0207708_10000936 3300026075 Bacteria 21857
310 Ga0207708_10005903 3300026075 Bacteria 9059
311 Ga0207708_10076932 3300026075 Bacteria 2560
312 Ga0207702_10014977 3300026078 Bacteria 6433
313 Ga0207648_10000316 3300026089 Bacteria 52941
314 Ga0207648_10012170 3300026089 Bacteria 8061
315 Ga0207648_10098142 3300026089 Bacteria 2564
316 Ga0207648_10280594 3300026089 Bacteria 1490
317 Ga0207648_10414948 3300026089 Bacteria 1222
318 Ga0207676_10036639 3300026095 Unclassified 3734
319 Ga0207676_11050539 3300026095 Bacteria 804
320 Ga0207674_10481037 3300026116 Bacteria 1200
321 Ga0207675_100000064 3300026118 Bacteria 79279
322 Ga0207675_100020995 3300026118 Bacteria 6088
323 Ga0207675_100776432 3300026118 Bacteria 970
324 Ga0209969_1003506 3300027360 Bacteria 2173
325 Ga0209969_1019015 3300027360 Bacteria 1017
326 Ga0209969_1021320 3300027360 Bacteria 967
327 Ga0209967_1000357 3300027364 Bacteria 6048
328 Ga0209981_1008074 3300027378 Bacteria 1426
329 Ga0209981_1012236 3300027378 Bacteria 1187
330 Ga0210000_1000809 3300027462 Bacteria 4332
331 Ga0210000_1010309 3300027462 Bacteria 1382
332 Ga0210000_1015146 3300027462 Bacteria 1159
333 Ga0209995_1002187 3300027471 Bacteria 3072
334 Ga0209968_1009734 3300027526 Bacteria 1473
335 Ga0209968_1014172 3300027526 Bacteria 1254
336 Ga0209968_1028151 3300027526 Unclassified 932
337 Ga0209983_1007574 3300027665 Bacteria 2224
338 Ga0209588_1019685 3300027671 Bacteria 2109
339 Ga0209588_1173135 3300027671 Bacteria 679
340 Ga0209966_1046734 3300027695 Unclassified 914
341 Ga0209966_1100938 3300027695 Bacteria 652
342 Ga0209998_10004757 3300027717 Bacteria 2869
343 Ga0207428_10006021 3300027907 Bacteria 11221
344 Ga0207428_10225761 3300027907 Bacteria 1403
345 Ga0207428_10323740 3300027907 Bacteria 1138
346 Ga0207428_11007083 3300027907 Bacteria 585
347 Ga0268265_10006971 3300028380 Bacteria 7644
348 Ga0268265_10014708 3300028380 Bacteria 5338
349 Ga0268265_10127613 3300028380 Bacteria 2108
350 Ga0268264_10001394 3300028381 Bacteria 22601
351 Ga0268264_10112410 3300028381 Unclassified 2388
352 Ga0307408_100009977 3300031548 Bacteria 6257
353 Ga0307408_100197104 3300031548 Bacteria 1627
354 Ga0307408_100899559 3300031548 Unclassified 810
355 Ga0307408_101239381 3300031548 Unclassified 697
356 Ga0307408_101396030 3300031548 Bacteria 659
357 Ga0307412_10623669 3300031911 Bacteria 916
358 Ga0307416_100014510 3300032002 Bacteria 5405
359 Ga0307416_100146913 3300032002 Bacteria 2154
360 Ga0307416_100450787 3300032002 Bacteria 1339
361 Ga0307416_100701589 3300032002 Bacteria 1101
362 Ga0307411_10079222 3300032005 Bacteria 2255
363 Ga0307411_10277041 3300032005 Bacteria 1333
364 Ga0307411_10531564 3300032005 Bacteria 1000
365 Ga0373948_0018888 3300034817 Archaea 1299
366 Ga0373959_0011584 3300034820 Unclassified 1560
367 Ga0373938_0040440 3300034957 Bacteria 1034
368 Ga0373938_0134466 3300034957 Bacteria 647
369 Ga0373926_0001625 3300035083 Bacteria 6933
370 Ga0373928_0048764 3300035084 Bacteria 994
371 Ga0373928_0106030 3300035084 Bacteria 739
372 Ga0373929_0029314 3300035085 Bacteria 1167
373 Ga0373929_0067608 3300035085 Bacteria 849
374 Ga0373934_0000505 3300035086 Bacteria 13698
375 Ga0373934_0059617 3300035086 Unclassified 1519
376 Ga0373934_0147300 3300035086 Unclassified 963
377 Ga0373940_0001144 3300035088 Bacteria 4640
378 Ga0373944_0001341 3300035089 Bacteria 6197
379 Ga0373949_0047640 3300035090 Bacteria 1072
380 Ga0373951_0009424 3300035091 Bacteria 2198
381 Ga0373952_0052459 3300035092 Bacteria 976
382 Ga0373923_0005638 3300035111 Bacteria 4263
383 Ga0373923_0359759 3300035111 Bacteria 696
384 Ga0373936_0063265 3300035113 Archaea 1514
385 Ga0373939_0004598 3300035114 Bacteria 3268
386 Ga0373939_0004651 3300035114 Bacteria 3252
387 Ga0373939_0015372 3300035114 Bacteria 2002
388 Ga0373941_0034851 3300035115 Bacteria 1521
389 Ga0373945_0009215 3300035116 Bacteria 3230
390 Ga0373953_0020872 3300035117 Unclassified 2451
391 Ga0373953_0029634 3300035117 Bacteria 2118
392 Ga0373953_0106868 3300035117 Unclassified 1181
393 Ga0373954_0000020 3300035118 Bacteria 60211
394 Ga0373954_0000592 3300035118 Bacteria 13753
395 Ga0373954_0013456 3300035118 Bacteria 3646
396 Ga0373954_0152396 3300035118 Unclassified 1129
397 Ga0373956_0000714 3300035119 Bacteria 13664
398 Ga0373956_0008076 3300035119 Bacteria 4256
399 Ga0373957_0010655 3300035120 Bacteria 3046
400 Ga0373957_0103267 3300035120 Bacteria 1143
401 Ga0373957_0209768 3300035120 Bacteria 813
402 Ga0373960_0096245 3300035121 Unclassified 954
403 Ga0373960_0096662 3300035121 Bacteria 952
404 Ga0373960_0126494 3300035121 Unclassified 853
405 Ga0373960_0129364 3300035121 Bacteria 845
406 Ga0373946_0005400 3300035171 Bacteria 4607
407 Ga0373955_0008526 3300035172 Bacteria 4764
408 Ga0373955_0020377 3300035172 Bacteria 3333
409 Ga0373955_0045973 3300035172 Bacteria 2358
410 Ga0373955_0778866 3300035172 Unclassified 588
411 Ga0373942_0019335 3300035207 Unclassified 1699
412 Ga0373942_0104127 3300035207 Bacteria 870
413 Ga0373942_0192844 3300035207 Unclassified 672
414 Ga0373961_0013206 3300035241 Unclassified 2078
415 Ga0373961_0053627 3300035241 Bacteria 1204
416 Ga0373961_0110463 3300035241 Unclassified 900
417 Ga0373962_0023028 3300035242 Bacteria 1656
418 Ga0373924_0011800 3300035410 Bacteria 3251
419 Ga0373924_0034126 3300035410 Bacteria 2058
420 Ga0373931_0003341 3300035691 Bacteria 7186
421 Ga0373931_0017425 3300035691 Bacteria 3553
422 Ga0373931_0069470 3300035691 Unclassified 1919
423 Ga0373931_0099167 3300035691 Bacteria 1636
424 Ga0373931_0145086 3300035691 Bacteria 1379
425 Ga0373931_0430763 3300035691 Bacteria 840
426 Ga0373935_0007432 3300035692 Bacteria 6558
427 Ga0373935_0010129 3300035692 Bacteria 5645
428 Ga0373935_0164435 3300035692 Bacteria 1514
429 Ga0373935_0226679 3300035692 Bacteria 1300
430 Ga0373935_0937556 3300035692 Bacteria 642
431 Ga0373927_0028362 3300035695 Bacteria 3650
432 Ga0373927_0342917 3300035695 Bacteria 984
433 Ga0373933_0001085 3300035724 Bacteria 16282
434 Ga0373933_0010314 3300035724 Bacteria 5120
435 Ga0373933_0023497 3300035724 Bacteria 3522
436 Ga0373933_0089132 3300035724 Bacteria 1901
437 Ga0373933_0248342 3300035724 Bacteria 1145
438 Ga0373947_0188465 3300035725 Unclassified 1345
439 Ga0373947_0303141 3300035725 Archaea 1065
440 Ga0373937_0005040 3300036401 Bacteria 11244
441 Ga0373937_0011050 3300036401 Bacteria 7914
442 Ga0373937_0044614 3300036401 Bacteria 4050
443 Ga0373937_0047468 3300036401 Bacteria 3929
444 Ga0373937_0092999 3300036401 Bacteria 2795
445 Ga0373937_0619215 3300036401 Bacteria 1027
446 Ga0373925_0284174 3300037068 Bacteria 1333
447 Ga0242420_023185 3300038996 Bacteria 1120
448 Ga0439439_0042570 3300041406 Bacteria 1180
449 Ga0439461_0002846 3300041410 Bacteria 2800
450 Ga0439465_0151432 3300041413 Unclassified 829
451 Ga0451807_1028620 3300041486 Bacteria 1526
452 Ga0451853_4099157 3300041512 Bacteria 781
453 Ga0439441_016881 3300042001 Bacteria 1306
454 Ga0439441_028188 3300042001 Bacteria 1075
455 Ga0439462_0063660 3300042015 Bacteria 998
456 Ga0439446_0027521 3300042156 Bacteria 1632
457 Ga0439434_0012556 3300042435 Bacteria 2506
458 Ga0439434_0029512 3300042435 Bacteria 1663
459 Ga0439435_0009299 3300042436 Bacteria 2303
460 Ga0439435_0026661 3300042436 Unclassified 1540
461 Ga0439435_0072329 3300042436 Bacteria 1022
462 Ga0439435_0109451 3300042436 Unclassified 856
463 Ga0439444_0018510 3300042437 Bacteria 1206
464 Ga0439444_0020499 3300042437 Bacteria 1163
465 Ga0439460_0002845 3300042461 Bacteria 4167
466 Ga0450893_0010142 3300042532 Bacteria 1545
467 Ga0451577_0810099 3300042876 Bacteria 846
468 Ga0451577_1191818 3300042876 Bacteria 679
469 Ga0466964_0040288 3300044706 Unclassified 1886
470 Ga0453684_0364527 3300044712 Unclassified 1626
471 Ga0466957_0047747 3300044842 Unclassified 2602
472 Ga0466960_0074678 3300044901 Bacteria 1695
473 Ga0451576_0000822 3300045051 Bacteria 60600
474 Ga0451576_0022841 3300045051 Bacteria 6777
475 Ga0451576_0029853 3300045051 Bacteria 5832
476 Ga0451576_0098737 3300045051 Bacteria 3037
477 Ga0451576_0177885 3300045051 Bacteria 2221
478 Ga0451576_0520242 3300045051 Bacteria 1250
479 Ga0466967_0164773 3300045976 Bacteria 2082
480 Ga0495592_0000293 3300046454 Bacteria 42689
481 Ga0495592_0044598 3300046454 Bacteria 3312
482 Ga0495592_0057151 3300046454 Bacteria 2880
483 Ga0495592_0136588 3300046454 Bacteria 1709
484 Ga0495603_0046469 3300046455 Bacteria 2587
485 Ga0495629_0476902 3300046459 Bacteria 843
486 Ga0495641_0010332 3300046461 Bacteria 5420
487 Ga0495641_0058502 3300046461 Unclassified 1744
488 Ga0495651_0011710 3300046462 Bacteria 6740
489 Ga0495651_0176623 3300046462 Bacteria 1516
490 Ga0495651_0376261 3300046462 Bacteria 932
491 Ga0495653_0190250 3300046463 Unclassified 1401
492 Ga0495580_0087444 3300046472 Bacteria 2170
493 Ga0495582_0012388 3300046473 Bacteria 4698
494 Ga0495639_0005058 3300046475 Bacteria 5665
495 Ga0495639_0030059 3300046475 Unclassified 2413
496 Ga0495662_0005966 3300046476 Bacteria 6088
497 Ga0495662_0017552 3300046476 Bacteria 3464
498 Ga0495662_0026785 3300046476 Bacteria 2784
499 Ga0495594_0304706 3300046499 Bacteria 907
500 Ga0495608_0047424 3300046511 Bacteria 2856
501 Ga0495608_0072742 3300046511 Bacteria 2242
502 Ga0495608_0150098 3300046511 Bacteria 1485
503 Ga0495608_0178831 3300046511 Bacteria 1343
504 Ga0495608_0337276 3300046511 Bacteria 929
505 Ga0495618_0033479 3300046514 Bacteria 3222
506 Ga0495618_0230766 3300046514 Unclassified 1165
507 Ga0495628_0017983 3300046516 Bacteria 5864
508 Ga0495628_0024530 3300046516 Bacteria 4935
509 Ga0495628_0080332 3300046516 Bacteria 2535
510 Ga0495628_0200299 3300046516 Unclassified 1504
511 Ga0495628_0251110 3300046516 Unclassified 1320
512 Ga0495628_0355832 3300046516 Bacteria 1076
513 Ga0495630_0032665 3300046517 Bacteria 3879
514 Ga0495630_0055939 3300046517 Bacteria 2956
515 Ga0495630_0081150 3300046517 Unclassified 2447
516 Ga0495644_0111494 3300046523 Bacteria 1038
517 Ga0495663_0159817 3300046525 Unclassified 773
518 Ga0495666_0033095 3300046526 Bacteria 2527
519 Ga0495666_0176120 3300046526 Bacteria 988
520 Ga0495642_0031610 3300046528 Bacteria 2123
521 Ga0495642_0239912 3300046528 Bacteria 792
522 Ga0495652_0086237 3300046529 Bacteria 2578
523 Ga0495652_0146302 3300046529 Bacteria 1852
524 Ga0495652_0298567 3300046529 Bacteria 1172
525 Ga0495665_0085235 3300046531 Bacteria 1660
526 Ga0495640_0018156 3300046533 Bacteria 5227
527 Ga0495640_0044954 3300046533 Bacteria 3066
528 Ga0495640_0242237 3300046533 Bacteria 1131
529 Ga0495586_0008518 3300046535 Bacteria 5457
530 Ga0495586_0176346 3300046535 Bacteria 1208
531 Ga0495586_0203553 3300046535 Unclassified 1122
532 Ga0495587_0024137 3300046536 Bacteria 3731
533 Ga0495587_0058727 3300046536 Bacteria 2259
534 Ga0495587_0167599 3300046536 Unclassified 1248
535 Ga0495598_0054186 3300046537 Bacteria 1217
536 Ga0495598_0132401 3300046537 Unclassified 856
537 Ga0495609_0108116 3300046538 Bacteria 1202
538 Ga0495621_0060974 3300046539 Bacteria 1369
539 Ga0495621_0074683 3300046539 Bacteria 1255
540 Ga0495645_0000344 3300046543 Bacteria 32939
541 Ga0495645_0078290 3300046543 Bacteria 2376
542 Ga0495667_0018506 3300046559 Bacteria 4706
543 Ga0495667_0064884 3300046559 Bacteria 2388
544 Ga0495667_0083269 3300046559 Bacteria 2077
545 Ga0495667_0118538 3300046559 Unclassified 1709
546 Ga0495667_0736911 3300046559 Bacteria 609
547 Ga0495634_0012351 3300046642 Bacteria 6185
548 Ga0495634_0022467 3300046642 Bacteria 4444
549 Ga0495634_0068049 3300046642 Bacteria 2353
550 Ga0495635_0056142 3300046663 Bacteria 2712
551 Ga0495635_0182715 3300046663 Bacteria 1425
552 Ga0495659_0125174 3300046664 Bacteria 1015
553 Ga0495659_0196544 3300046664 Bacteria 826
554 Ga0495588_0060033 3300046674 Bacteria 1968
555 Ga0495657_0014522 3300046675 Bacteria 5778
556 Ga0495657_0116727 3300046675 Bacteria 1685
557 Ga0495657_0159295 3300046675 Bacteria 1397
558 Ga0495657_0180204 3300046675 Bacteria 1297
559 Ga0495599_0000231 3300046678 Bacteria 35177
560 Ga0495599_0022846 3300046678 Bacteria 3906
561 Ga0495646_0156587 3300046680 Unclassified 1264
562 Ga0495647_0004648 3300046681 Bacteria 4474
563 Ga0495647_0310225 3300046681 Bacteria 712
564 Ga0495658_0015526 3300046683 Bacteria 3907
565 Ga0495658_0036547 3300046683 Bacteria 2710
566 Ga0495658_0519895 3300046683 Bacteria 762
567 Ga0495669_0033260 3300046684 Bacteria 2269
568 Ga0495613_0024505 3300046689 Bacteria 4495
569 Ga0495613_0031717 3300046689 Bacteria 3925
570 Ga0495624_0231645 3300046690 Bacteria 1119
571 Ga0495600_0009220 3300046809 Bacteria 6087
572 Ga0495600_0036340 3300046809 Bacteria 3201
573 Ga0495581_0123335 3300047315 Bacteria 1508
574 Ga0495581_0683956 3300047315 Bacteria 592
575 Ga0495604_0011098 3300047317 Bacteria 7151
576 Ga0495604_0015663 3300047317 Bacteria 6052
577 Ga0495636_0002166 3300047318 Bacteria 7532
578 Ga0495674_0080284 3300047319 Unclassified 2799
579 Ga0495674_0084033 3300047319 Bacteria 2728
580 Ga0495676_0211726 3300047321 Bacteria 1340
581 Ga0495680_0032475 3300047322 Bacteria 4236
582 Ga0495680_0056542 3300047322 Bacteria 3037
583 Ga0495680_0079301 3300047322 Bacteria 2483
584 Ga0495680_0101042 3300047322 Unclassified 2148
585 Ga0495680_0170505 3300047322 Bacteria 1576
586 Ga0495684_0025957 3300047471 Bacteria 4502
587 Ga0495684_0096567 3300047471 Bacteria 2236
588 Ga0495684_0319093 3300047471 Bacteria 1111
589 Ga0495684_0320692 3300047471 Unclassified 1108
590 Ga0495684_0700763 3300047471 Bacteria 671
591 Ga0495614_0164452 3300048089 Bacteria 994
592 Ga0501292_119558 3300049515 Bacteria 536
593 Ga0501298_073631 3300049521 Bacteria 741
594 Ga0501033_0030094 3300049570 Bacteria 4080
595 Ga0501036_0401188 3300049572 Bacteria 1144
596 Ga0501037_0253477 3300049573 Bacteria 1231
597 Ga0501037_0480080 3300049573 Bacteria 845
598 Ga0501038_0050494 3300049574 Bacteria 3593
599 Ga0501038_0305991 3300049574 Bacteria 1246
600 Ga0501039_0078134 3300049575 Bacteria 2574
601 Ga0501039_0318257 3300049575 Bacteria 1223
602 Ga0501039_0378992 3300049575 Bacteria 1111
603 Ga0501039_0762417 3300049575 Bacteria 755
604 Ga0501040_0034358 3300049576 Bacteria 3435
605 Ga0501040_0156972 3300049576 Unclassified 1607
606 Ga0501040_0402107 3300049576 Bacteria 983
607 Ga0501040_0454069 3300049576 Bacteria 922
608 Ga0501041_0137227 3300049577 Bacteria 1524
609 Ga0501041_0285010 3300049577 Bacteria 1040
610 Ga0501041_0330409 3300049577 Unclassified 962
611 Ga0501041_0463001 3300049577 Bacteria 805
612 Ga0501042_0035847 3300049578 Bacteria 3519
613 Ga0501042_0309100 3300049578 Bacteria 1142
614 Ga0501042_0444357 3300049578 Unclassified 940
615 Ga0501043_0812048 3300049579 Unclassified 676
616 Ga0501046_0028053 3300049580 Bacteria 4588
617 Ga0501046_0055514 3300049580 Bacteria 3112
618 Ga0501046_0541311 3300049580 Bacteria 831
619 Ga0501048_0083168 3300049582 Bacteria 2257
620 Ga0501048_0189561 3300049582 Bacteria 1457
621 Ga0501048_0662988 3300049582 Bacteria 749
622 Ga0501068_0032306 3300049584 Bacteria 3113
623 Ga0501071_0000879 3300049587 Bacteria 16236
624 Ga0501071_0071317 3300049587 Bacteria 2532
625 Ga0501071_0469648 3300049587 Bacteria 964
626 Ga0501072_0003042 3300049588 Bacteria 12653
627 Ga0501072_0076283 3300049588 Bacteria 2652
628 Ga0501072_0077852 3300049588 Bacteria 2626
629 Ga0501072_0081610 3300049588 Bacteria 2563
630 Ga0501072_0126733 3300049588 Bacteria 2034
631 Ga0501073_0155271 3300049589 Bacteria 1586
632 Ga0501073_0284449 3300049589 Bacteria 1141
633 Ga0501074_0211108 3300049590 Bacteria 1383
634 Ga0501075_0044465 3300049591 Bacteria 3332
635 Ga0501075_0166662 3300049591 Bacteria 1681
636 Ga0501075_0181147 3300049591 Bacteria 1607
637 Ga0501076_0001168 3300049592 Bacteria 17374
638 Ga0501077_0213297 3300049593 Bacteria 1227
639 Ga0501235_044322 3300049669 Bacteria 1022
640 Ga0501249_034262 3300049679 Bacteria 1139
641 Ga0501079_0002730 3300049741 Bacteria 12860
642 Ga0501079_0041684 3300049741 Bacteria 3545
643 Ga0501079_0358803 3300049741 Bacteria 1142
644 Ga0501080_0058100 3300049742 Bacteria 3601
645 Ga0501081_0013737 3300049743 Bacteria 5326
646 Ga0501273_014629 3300049770 Bacteria 1012
647 Ga0501035_0047672 3300049822 Bacteria 3845
648 Ga0501035_0432495 3300049822 Bacteria 1091
649 Ga0501045_0068835 3300049824 Bacteria 2601
650 Ga0501045_0082061 3300049824 Bacteria 2377
651 nmdc:mga05p37_109_c1 3300050507 Bacteria 74571
652 nmdc:mga05p37_261434_c1 3300050507 Bacteria 2071
653 nmdc:mga05p37_358492_c1 3300050507 Bacteria 1715
654 nmdc:mga05p37_604246_c1 3300050507 Bacteria 1237
655 nmdc:mga05p37_886_c1 3300050507 Bacteria 33754
656 nmdc:mga09592_140748_c1 3300050508 Bacteria 2080
657 nmdc:mga09592_202854_c1 3300050508 Unclassified 1717
658 nmdc:mga09592_2901_c1 3300050508 Bacteria 13899
659 nmdc:mga09592_6868_c1 3300050508 Bacteria 9261
660 nmdc:mga0qj67_1170396_c1 3300050509 Unclassified 599
661 nmdc:mga0qj67_137754_c1 3300050509 Unclassified 1978
662 nmdc:mga0qj67_2700_c1 3300050509 Bacteria 12721
663 nmdc:mga0qj67_27222_c1 3300050509 Bacteria 4428
664 nmdc:mga0qj67_385230_c1 3300050509 Bacteria 1132
665 nmdc:mga0qj67_41917_c1 3300050509 Bacteria 3603
666 nmdc:mga0qj67_422082_c1 3300050509 Bacteria 1075
667 nmdc:mga0qj67_507182_c1 3300050509 Bacteria 970
668 nmdc:mga0qj67_662400_c1 3300050509 Unclassified 832
669 nmdc:mga0qj67_6924_c1 3300050509 Bacteria 8346
670 nmdc:mga06r32_1611305_c1 3300050510 Bacteria 587
671 nmdc:mga06r32_16323_c1 3300050510 Bacteria 6764
672 nmdc:mga06r32_173746_c1 3300050510 Bacteria 2139
673 nmdc:mga06r32_287585_c1 3300050510 Bacteria 1631
674 nmdc:mga06r32_309216_c1 3300050510 Unclassified 1566
675 nmdc:mga06r32_383217_c1 3300050510 Bacteria 1389
676 nmdc:mga06r32_395194_c1 3300050510 Bacteria 1365
677 nmdc:mga08y16_152610_c1 3300050511 Bacteria 2401
678 nmdc:mga08y16_189087_c1 3300050511 Unclassified 2136
679 nmdc:mga08y16_346845_c1 3300050511 Bacteria 1526
680 nmdc:mga08y16_429286_c1 3300050511 Unclassified 1350
681 nmdc:mga08y16_90814_c1 3300050511 Bacteria 3184
682 nmdc:mga0n895_423934_c1 3300050512 Bacteria 1345
683 nmdc:mga0n895_4702_c1 3300050512 Bacteria 11267
684 nmdc:mga0n895_677390_c1 3300050512 Unclassified 1028
685 nmdc:mga0n895_772692_c1 3300050512 Archaea 952
686 nmdc:mga0n895_8407_c1 3300050512 Bacteria 8937
687 nmdc:mga0n895_86_c1 3300050512 Bacteria 53794
688 nmdc:mga0rr50_241822_c1 3300050513 Unclassified 1496
689 nmdc:mga0rr50_3195_c1 3300050513 Bacteria 9370
690 nmdc:mga0rr50_390926_c1 3300050513 Bacteria 1174
691 nmdc:mga0rr50_664_c1 3300050513 Bacteria 18446
692 nmdc:mga08x19_11713_c1 3300050514 Bacteria 5282
693 nmdc:mga08x19_138253_c1 3300050514 Bacteria 1644
694 nmdc:mga08x19_20408_c1 3300050514 Bacteria 4079
695 nmdc:mga08x19_4656_c1 3300050514 Bacteria 8139
696 nmdc:mga08x19_557910_c1 3300050514 Bacteria 811
697 nmdc:mga08x19_6463_c1 3300050514 Bacteria 6938
698 nmdc:mga08x19_70089_c1 3300050514 Bacteria 2284
699 nmdc:mga08x19_758067_c1 3300050514 Unclassified 689
700 nmdc:mga0a205_281873_c1 3300050515 Bacteria 1537
701 nmdc:mga0a205_31489_c1 3300050515 Bacteria 5081
702 nmdc:mga0a205_385096_c1 3300050515 Unclassified 1267
703 nmdc:mga0a205_505_c1 3300050515 Bacteria 30610
704 Ga0495601_0000862 3300053077 Bacteria 16539
705 Ga0495601_0018854 3300053077 Bacteria 4203
706 Ga0495601_0029688 3300053077 Bacteria 3393
707 Ga0495601_0153551 3300053077 Bacteria 1503
708 Ga0495601_0254334 3300053077 Bacteria 1147
709 Ga0495595_0008449 3300053084 Bacteria 4225
710 Ga0495595_0523631 3300053084 Bacteria 605
711 Ga0495619_0034504 3300053085 Bacteria 3289
712 Ga0495619_0108655 3300053085 Unclassified 1893
713 Ga0501084_0047735 3300054114 Bacteria 3586
714 Ga0501084_0096251 3300054114 Bacteria 2486
715 Ga0501084_0544486 3300054114 Bacteria 981
716 Ga0590075_057417 3300059424 Bacteria 1002
717 Ga0501082_0237309 3300060353 Bacteria 1587
718 Ga0501082_0744156 3300060353 Bacteria 858
719 Ga0530510_0001231 3300061734 Bacteria 17086
720 Ga0530510_0215943 3300061734 Bacteria 1425
721 Ga0530510_0220211 3300061734 Unclassified 1411
722 Ga0530510_1022899 3300061734 Bacteria 632
723 Ga0070696_100218371
724 Ga0065707_10020436
725 Ga0065707_10104294
726 Ga0070676_10060495
727 Ga0070683_100103896
728 Ga0070683_101282509
729 Ga0070690_100000398
730 Ga0070690_100138389
731 Ga0068869_100001796
732 Ga0068869_100034494
733 Ga0070680_100001167
734 Ga0070680_100098560
735 Ga0070680_100118801
736 Ga0070680_100132431
737 Ga0070680_101115375
738 Ga0070682_100001096
739 Ga0068868_100005562
740 Ga0070689_100000188
741 Ga0070689_100024102
742 Ga0070689_100097747
743 Ga0070689_100109570
744 Ga0070689_100701409
745 Ga0070691_10022630
746 Ga0070687_100000069
747 Ga0070687_100232332
748 Ga0070692_10010076
749 Ga0070692_10303448
750 Ga0070668_100022871
751 Ga0070669_100013309
752 Ga0070669_100364818
753 Ga0070675_100230481
754 Ga0070671_100579148
755 Ga0070673_100269484
756 Ga0070673_100461768
757 Ga0070688_100146232
758 Ga0070688_100214206
759 Ga0070688_101090354
760 Ga0070659_101147652
761 Ga0070667_100761048
762 Ga0070703_10083362
763 Ga0070714_100100787
764 Ga0070713_100195808
765 Ga0070710_10152865
766 Ga0070701_10000603
767 Ga0070711_100422986
768 Ga0070705_100001149
769 Ga0070705_100010469
770 Ga0070705_100024627
771 Ga0070705_100168798
772 Ga0070705_100234559
773 Ga0070700_100008466
774 Ga0070700_100023110
775 Ga0070700_101036391
776 Ga0070694_100001966
777 Ga0070694_100038605
778 Ga0070694_100102411
779 Ga0070694_100154825
780 Ga0070694_100240387
781 Ga0070694_100319385
782 Ga0070694_100519864
783 Ga0070694_100754982
784 Ga0070694_100915354
785 Ga0070708_100623349
786 Ga0070681_10035955
787 Ga0070681_10120479
788 Ga0070681_10229224
789 Ga0068867_100000296
790 Ga0068867_100011080
791 Ga0068867_100899274
792 Ga0068867_101254362
793 Ga0070706_100768166
794 Ga0070706_101373514
795 Ga0070707_100573127
796 Ga0070698_100052274
797 Ga0070698_100092149
798 Ga0070698_100490415
799 Ga0070699_100100337
800 Ga0070699_100234972
801 Ga0070699_100690030
802 Ga0070699_101002427
803 Ga0070679_100003737
804 Ga0070679_100112749
805 Ga0070679_100256385
806 Ga0070684_100212309
807 Ga0070697_100009252
808 Ga0070697_100396270
809 Ga0068853_100072412
810 Ga0070672_101561865
811 Ga0070686_100000090
812 Ga0070686_100267793
813 Ga0070686_100358380
814 Ga0070686_100429094
815 Ga0070686_100434628
816 Ga0070686_101194839
817 Ga0070695_100000188
818 Ga0070695_100004474
819 Ga0070695_100022517
820 Ga0070695_100119152
821 Ga0070695_100226764
822 Ga0070695_100443880
823 Ga0070695_100465393
824 Ga0070696_100000719
825 Ga0070696_100002632
826 Ga0070696_100036360
827 Ga0070696_100039245
828 Ga0070696_100461964
829 Ga0070693_100000525
830 Ga0070704_100000168
831 Ga0070704_100000545
832 Ga0070704_100006984
833 Ga0070704_100037205
834 Ga0070704_100099034
835 Ga0070704_100466991
836 Ga0070704_100622522
837 Ga0070704_101053583
838 Ga0068855_100000833
839 Ga0068854_100000657
840 Ga0068854_100764757
841 Ga0068856_100003103
842 Ga0070702_100000002
843 Ga0070702_100004543
844 Ga0070702_100595670
845 Ga0068852_100439119
846 Ga0068859_100000195
847 Ga0068859_100115984
848 Ga0068859_100345673
849 Ga0068859_100719125
850 Ga0068864_100319590
851 Ga0068864_100666633
852 Ga0068866_10002071
853 Ga0068866_10089292
854 Ga0068861_100000043
855 Ga0068861_100062821
856 Ga0068858_100005138
857 Ga0068858_100199292
858 Ga0068860_100002559
859 Ga0068860_100083022
860 Ga0068862_100002188
861 Ga0068862_100070855
862 Ga0068862_100132940
863 Ga0068862_101635017
864 Ga0081538_10125963
865 Ga0081539_10000233
866 Ga0070715_10050628
867 Ga0070716_100007311
868 Ga0070716_100059116
869 Ga0097621_100000045
870 Ga0097621_100016034
871 Ga0097621_100167247
872 Ga0097621_100350612
873 Ga0068871_100000040
874 Ga0068871_100012220
875 Ga0075428_100000047
876 Ga0075428_100043245
877 Ga0075428_100050115
878 Ga0075428_100097885
879 Ga0075428_100253105
880 Ga0075428_100530864
881 Ga0075428_101074348
882 Ga0075430_100004392
883 Ga0075430_100018834
884 Ga0075430_100023346
885 Ga0075430_100058324
886 Ga0075430_100147024
887 Ga0075430_100164839
888 Ga0075431_100014374
889 Ga0075431_100101199
890 Ga0075431_100120534
891 Ga0075431_100237297
892 Ga0075433_10000605
893 Ga0075433_10071751
894 Ga0075434_100000006
895 Ga0075434_100000554
896 Ga0075434_100047891
897 Ga0075434_101456026
898 Ga0075434_101813977
899 Ga0075434_102044309
900 Ga0075429_100000008
901 Ga0075429_100000067
902 Ga0075429_100052460
903 Ga0075429_100177709
904 Ga0075429_100298831
905 Ga0075429_101293697
906 Ga0068865_100001956
907 Ga0075436_100000174
908 Ga0075436_100001082
909 Ga0075436_100009225
910 Ga0075436_100022044
911 Ga0075436_100072304
912 Ga0075436_100090296
913 Ga0075436_100127289
914 Ga0075436_100349398
915 Ga0075436_100466701
916 Ga0097620_100000195
917 Ga0097620_100115982
918 Ga0097620_100345671
919 Ga0097620_100719110
920 Ga0075435_100020896
921 Ga0075435_100039691
922 Ga0075435_100058248
923 Ga0075435_100433430
924 Ga0099794_10501479
925 Ga0105250_10073498
926 Ga0105250_10375435
927 Ga0111539_10219068
928 Ga0111539_10226278
929 Ga0111539_10663354
930 Ga0111539_11002257
931 Ga0111539_11198955
932 Ga0111539_11293948
933 Ga0105245_10000306
934 Ga0105245_10048544
935 Ga0105245_10536166
936 Ga0105245_11794603
937 Ga0114129_10000040
938 Ga0114129_10021807
939 Ga0114129_10210929
940 Ga0114129_10298916
941 Ga0114129_10710863
942 Ga0114129_10897341
943 Ga0114129_10981008
944 Ga0114129_12239374
945 Ga0105243_10000035
946 Ga0105243_10002936
947 Ga0105241_10070539
948 Ga0105242_10004996
949 Ga0105242_10039137
950 Ga0105242_10258541
951 Ga0105242_11735615
952 Ga0105249_10007943
953 Ga0105249_10055112
954 Ga0105249_10189440
955 Ga0105239_10048386
956 Ga0157316_1019378
957 Ga0157378_10001996
958 Ga0157378_10686009
959 Ga0163162_10347688
960 Ga0157372_11047746
961 Ga0157372_11048349
962 Ga0157375_10133322
963 Ga0157375_10546244
964 Ga0157380_10018970
965 Ga0157380_10106095
966 Ga0157380_10154190
967 Ga0157380_11415728
968 Ga0157377_10049229
969 Ga0157377_10286936
970 Ga0157379_10978035
971 Ga0157376_10000403
972 Ga0157376_10022959
973 Ga0163161_10225180
974 Ga0207692_10117272
975 Ga0207642_10003118
976 Ga0207642_10052050
977 Ga0207685_10260991
978 Ga0207645_10414579
979 Ga0207643_10044298
980 Ga0207643_10084606
981 Ga0207684_10682965
982 Ga0207654_10034497
983 Ga0207707_10028946
984 Ga0207707_10048467
985 Ga0207707_10476037
986 Ga0207693_10462161
987 Ga0207663_10133508
988 Ga0207660_10006506
989 Ga0207660_10047673
990 Ga0207660_10088771
991 Ga0207660_10155707
992 Ga0207660_10914922
993 Ga0207662_10000006
994 Ga0207662_10039730
995 Ga0207652_10088081
996 Ga0207646_10280400
997 Ga0207681_10025231
998 Ga0207687_10003249
999 Ga0207687_10027525
1000 Ga0207664_10036885
1001 Ga0207644_10540261
1002 Ga0207686_10003499
1003 Ga0207686_10016405
1004 Ga0207686_11024912
1005 Ga0207709_10007469
1006 Ga0207709_10015032
1007 Ga0207670_10001617
1008 Ga0207670_10020433
1009 Ga0207670_10117777
1010 Ga0207670_10594479
1011 Ga0207669_10021023
1012 Ga0207665_10007350
1013 Ga0207665_10081009
1014 Ga0207665_10663647
1015 Ga0207711_10530941
1016 Ga0207711_11559720
1017 Ga0207689_10000082
1018 Ga0207689_10010692
1019 Ga0207689_10097302
1020 Ga0207689_10229664
1021 Ga0207661_10010666
1022 Ga0207667_10012981
1023 Ga0207651_10048965
1024 Ga0207712_10033486
1025 Ga0207712_10096830
1026 Ga0207640_10001404
1027 Ga0207677_10005887
1028 Ga0207703_10017112
1029 Ga0207703_11678154
1030 Ga0207639_10203879
1031 Ga0207708_10000936
1032 Ga0207708_10005903
1033 Ga0207708_10076932
1034 Ga0207702_10014977
1035 Ga0207648_10000316
1036 Ga0207648_10012170
1037 Ga0207648_10098142
1038 Ga0207648_10280594
1039 Ga0207648_10414948
1040 Ga0207676_10036639
1041 Ga0207676_11050539
1042 Ga0207674_10481037
1043 Ga0207675_100000064
1044 Ga0207675_100020995
1045 Ga0207675_100776432
1046 Ga0209969_1003506
1047 Ga0209969_1019015
1048 Ga0209969_1021320
1049 Ga0209967_1000357
1050 Ga0209981_1008074
1051 Ga0209981_1012236
1052 Ga0210000_1000809
1053 Ga0210000_1010309
1054 Ga0210000_1015146
1055 Ga0209995_1002187
1056 Ga0209968_1009734
1057 Ga0209968_1014172
1058 Ga0209968_1028151
1059 Ga0209983_1007574
1060 Ga0209588_1019685
1061 Ga0209588_1173135
1062 Ga0209966_1046734
1063 Ga0209966_1100938
1064 Ga0209998_10004757
1065 Ga0207428_10006021
1066 Ga0207428_10225761
1067 Ga0207428_10323740
1068 Ga0207428_11007083
1069 Ga0268265_10006971
1070 Ga0268265_10014708
1071 Ga0268265_10127613
1072 Ga0268264_10001394
1073 Ga0268264_10112410
1074 Ga0307408_100009977
1075 Ga0307408_100197104
1076 Ga0307408_100899559
1077 Ga0307408_101239381
1078 Ga0307408_101396030
1079 Ga0307412_10623669
1080 Ga0307416_100014510
1081 Ga0307416_100146913
1082 Ga0307416_100450787
1083 Ga0307416_100701589
1084 Ga0307411_10079222
1085 Ga0307411_10277041
1086 Ga0307411_10531564
1087 Ga0373948_0018888
1088 Ga0373959_0011584
1089 Ga0373938_0040440
1090 Ga0373938_0134466
1091 Ga0373926_0001625
1092 Ga0373928_0048764
1093 Ga0373928_0106030
1094 Ga0373929_0029314
1095 Ga0373929_0067608
1096 Ga0373934_0000505
1097 Ga0373934_0059617
1098 Ga0373934_0147300
1099 Ga0373940_0001144
1100 Ga0373944_0001341
1101 Ga0373949_0047640
1102 Ga0373951_0009424
1103 Ga0373952_0052459
1104 Ga0373923_0005638
1105 Ga0373923_0359759
1106 Ga0373936_0063265
1107 Ga0373939_0004598
1108 Ga0373939_0004651
1109 Ga0373939_0015372
1110 Ga0373941_0034851
1111 Ga0373945_0009215
1112 Ga0373953_0020872
1113 Ga0373953_0029634
1114 Ga0373953_0106868
1115 Ga0373954_0000020
1116 Ga0373954_0000592
1117 Ga0373954_0013456
1118 Ga0373954_0152396
1119 Ga0373956_0000714
1120 Ga0373956_0008076
1121 Ga0373957_0010655
1122 Ga0373957_0103267
1123 Ga0373957_0209768
1124 Ga0373960_0096245
1125 Ga0373960_0096662
1126 Ga0373960_0126494
1127 Ga0373960_0129364
1128 Ga0373946_0005400
1129 Ga0373955_0008526
1130 Ga0373955_0020377
1131 Ga0373955_0045973
1132 Ga0373955_0778866
1133 Ga0373942_0019335
1134 Ga0373942_0104127
1135 Ga0373942_0192844
1136 Ga0373961_0013206
1137 Ga0373961_0053627
1138 Ga0373961_0110463
1139 Ga0373962_0023028
1140 Ga0373924_0011800
1141 Ga0373924_0034126
1142 Ga0373931_0003341
1143 Ga0373931_0017425
1144 Ga0373931_0069470
1145 Ga0373931_0099167
1146 Ga0373931_0145086
1147 Ga0373931_0430763
1148 Ga0373935_0007432
1149 Ga0373935_0010129
1150 Ga0373935_0164435
1151 Ga0373935_0226679
1152 Ga0373935_0937556
1153 Ga0373927_0028362
1154 Ga0373927_0342917
1155 Ga0373933_0001085
1156 Ga0373933_0010314
1157 Ga0373933_0023497
1158 Ga0373933_0089132
1159 Ga0373933_0248342
1160 Ga0373947_0188465
1161 Ga0373947_0303141
1162 Ga0373937_0005040
1163 Ga0373937_0011050
1164 Ga0373937_0044614
1165 Ga0373937_0047468
1166 Ga0373937_0092999
1167 Ga0373937_0619215
1168 Ga0373925_0284174
1169 Ga0242420_023185
1170 Ga0439439_0042570
1171 Ga0439461_0002846
1172 Ga0439465_0151432
1173 Ga0451807_1028620
1174 Ga0451853_4099157
1175 Ga0439441_016881
1176 Ga0439441_028188
1177 Ga0439462_0063660
1178 Ga0439446_0027521
1179 Ga0439434_0012556
1180 Ga0439434_0029512
1181 Ga0439435_0009299
1182 Ga0439435_0026661
1183 Ga0439435_0072329
1184 Ga0439435_0109451
1185 Ga0439444_0018510
1186 Ga0439444_0020499
1187 Ga0439460_0002845
1188 Ga0450893_0010142
1189 Ga0451577_0810099
1190 Ga0451577_1191818
1191 Ga0466964_0040288
1192 Ga0453684_0364527
1193 Ga0466957_0047747
1194 Ga0466960_0074678
1195 Ga0451576_0000822
1196 Ga0451576_0022841
1197 Ga0451576_0029853
1198 Ga0451576_0098737
1199 Ga0451576_0177885
1200 Ga0451576_0520242
1201 Ga0466967_0164773
1202 Ga0495592_0000293
1203 Ga0495592_0044598
1204 Ga0495592_0057151
1205 Ga0495592_0136588
1206 Ga0495603_0046469
1207 Ga0495629_0476902
1208 Ga0495641_0010332
1209 Ga0495641_0058502
1210 Ga0495651_0011710
1211 Ga0495651_0176623
1212 Ga0495651_0376261
1213 Ga0495653_0190250
1214 Ga0495580_0087444
1215 Ga0495582_0012388
1216 Ga0495639_0005058
1217 Ga0495639_0030059
1218 Ga0495662_0005966
1219 Ga0495662_0017552
1220 Ga0495662_0026785
1221 Ga0495594_0304706
1222 Ga0495608_0047424
1223 Ga0495608_0072742
1224 Ga0495608_0150098
1225 Ga0495608_0178831
1226 Ga0495608_0337276
1227 Ga0495618_0033479
1228 Ga0495618_0230766
1229 Ga0495628_0017983
1230 Ga0495628_0024530
1231 Ga0495628_0080332
1232 Ga0495628_0200299
1233 Ga0495628_0251110
1234 Ga0495628_0355832
1235 Ga0495630_0032665
1236 Ga0495630_0055939
1237 Ga0495630_0081150
1238 Ga0495644_0111494
1239 Ga0495663_0159817
1240 Ga0495666_0033095
1241 Ga0495666_0176120
1242 Ga0495642_0031610
1243 Ga0495642_0239912
1244 Ga0495652_0086237
1245 Ga0495652_0146302
1246 Ga0495652_0298567
1247 Ga0495665_0085235
1248 Ga0495640_0018156
1249 Ga0495640_0044954
1250 Ga0495640_0242237
1251 Ga0495586_0008518
1252 Ga0495586_0176346
1253 Ga0495586_0203553
1254 Ga0495587_0024137
1255 Ga0495587_0058727
1256 Ga0495587_0167599
1257 Ga0495598_0054186
1258 Ga0495598_0132401
1259 Ga0495609_0108116
1260 Ga0495621_0060974
1261 Ga0495621_0074683
1262 Ga0495645_0000344
1263 Ga0495645_0078290
1264 Ga0495667_0018506
1265 Ga0495667_0064884
1266 Ga0495667_0083269
1267 Ga0495667_0118538
1268 Ga0495667_0736911
1269 Ga0495634_0012351
1270 Ga0495634_0022467
1271 Ga0495634_0068049
1272 Ga0495635_0056142
1273 Ga0495635_0182715
1274 Ga0495659_0125174
1275 Ga0495659_0196544
1276 Ga0495588_0060033
1277 Ga0495657_0014522
1278 Ga0495657_0116727
1279 Ga0495657_0159295
1280 Ga0495657_0180204
1281 Ga0495599_0000231
1282 Ga0495599_0022846
1283 Ga0495646_0156587
1284 Ga0495647_0004648
1285 Ga0495647_0310225
1286 Ga0495658_0015526
1287 Ga0495658_0036547
1288 Ga0495658_0519895
1289 Ga0495669_0033260
1290 Ga0495613_0024505
1291 Ga0495613_0031717
1292 Ga0495624_0231645
1293 Ga0495600_0009220
1294 Ga0495600_0036340
1295 Ga0495581_0123335
1296 Ga0495581_0683956
1297 Ga0495604_0011098
1298 Ga0495604_0015663
1299 Ga0495636_0002166
1300 Ga0495674_0080284
1301 Ga0495674_0084033
1302 Ga0495676_0211726
1303 Ga0495680_0032475
1304 Ga0495680_0056542
1305 Ga0495680_0079301
1306 Ga0495680_0101042
1307 Ga0495680_0170505
1308 Ga0495684_0025957
1309 Ga0495684_0096567
1310 Ga0495684_0319093
1311 Ga0495684_0320692
1312 Ga0495684_0700763
1313 Ga0495614_0164452
1314 Ga0501292_119558
1315 Ga0501298_073631
1316 Ga0501033_0030094
1317 Ga0501036_0401188
1318 Ga0501037_0253477
1319 Ga0501037_0480080
1320 Ga0501038_0050494
1321 Ga0501038_0305991
1322 Ga0501039_0078134
1323 Ga0501039_0318257
1324 Ga0501039_0378992
1325 Ga0501039_0762417
1326 Ga0501040_0034358
1327 Ga0501040_0156972
1328 Ga0501040_0402107
1329 Ga0501040_0454069
1330 Ga0501041_0137227
1331 Ga0501041_0285010
1332 Ga0501041_0330409
1333 Ga0501041_0463001
1334 Ga0501042_0035847
1335 Ga0501042_0309100
1336 Ga0501042_0444357
1337 Ga0501043_0812048
1338 Ga0501046_0028053
1339 Ga0501046_0055514
1340 Ga0501046_0541311
1341 Ga0501048_0083168
1342 Ga0501048_0189561
1343 Ga0501048_0662988
1344 Ga0501068_0032306
1345 Ga0501071_0000879
1346 Ga0501071_0071317
1347 Ga0501071_0469648
1348 Ga0501072_0003042
1349 Ga0501072_0076283
1350 Ga0501072_0077852
1351 Ga0501072_0081610
1352 Ga0501072_0126733
1353 Ga0501073_0155271
1354 Ga0501073_0284449
1355 Ga0501074_0211108
1356 Ga0501075_0044465
1357 Ga0501075_0166662
1358 Ga0501075_0181147
1359 Ga0501076_0001168
1360 Ga0501077_0213297
1361 Ga0501235_044322
1362 Ga0501249_034262
1363 Ga0501079_0002730
1364 Ga0501079_0041684
1365 Ga0501079_0358803
1366 Ga0501080_0058100
1367 Ga0501081_0013737
1368 Ga0501273_014629
1369 Ga0501035_0047672
1370 Ga0501035_0432495
1371 Ga0501045_0068835
1372 Ga0501045_0082061
1373 nmdc:mga05p37_109_c1
1374 nmdc:mga05p37_261434_c1
1375 nmdc:mga05p37_358492_c1
1376 nmdc:mga05p37_604246_c1
1377 nmdc:mga05p37_886_c1
1378 nmdc:mga09592_140748_c1
1379 nmdc:mga09592_202854_c1
1380 nmdc:mga09592_2901_c1
1381 nmdc:mga09592_6868_c1
1382 nmdc:mga0qj67_1170396_c1
1383 nmdc:mga0qj67_137754_c1
1384 nmdc:mga0qj67_2700_c1
1385 nmdc:mga0qj67_27222_c1
1386 nmdc:mga0qj67_385230_c1
1387 nmdc:mga0qj67_41917_c1
1388 nmdc:mga0qj67_422082_c1
1389 nmdc:mga0qj67_507182_c1
1390 nmdc:mga0qj67_662400_c1
1391 nmdc:mga0qj67_6924_c1
1392 nmdc:mga06r32_1611305_c1
1393 nmdc:mga06r32_16323_c1
1394 nmdc:mga06r32_173746_c1
1395 nmdc:mga06r32_287585_c1
1396 nmdc:mga06r32_309216_c1
1397 nmdc:mga06r32_383217_c1
1398 nmdc:mga06r32_395194_c1
1399 nmdc:mga08y16_152610_c1
1400 nmdc:mga08y16_189087_c1
1401 nmdc:mga08y16_346845_c1
1402 nmdc:mga08y16_429286_c1
1403 nmdc:mga08y16_90814_c1
1404 nmdc:mga0n895_423934_c1
1405 nmdc:mga0n895_4702_c1
1406 nmdc:mga0n895_677390_c1
1407 nmdc:mga0n895_772692_c1
1408 nmdc:mga0n895_8407_c1
1409 nmdc:mga0n895_86_c1
1410 nmdc:mga0rr50_241822_c1
1411 nmdc:mga0rr50_3195_c1
1412 nmdc:mga0rr50_390926_c1
1413 nmdc:mga0rr50_664_c1
1414 nmdc:mga08x19_11713_c1
1415 nmdc:mga08x19_138253_c1
1416 nmdc:mga08x19_20408_c1
1417 nmdc:mga08x19_4656_c1
1418 nmdc:mga08x19_557910_c1
1419 nmdc:mga08x19_6463_c1
1420 nmdc:mga08x19_70089_c1
1421 nmdc:mga08x19_758067_c1
1422 nmdc:mga0a205_281873_c1
1423 nmdc:mga0a205_31489_c1
1424 nmdc:mga0a205_385096_c1
1425 nmdc:mga0a205_505_c1
1426 Ga0495601_0000862
1427 Ga0495601_0018854
1428 Ga0495601_0029688
1429 Ga0495601_0153551
1430 Ga0495601_0254334
1431 Ga0495595_0008449
1432 Ga0495595_0523631
1433 Ga0495619_0034504
1434 Ga0495619_0108655
1435 Ga0501084_0047735
1436 Ga0501084_0096251
1437 Ga0501084_0544486
1438 Ga0590075_057417
1439 Ga0501082_0237309
1440 Ga0501082_0744156
1441 Ga0530510_0001231
1442 Ga0530510_0215943
1443 Ga0530510_0220211
1444 Ga0530510_1022899

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00866

Ring_hydroxyl_B

Ring hydroxylating beta subunit

46

180

0.97

PF13577

SnoaL_4

SnoaL-like domain

33

172

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
8h2t-assembly1.cif.gz_H cryo-em structure of iadd/e dioxygenase bound with iaa 0.9107 5 147
3e99-assembly1.cif.gz_A crystal structure of the beta subunit of the benzoate 1,2-dioxygenase (benb, bmaa0186) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.8781 7 144
3ef8-assembly1.cif.gz_A crystal structure of putative scytalone dehydratase (yp_496742.1) from novosphingobium aromaticivorans dsm 12444 at 1.50 a resolution 0.8726 5 143
1wql-assembly1.cif.gz_B cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 0.8619 1 154
2chc-assembly1.cif.gz_A structure of rv3472(d26n), a function unknown protein from mycobacterium tuberculosis 0.858 6 143
ID Description Score Start End Superfamily
3e99A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.87 7 144 3.10.450.50
af_Q47140_1_172_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8658 1 147 3.10.450.50
af_P71754_77_184_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8611 80 138 3.10.450.50
3ef8B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8485 3 143 3.10.450.50
2b1xB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8456 5 146 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A537C0D0-F1-model_v4 Aromatic-ring-hydroxylating dioxygenase subunit beta 0.9549 1 132 GO:0019380
GO:0051213
AF-A0A243SX33-F1-model_v4 deleted 0.9521 82 147
AF-A0A536XR34-F1-model_v4 Aromatic-ring-hydroxylating dioxygenase subunit beta 0.9496 2 140 GO:0019380
GO:0051213
AF-A0A537C0D0-F1-model_v4 Aromatic-ring-hydroxylating dioxygenase subunit beta 0.9411 1 132 GO:0019380
GO:0051213
AF-N9SU72-F1-model_v4 deleted 0.939 1 144

Map