F477449

General Info

Members Datasets Scaffolds Average Seq Length
722 221 1444 254

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0013044|Ga0496124_0013044_2092_2988
Length 298
Sequence MRWKLCTIRPLCTADYLNREHGAKPLYTLTQQENMRLGIISALHEEQAGLVEAMEGPAKLIHAKREYWVGQLWEIDAVCVLSRIGKVAAAMTATTLVEKFGVTHILFTGVAGAGDRTIRVGDIVVAESLVQHDMDASPLFPRFEVPLTGQTHFQPDQQLSLRLSGAAHAFLECDFLERISETERQAFGLAQPRVHRGLIASGDQFVNDRQRIDALNAALPGLVAVEMEGAAVAQVCQELDVPFAVIRAVSDNANEDAAHDFMRFVKSVAAQYAFHITRRLCRQLVEAPLQPRSESAGM

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
25 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
31 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
32 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
33 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
36 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
37 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
38 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
39 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
45 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
46 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
71 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
72 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
73 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
74 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
75 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
76 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
77 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
78 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
81 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
82 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
83 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
88 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
89 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
95 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
96 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
97 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
98 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
102 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
110 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
111 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
112 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
113 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
114 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
124 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
125 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
126 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
127 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
130 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
131 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
132 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
135 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
155 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
156 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
157 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
160 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
165 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
184 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
187 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
192 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
193 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
200 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
201 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
202 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
203 2643221556 Massilia sp. Root1485 Isolate Unclassified
204 2643221684 Massilia sp. Root133 Isolate Unclassified
205 2738541297 Duganella sp. GV083 Isolate Unclassified
206 2738541357 Duganella sp. GV053 Isolate Unclassified
207 2738543003 Duganella sp. GV066 Isolate Unclassified
208 2738543026 Duganella sp. GV089 Isolate Unclassified
209 2738543029 Duganella sp. GV039 Isolate Unclassified
210 2821131069 Duganella sp. 1224 Isolate Unclassified
211 2842711865 Duganella sp. R-73148 Isolate Unclassified
212 2855730933 Achromobacter sp. HZ28 Isolate Nodule
213 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
214 2857558681 Duganella sp. R-74565 Isolate Unclassified
215 2857564685 Duganella sp. R-74599 Isolate Unclassified
216 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
217 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
218 2904424332 Duganella sp. 1411 Isolate Rhizosphere
219 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
220 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
221 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 0
Isolates 2.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.6
Nodule 0.14
Rhizoplane 3.32
Rhizosphere 87.12
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0013044 3300048927 Bacteria 8142
2 JGI25154J39366_1000436 3300002738 Bacteria 22196
3 JGI25150J39212_1000518 3300002774 Bacteria 15856
4 JGI25151J46595_10000778 3300003187 Bacteria 25778
5 rootL2_10048618 3300003322 Bacteria 7927
6 rootL2_10048626 3300003322 Bacteria 3463
7 rootL2_10052342 3300003322 Bacteria 2448
8 Ga0055529_1000015 3300003763 Bacteria 366950
9 Ga0055526_1000007 3300003771 Bacteria 321998
10 Ga0070666_10230580 3300005335 Bacteria 1307
11 Ga0070680_100041276 3300005336 Bacteria 3741
12 Ga0070660_100089134 3300005339 Bacteria 2430
13 Ga0070660_100173293 3300005339 Bacteria 1743
14 Ga0070660_100322332 3300005339 Bacteria 1269
15 Ga0070661_100143245 3300005344 Bacteria 1802
16 Ga0070659_100091407 3300005366 Bacteria 2439
17 Ga0070659_100113438 3300005366 Bacteria 2189
18 Ga0070663_100062990 3300005455 Bacteria 2676
19 Ga0070662_100210353 3300005457 Bacteria 1547
20 Ga0068855_100006000 3300005563 Bacteria 14821
21 Ga0068855_100536112 3300005563 Bacteria 1268
22 Ga0070664_100102366 3300005564 Bacteria 2492
23 Ga0070664_100193079 3300005564 Bacteria 1814
24 Ga0068857_100321283 3300005577 Bacteria 1430
25 Ga0068852_100357050 3300005616 Bacteria 1428
26 Ga0070717_10079001 3300006028 Bacteria 2758
27 Ga0075363_100052926 3300006048 Bacteria 2168
28 Ga0075364_10144923 3300006051 Bacteria 1599
29 Ga0075362_10011219 3300006177 Bacteria 3526
30 Ga0097621_100299942 3300006237 Bacteria 1419
31 Ga0105244_10001653 3300009036 Bacteria 17641
32 Ga0105244_10003305 3300009036 Bacteria 11608
33 Ga0105244_10021468 3300009036 Bacteria 3571
34 Ga0105240_10339693 3300009093 Bacteria 1706
35 Ga0105245_10114926 3300009098 Bacteria 2507
36 Ga0105243_10257882 3300009148 Bacteria 1560
37 Ga0105242_10056657 3300009176 Bacteria 3207
38 Ga0105242_10066652 3300009176 Bacteria 2974
39 Ga0105238_10249752 3300009551 Bacteria 1752
40 Ga0105239_10156431 3300010375 Bacteria 2545
41 Ga0157371_10000003 3300013102 Bacteria 543317
42 Ga0157370_10229453 3300013104 Unclassified 1719
43 Ga0157374_10256690 3300013296 Bacteria 1721
44 Ga0157372_10049812 3300013307 Bacteria 4659
45 Ga0182008_10003135 3300014497 Bacteria 10113
46 Ga0182008_10008129 3300014497 Bacteria 5743
47 Ga0157376_10295272 3300014969 Bacteria 1532
48 Ga0182006_1000007 3300015261 Bacteria 452190
49 Ga0182006_1000023 3300015261 Bacteria 275031
50 Ga0182007_10000022 3300015262 Bacteria 189018
51 Ga0182007_10006126 3300015262 Bacteria 5193
52 Ga0182005_1000006 3300015265 Bacteria 515188
53 Ga0182005_1000010 3300015265 Bacteria 434103
54 Ga0163161_10018403 3300017792 Bacteria 4897
55 Ga0163161_10078914 3300017792 Bacteria 2420
56 Ga0213872_10000108 3300021361 Bacteria 76910
57 Ga0213872_10000642 3300021361 Bacteria 26433
58 Ga0213872_10000745 3300021361 Bacteria 24082
59 Ga0213872_10032067 3300021361 Bacteria 2408
60 Ga0209563_100011 3300025230 Bacteria 1187808
61 Ga0209437_102479 3300025233 Bacteria 3554
62 Ga0209437_107340 3300025233 Bacteria 1797
63 Ga0207425_1000257 3300025245 Bacteria 39389
64 Ga0209646_1000042 3300025246 Bacteria 343923
65 Ga0209677_100566 3300025253 Bacteria 20483
66 Ga0209148_1000580 3300025254 Bacteria 33685
67 Ga0209455_1000031 3300025272 Bacteria 519952
68 Ga0209025_1003139 3300025294 Bacteria 16151
69 Ga0209564_1000010 3300025295 Bacteria 885399
70 Ga0209564_1000042 3300025295 Bacteria 392805
71 Ga0209758_1000379 3300025297 Bacteria 77337
72 Ga0207655_1000933 3300025728 Bacteria 30311
73 Ga0207655_1001881 3300025728 Bacteria 18046
74 Ga0207705_10001434 3300025909 Bacteria 19002
75 Ga0207654_10002736 3300025911 Bacteria 8945
76 Ga0207660_10039246 3300025917 Bacteria 3309
77 Ga0207657_10017508 3300025919 Bacteria 6866
78 Ga0207649_10244710 3300025920 Bacteria 1289
79 Ga0207694_10204503 3300025924 Bacteria 1607
80 Ga0207687_10224867 3300025927 Bacteria 1480
81 Ga0207690_10213203 3300025932 Bacteria 1473
82 Ga0207686_10004493 3300025934 Bacteria 7473
83 Ga0207709_10098284 3300025935 Bacteria 1930
84 Ga0207689_10268830 3300025942 Bacteria 1411
85 Ga0207679_10080801 3300025945 Bacteria 2483
86 Ga0207679_10282364 3300025945 Bacteria 1424
87 Ga0207667_10005031 3300025949 Bacteria 16165
88 Ga0207639_10546467 3300026041 Bacteria 1063
89 Ga0207648_10282081 3300026089 Bacteria 1485
90 Ga0207674_10222947 3300026116 Bacteria 1834
91 Ga0207698_10213133 3300026142 Bacteria 1739
92 Ga0316180_1180700 3300030736 Bacteria 9565
93 Ga0316181_1129638 3300030744 Bacteria 937
94 Ga0316181_1199303 3300030744 Bacteria 4470
95 Ga0316182_1271808 3300030745 Bacteria 1145
96 Ga0316182_1358504 3300030745 Bacteria 3305
97 Ga0307414_10011223 3300032004 Bacteria 5244
98 Ga0373939_0059011 3300035114 Bacteria 1215
99 Ga0395899_0000019 3300037312 Bacteria 411777
100 Ga0395899_0003649 3300037312 Bacteria 12188
101 Ga0395899_0005285 3300037312 Bacteria 10023
102 Ga0395899_0007031 3300037312 Bacteria 8706
103 Ga0395899_0010061 3300037312 Bacteria 7251
104 Ga0395899_0147074 3300037312 Bacteria 1672
105 Ga0395899_0158726 3300037312 Bacteria 1599
106 Ga0395900_0001043 3300037418 Bacteria 35555
107 Ga0395900_0001113 3300037418 Bacteria 34100
108 Ga0395900_0001479 3300037418 Bacteria 28032
109 Ga0395900_0024595 3300037418 Bacteria 6165
110 Ga0395900_0146256 3300037418 Bacteria 2416
111 Ga0395900_0162218 3300037418 Bacteria 2279
112 Ga0395900_0221245 3300037418 Bacteria 1908
113 Ga0395898_0006387 3300037466 Bacteria 12593
114 Ga0395898_0167004 3300037466 Bacteria 2104
115 Ga0395898_0174287 3300037466 Bacteria 2056
116 Ga0395898_0670191 3300037466 Bacteria 979
117 Ga0395905_0090520 3300037471 Bacteria 2868
118 Ga0395905_0204391 3300037471 Bacteria 1851
119 Ga0395905_0277630 3300037471 Bacteria 1561
120 Ga0395901_0000278 3300038443 Bacteria 63368
121 Ga0395901_0001341 3300038443 Bacteria 25811
122 Ga0395901_0149846 3300038443 Bacteria 2452
123 Ga0395901_0268521 3300038443 Bacteria 1775
124 Ga0436361_0147055 3300039447 Bacteria 2236
125 Ga0436361_0183975 3300039447 Bacteria 24933
126 Ga0436361_0605709 3300039447 Bacteria 2185
127 Ga0436361_0683298 3300039447 Bacteria 2261
128 Ga0436361_0797816 3300039447 Bacteria 8982
129 Ga0439449_0041316 3300042007 Bacteria 1714
130 Ga0439455_0048889 3300042012 Bacteria 1101
131 Ga0450904_000223 3300042139 Bacteria 12400
132 Ga0466972_0001809 3300044658 Bacteria 10482
133 Ga0466965_0032952 3300044683 Bacteria 2531
134 Ga0466965_0039596 3300044683 Bacteria 2317
135 Ga0466965_0054629 3300044683 Bacteria 1986
136 Ga0466965_0147485 3300044683 Bacteria 1228
137 Ga0466966_0008186 3300044684 Bacteria 6929
138 Ga0466966_0020912 3300044684 Bacteria 4302
139 Ga0466966_0043082 3300044684 Bacteria 2894
140 Ga0466966_0080439 3300044684 Bacteria 2029
141 Ga0466966_0227174 3300044684 Bacteria 1126
142 Ga0466964_0004327 3300044706 Bacteria 5234
143 Ga0466971_0147173 3300044719 Bacteria 1098
144 Ga0466968_0034835 3300044735 Bacteria 2103
145 Ga0466957_0000018 3300044842 Bacteria 64818
146 Ga0466957_0022654 3300044842 Bacteria 3707
147 Ga0466957_0076963 3300044842 Bacteria 2072
148 Ga0466959_0015548 3300045049 Bacteria 5546
149 Ga0466959_0138641 3300045049 Bacteria 1720
150 Ga0466959_0309929 3300045049 Bacteria 1080
151 Ga0466959_0309986 3300045049 Bacteria 1080
152 Ga0466958_0089787 3300045836 Bacteria 1900
153 Ga0466958_0230536 3300045836 Bacteria 1182
154 Ga0466967_0068239 3300045976 Bacteria 3174
155 Ga0495617_000179 3300046452 Bacteria 40095
156 Ga0495617_000662 3300046452 Bacteria 17247
157 Ga0495617_002766 3300046452 Bacteria 6771
158 Ga0495627_000004 3300046453 Bacteria 640612
159 Ga0495627_000583 3300046453 Bacteria 29150
160 Ga0495627_030695 3300046453 Bacteria 1702
161 Ga0495627_047635 3300046453 Bacteria 1299
162 Ga0495603_0155052 3300046455 Bacteria 1329
163 Ga0495590_0000012 3300046457 Bacteria 303377
164 Ga0495590_0000575 3300046457 Bacteria 17399
165 Ga0495590_0001081 3300046457 Bacteria 12001
166 Ga0495590_0005303 3300046457 Bacteria 5115
167 Ga0495591_000494 3300046458 Bacteria 31237
168 Ga0495629_0066104 3300046459 Bacteria 2523
169 Ga0495638_0000047 3300046460 Bacteria 216004
170 Ga0495638_0072855 3300046460 Bacteria 2098
171 Ga0495638_0117144 3300046460 Bacteria 1577
172 Ga0495638_0275933 3300046460 Bacteria 915
173 Ga0495638_0295970 3300046460 Bacteria 874
174 Ga0495653_0000082 3300046463 Bacteria 80285
175 Ga0495653_0011424 3300046463 Bacteria 7257
176 Ga0495653_0023637 3300046463 Bacteria 4961
177 Ga0495653_0026879 3300046463 Bacteria 4610
178 Ga0495653_0242422 3300046463 Bacteria 1200
179 Ga0495650_0000077 3300046471 Bacteria 245511
180 Ga0495650_0000265 3300046471 Bacteria 100744
181 Ga0495650_0000826 3300046471 Bacteria 37460
182 Ga0495650_0000899 3300046471 Bacteria 35060
183 Ga0495650_0000931 3300046471 Bacteria 33966
184 Ga0495650_0003104 3300046471 Bacteria 12462
185 Ga0495650_0028330 3300046471 Bacteria 2574
186 Ga0495650_0035428 3300046471 Bacteria 2197
187 Ga0495650_0039162 3300046471 Bacteria 2047
188 Ga0495580_0007047 3300046472 Bacteria 9062
189 Ga0495582_0013573 3300046473 Bacteria 4485
190 Ga0495582_0029173 3300046473 Bacteria 3028
191 Ga0495582_0300031 3300046473 Bacteria 923
192 Ga0495605_0000399 3300046474 Bacteria 39905
193 Ga0495605_0000400 3300046474 Bacteria 39776
194 Ga0495605_0003060 3300046474 Bacteria 10095
195 Ga0495605_0005857 3300046474 Bacteria 7103
196 Ga0495605_0008291 3300046474 Bacteria 5878
197 Ga0495605_0015580 3300046474 Bacteria 4130
198 Ga0495584_0000004 3300046491 Bacteria 314714
199 Ga0495584_0000760 3300046491 Bacteria 21323
200 Ga0495584_0001006 3300046491 Bacteria 17636
201 Ga0495584_0002503 3300046491 Bacteria 10416
202 Ga0495584_0007301 3300046491 Bacteria 5763
203 Ga0495584_0008592 3300046491 Bacteria 5288
204 Ga0495584_0009364 3300046491 Bacteria 5045
205 Ga0495584_0025129 3300046491 Bacteria 3019
206 Ga0495584_0038063 3300046491 Bacteria 2431
207 Ga0495585_0000050 3300046492 Bacteria 119283
208 Ga0495585_0000053 3300046492 Bacteria 115559
209 Ga0495585_0000420 3300046492 Bacteria 40892
210 Ga0495585_0001104 3300046492 Bacteria 22218
211 Ga0495585_0001162 3300046492 Bacteria 21412
212 Ga0495585_0002628 3300046492 Bacteria 12649
213 Ga0495585_0003115 3300046492 Bacteria 11381
214 Ga0495585_0005092 3300046492 Bacteria 8366
215 Ga0495585_0007144 3300046492 Bacteria 6857
216 Ga0495585_0027664 3300046492 Bacteria 3235
217 Ga0495585_0057585 3300046492 Bacteria 2144
218 Ga0495585_0074491 3300046492 Bacteria 1847
219 Ga0495585_0079595 3300046492 Bacteria 1777
220 Ga0495594_0000634 3300046499 Bacteria 18079
221 Ga0495594_0000954 3300046499 Bacteria 15021
222 Ga0495594_0003009 3300046499 Bacteria 8732
223 Ga0495594_0008961 3300046499 Bacteria 5161
224 Ga0495594_0071670 3300046499 Bacteria 1927
225 Ga0495594_0085854 3300046499 Bacteria 1760
226 Ga0495594_0151767 3300046499 Bacteria 1315
227 Ga0495596_0000606 3300046500 Bacteria 22493
228 Ga0495596_0001244 3300046500 Bacteria 14824
229 Ga0495596_0005196 3300046500 Bacteria 6191
230 Ga0495596_0006666 3300046500 Bacteria 5287
231 Ga0495596_0021585 3300046500 Bacteria 2627
232 Ga0495596_0021836 3300046500 Bacteria 2608
233 Ga0495596_0023113 3300046500 Bacteria 2524
234 Ga0495596_0037308 3300046500 Bacteria 1922
235 Ga0495596_0043444 3300046500 Bacteria 1771
236 Ga0495596_0052325 3300046500 Bacteria 1598
237 Ga0495596_0058954 3300046500 Bacteria 1496
238 Ga0495607_0000638 3300046501 Bacteria 34024
239 Ga0495607_0001742 3300046501 Bacteria 18631
240 Ga0495607_0002137 3300046501 Bacteria 16493
241 Ga0495607_0004083 3300046501 Bacteria 10914
242 Ga0495607_0005155 3300046501 Bacteria 9430
243 Ga0495607_0005235 3300046501 Bacteria 9334
244 Ga0495607_0011197 3300046501 Bacteria 5987
245 Ga0495607_0020767 3300046501 Bacteria 4143
246 Ga0495607_0039222 3300046501 Bacteria 2830
247 Ga0495607_0049634 3300046501 Bacteria 2445
248 Ga0495607_0133300 3300046501 Bacteria 1290
249 Ga0495607_0156896 3300046501 Bacteria 1160
250 Ga0495607_0179288 3300046501 Bacteria 1063
251 Ga0495583_0000092 3300046506 Bacteria 158865
252 Ga0495583_0000862 3300046506 Bacteria 36867
253 Ga0495583_0000926 3300046506 Bacteria 34454
254 Ga0495583_0001605 3300046506 Bacteria 22200
255 Ga0495583_0006011 3300046506 Bacteria 8041
256 Ga0495583_0009905 3300046506 Bacteria 5637
257 Ga0495583_0011528 3300046506 Bacteria 5070
258 Ga0495583_0012394 3300046506 Bacteria 4828
259 Ga0495583_0048388 3300046506 Bacteria 1951
260 Ga0495583_0081388 3300046506 Bacteria 1406
261 Ga0495583_0159846 3300046506 Bacteria 930
262 Ga0495606_0000101 3300046507 Bacteria 146752
263 Ga0495606_0000201 3300046507 Bacteria 103926
264 Ga0495606_0000409 3300046507 Bacteria 72543
265 Ga0495606_0000623 3300046507 Bacteria 55841
266 Ga0495606_0001015 3300046507 Bacteria 40726
267 Ga0495606_0001399 3300046507 Bacteria 32508
268 Ga0495606_0007028 3300046507 Bacteria 10207
269 Ga0495606_0013533 3300046507 Bacteria 6435
270 Ga0495606_0014004 3300046507 Bacteria 6288
271 Ga0495606_0015466 3300046507 Bacteria 5877
272 Ga0495606_0024874 3300046507 Bacteria 4302
273 Ga0495606_0183653 3300046507 Bacteria 1204
274 Ga0495606_0224118 3300046507 Bacteria 1057
275 Ga0495610_0000293 3300046512 Bacteria 52547
276 Ga0495610_0000381 3300046512 Bacteria 45780
277 Ga0495610_0000400 3300046512 Bacteria 45021
278 Ga0495610_0005911 3300046512 Bacteria 8572
279 Ga0495610_0006591 3300046512 Bacteria 7935
280 Ga0495610_0034204 3300046512 Bacteria 2619
281 Ga0495610_0064705 3300046512 Bacteria 1727
282 Ga0495610_0076766 3300046512 Bacteria 1544
283 Ga0495616_0000313 3300046513 Bacteria 38775
284 Ga0495616_0000776 3300046513 Bacteria 23333
285 Ga0495616_0002505 3300046513 Bacteria 12145
286 Ga0495616_0003745 3300046513 Bacteria 9701
287 Ga0495616_0007297 3300046513 Bacteria 6617
288 Ga0495616_0008618 3300046513 Bacteria 6022
289 Ga0495616_0017522 3300046513 Bacteria 3950
290 Ga0495616_0018666 3300046513 Bacteria 3801
291 Ga0495616_0020062 3300046513 Bacteria 3641
292 Ga0495616_0032208 3300046513 Bacteria 2741
293 Ga0495616_0053589 3300046513 Bacteria 2004
294 Ga0495616_0065148 3300046513 Bacteria 1776
295 Ga0495620_0085240 3300046515 Bacteria 1273
296 Ga0495630_0352880 3300046517 Bacteria 1126
297 Ga0495631_0000402 3300046518 Bacteria 29972
298 Ga0495631_0001253 3300046518 Bacteria 15697
299 Ga0495631_0007541 3300046518 Bacteria 5531
300 Ga0495631_0013364 3300046518 Bacteria 3986
301 Ga0495631_0013543 3300046518 Bacteria 3957
302 Ga0495631_0016262 3300046518 Bacteria 3552
303 Ga0495631_0024044 3300046518 Bacteria 2818
304 Ga0495631_0027321 3300046518 Bacteria 2612
305 Ga0495631_0037263 3300046518 Bacteria 2167
306 Ga0495631_0078769 3300046518 Bacteria 1422
307 Ga0495631_0091509 3300046518 Bacteria 1309
308 Ga0495632_0000447 3300046519 Bacteria 39298
309 Ga0495632_0000523 3300046519 Bacteria 36220
310 Ga0495632_0000632 3300046519 Bacteria 32427
311 Ga0495632_0001828 3300046519 Bacteria 17138
312 Ga0495632_0041744 3300046519 Bacteria 2303
313 Ga0495632_0074838 3300046519 Bacteria 1621
314 Ga0495632_0094360 3300046519 Bacteria 1415
315 Ga0495637_0000003 3300046520 Bacteria 623293
316 Ga0495637_0000263 3300046520 Bacteria 41706
317 Ga0495637_0000620 3300046520 Bacteria 25083
318 Ga0495643_0000234 3300046522 Bacteria 84022
319 Ga0495643_0000235 3300046522 Bacteria 83550
320 Ga0495643_0000388 3300046522 Bacteria 58226
321 Ga0495643_0001408 3300046522 Bacteria 22304
322 Ga0495643_0003651 3300046522 Bacteria 11171
323 Ga0495643_0013811 3300046522 Bacteria 4819
324 Ga0495643_0020015 3300046522 Bacteria 3865
325 Ga0495643_0043408 3300046522 Bacteria 2447
326 Ga0495643_0050841 3300046522 Bacteria 2231
327 Ga0495644_0014074 3300046523 Bacteria 3065
328 Ga0495644_0023963 3300046523 Bacteria 2322
329 Ga0495644_0037640 3300046523 Bacteria 1825
330 Ga0495644_0039463 3300046523 Bacteria 1780
331 Ga0495644_0066031 3300046523 Bacteria 1359
332 Ga0495644_0106723 3300046523 Bacteria 1061
333 Ga0495648_0000019 3300046524 Bacteria 276407
334 Ga0495648_0000451 3300046524 Bacteria 44465
335 Ga0495648_0000716 3300046524 Bacteria 35380
336 Ga0495648_0005778 3300046524 Bacteria 10205
337 Ga0495648_0005848 3300046524 Bacteria 10125
338 Ga0495648_0007461 3300046524 Bacteria 8745
339 Ga0495648_0019862 3300046524 Bacteria 4704
340 Ga0495648_0021156 3300046524 Bacteria 4513
341 Ga0495648_0037586 3300046524 Bacteria 3109
342 Ga0495648_0044982 3300046524 Bacteria 2750
343 Ga0495648_0111242 3300046524 Bacteria 1490
344 Ga0495648_0258534 3300046524 Bacteria 837
345 Ga0495663_0009455 3300046525 Bacteria 2704
346 Ga0495666_0017788 3300046526 Bacteria 3539
347 Ga0495666_0114171 3300046526 Bacteria 1267
348 Ga0495642_0000197 3300046528 Bacteria 35507
349 Ga0495642_0000454 3300046528 Bacteria 21585
350 Ga0495642_0000636 3300046528 Bacteria 17569
351 Ga0495642_0001145 3300046528 Bacteria 12187
352 Ga0495642_0003250 3300046528 Bacteria 6436
353 Ga0495642_0004143 3300046528 Bacteria 5656
354 Ga0495642_0004192 3300046528 Bacteria 5614
355 Ga0495642_0007195 3300046528 Bacteria 4272
356 Ga0495642_0015655 3300046528 Bacteria 2951
357 Ga0495642_0025496 3300046528 Bacteria 2344
358 Ga0495642_0032439 3300046528 Bacteria 2095
359 Ga0495642_0036593 3300046528 Bacteria 1984
360 Ga0495642_0084986 3300046528 Bacteria 1335
361 Ga0495642_0142331 3300046528 Bacteria 1035
362 Ga0495652_0018190 3300046529 Bacteria 6271
363 Ga0495654_0000022 3300046530 Bacteria 260104
364 Ga0495654_0005038 3300046530 Bacteria 7742
365 Ga0495654_0007858 3300046530 Bacteria 5931
366 Ga0495654_0019479 3300046530 Bacteria 3549
367 Ga0495654_0070615 3300046530 Bacteria 1655
368 Ga0495654_0118607 3300046530 Bacteria 1200
369 Ga0495665_0005293 3300046531 Bacteria 6954
370 Ga0495586_0007219 3300046535 Bacteria 5926
371 Ga0495586_0009979 3300046535 Bacteria 5059
372 Ga0495586_0298604 3300046535 Bacteria 923
373 Ga0495587_0028124 3300046536 Bacteria 3421
374 Ga0495587_0032239 3300046536 Bacteria 3168
375 Ga0495587_0139262 3300046536 Bacteria 1385
376 Ga0495609_0000117 3300046538 Bacteria 92147
377 Ga0495609_0000638 3300046538 Bacteria 27258
378 Ga0495609_0000741 3300046538 Bacteria 24793
379 Ga0495609_0007027 3300046538 Bacteria 5670
380 Ga0495609_0007753 3300046538 Bacteria 5320
381 Ga0495609_0022220 3300046538 Bacteria 2923
382 Ga0495609_0059981 3300046538 Bacteria 1682
383 Ga0495609_0068345 3300046538 Bacteria 1563
384 Ga0495609_0073213 3300046538 Bacteria 1503
385 Ga0495609_0083760 3300046538 Bacteria 1392
386 Ga0495609_0127829 3300046538 Bacteria 1090
387 Ga0495597_0000075 3300046542 Bacteria 86570
388 Ga0495597_0000247 3300046542 Bacteria 49379
389 Ga0495597_0000500 3300046542 Bacteria 32676
390 Ga0495597_0000681 3300046542 Bacteria 27483
391 Ga0495597_0000886 3300046542 Bacteria 23294
392 Ga0495597_0017518 3300046542 Bacteria 3369
393 Ga0495597_0018852 3300046542 Bacteria 3234
394 Ga0495597_0042178 3300046542 Bacteria 2035
395 Ga0495597_0051957 3300046542 Bacteria 1805
396 Ga0495645_0338219 3300046543 Bacteria 973
397 Ga0495622_0000019 3300046557 Bacteria 169931
398 Ga0495622_0000037 3300046557 Bacteria 119690
399 Ga0495622_0025372 3300046557 Bacteria 2769
400 Ga0495622_0059210 3300046557 Bacteria 1773
401 Ga0495622_0063105 3300046557 Bacteria 1714
402 Ga0495633_0000221 3300046558 Bacteria 70459
403 Ga0495633_0000489 3300046558 Bacteria 39984
404 Ga0495633_0001948 3300046558 Bacteria 14997
405 Ga0495633_0001978 3300046558 Bacteria 14838
406 Ga0495633_0004764 3300046558 Bacteria 8512
407 Ga0495633_0005394 3300046558 Bacteria 7834
408 Ga0495633_0007241 3300046558 Bacteria 6420
409 Ga0495633_0008933 3300046558 Bacteria 5584
410 Ga0495633_0025142 3300046558 Bacteria 2934
411 Ga0495633_0044824 3300046558 Bacteria 2095
412 Ga0495633_0081829 3300046558 Bacteria 1502
413 Ga0495633_0111366 3300046558 Bacteria 1269
414 Ga0495633_0116165 3300046558 Bacteria 1240
415 Ga0495633_0158826 3300046558 Bacteria 1043
416 Ga0495656_0074407 3300046615 Bacteria 1517
417 Ga0495656_0121505 3300046615 Bacteria 1233
418 Ga0495656_0254930 3300046615 Bacteria 887
419 Ga0495668_0000398 3300046616 Bacteria 57103
420 Ga0495668_0000496 3300046616 Bacteria 49112
421 Ga0495668_0000961 3300046616 Bacteria 32029
422 Ga0495668_0001559 3300046616 Bacteria 21734
423 Ga0495668_0001745 3300046616 Bacteria 19948
424 Ga0495668_0001864 3300046616 Bacteria 18920
425 Ga0495668_0003424 3300046616 Bacteria 11903
426 Ga0495668_0004995 3300046616 Bacteria 9165
427 Ga0495668_0005718 3300046616 Bacteria 8316
428 Ga0495668_0013940 3300046616 Bacteria 4726
429 Ga0495668_0015465 3300046616 Bacteria 4455
430 Ga0495668_0018929 3300046616 Bacteria 3977
431 Ga0495668_0020341 3300046616 Bacteria 3818
432 Ga0495668_0021966 3300046616 Bacteria 3651
433 Ga0495668_0037418 3300046616 Bacteria 2714
434 Ga0495668_0080336 3300046616 Bacteria 1789
435 Ga0495668_0090106 3300046616 Bacteria 1680
436 Ga0495634_0027322 3300046642 Bacteria 3971
437 Ga0495634_0196341 3300046642 Bacteria 1256
438 Ga0495611_0001262 3300046648 Bacteria 13030
439 Ga0495611_0001740 3300046648 Bacteria 10536
440 Ga0495611_0002290 3300046648 Bacteria 8865
441 Ga0495611_0003996 3300046648 Bacteria 6420
442 Ga0495611_0013464 3300046648 Bacteria 3483
443 Ga0495611_0018188 3300046648 Bacteria 3011
444 Ga0495611_0076766 3300046648 Bacteria 1531
445 Ga0495611_0092767 3300046648 Bacteria 1396
446 Ga0495625_0000432 3300046660 Bacteria 63013
447 Ga0495625_0010083 3300046660 Bacteria 7852
448 Ga0495625_0012643 3300046660 Bacteria 6832
449 Ga0495625_0025283 3300046660 Bacteria 4505
450 Ga0495625_0134648 3300046660 Bacteria 1671
451 Ga0495635_0035039 3300046663 Bacteria 3480
452 Ga0495635_0400615 3300046663 Bacteria 912
453 Ga0495659_0143940 3300046664 Bacteria 953
454 Ga0495661_0000650 3300046665 Bacteria 35187
455 Ga0495661_0001359 3300046665 Bacteria 20668
456 Ga0495661_0001854 3300046665 Bacteria 16896
457 Ga0495661_0003398 3300046665 Bacteria 11769
458 Ga0495661_0007453 3300046665 Bacteria 7632
459 Ga0495661_0011354 3300046665 Bacteria 6045
460 Ga0495661_0011453 3300046665 Bacteria 6018
461 Ga0495661_0023785 3300046665 Bacteria 3972
462 Ga0495661_0029698 3300046665 Bacteria 3487
463 Ga0495661_0048858 3300046665 Bacteria 2569
464 Ga0495661_0073224 3300046665 Bacteria 1997
465 Ga0495661_0145374 3300046665 Bacteria 1285
466 Ga0495661_0199216 3300046665 Bacteria 1049
467 Ga0495588_0000094 3300046674 Bacteria 176169
468 Ga0495588_0006574 3300046674 Bacteria 5245
469 Ga0495588_0007338 3300046674 Bacteria 5011
470 Ga0495588_0007619 3300046674 Bacteria 4940
471 Ga0495588_0025571 3300046674 Bacteria 2942
472 Ga0495588_0082365 3300046674 Bacteria 1680
473 Ga0495588_0105363 3300046674 Bacteria 1483
474 Ga0495588_0135351 3300046674 Bacteria 1300
475 Ga0495588_0199970 3300046674 Bacteria 1055
476 Ga0495669_0000015 3300046684 Bacteria 140309
477 Ga0495669_0003046 3300046684 Bacteria 6891
478 Ga0495669_0008762 3300046684 Bacteria 4259
479 Ga0495669_0045641 3300046684 Bacteria 1954
480 Ga0495669_0074051 3300046684 Bacteria 1556
481 Ga0495624_0017844 3300046690 Bacteria 4755
482 Ga0495624_0059389 3300046690 Bacteria 2400
483 Ga0495624_0141814 3300046690 Bacteria 1472
484 Ga0495670_0000278 3300046691 Bacteria 24090
485 Ga0495670_0000315 3300046691 Bacteria 22991
486 Ga0495670_0002848 3300046691 Bacteria 8553
487 Ga0495670_0036650 3300046691 Bacteria 2443
488 Ga0495670_0038367 3300046691 Bacteria 2388
489 Ga0495670_0038790 3300046691 Bacteria 2375
490 Ga0495670_0081675 3300046691 Bacteria 1647
491 Ga0495670_0143618 3300046691 Bacteria 1249
492 Ga0495670_0190905 3300046691 Bacteria 1083
493 Ga0495670_0378808 3300046691 Bacteria 763
494 Ga0495671_0000301 3300046692 Bacteria 41678
495 Ga0495671_0001957 3300046692 Bacteria 13212
496 Ga0495671_0011330 3300046692 Bacteria 4914
497 Ga0495671_0022280 3300046692 Bacteria 3321
498 Ga0495671_0077262 3300046692 Bacteria 1632
499 Ga0495671_0091360 3300046692 Bacteria 1490
500 Ga0495671_0172281 3300046692 Bacteria 1052
501 Ga0495649_0000268 3300046694 Bacteria 46424
502 Ga0495649_0001458 3300046694 Bacteria 17803
503 Ga0495649_0016287 3300046694 Bacteria 4214
504 Ga0495649_0016588 3300046694 Bacteria 4172
505 Ga0495649_0027637 3300046694 Bacteria 3147
506 Ga0495649_0200831 3300046694 Bacteria 1035
507 Ga0495589_0000096 3300046794 Bacteria 84521
508 Ga0495589_0000351 3300046794 Bacteria 35944
509 Ga0495589_0000626 3300046794 Bacteria 23278
510 Ga0495589_0007724 3300046794 Bacteria 5627
511 Ga0495589_0028640 3300046794 Bacteria 2810
512 Ga0495589_0032591 3300046794 Bacteria 2619
513 Ga0495589_0109227 3300046794 Bacteria 1335
514 Ga0495589_0120688 3300046794 Bacteria 1262
515 Ga0495589_0162513 3300046794 Bacteria 1063
516 Ga0495600_0033257 3300046809 Bacteria 3347
517 Ga0495600_0043681 3300046809 Bacteria 2923
518 Ga0495660_0000497 3300046810 Bacteria 32487
519 Ga0495660_0000526 3300046810 Bacteria 31313
520 Ga0495660_0000661 3300046810 Bacteria 26723
521 Ga0495660_0003743 3300046810 Bacteria 9339
522 Ga0495660_0005475 3300046810 Bacteria 7605
523 Ga0495660_0008077 3300046810 Bacteria 6182
524 Ga0495660_0016406 3300046810 Bacteria 4271
525 Ga0495660_0027981 3300046810 Bacteria 3187
526 Ga0495660_0036766 3300046810 Bacteria 2729
527 Ga0495660_0042789 3300046810 Bacteria 2501
528 Ga0495660_0092536 3300046810 Bacteria 1569
529 Ga0495660_0188626 3300046810 Bacteria 992
530 Ga0495660_0219373 3300046810 Bacteria 897
531 Ga0495581_0016403 3300047315 Bacteria 4307
532 Ga0495581_0056896 3300047315 Bacteria 2257
533 Ga0495581_0119670 3300047315 Bacteria 1532
534 Ga0495581_0167880 3300047315 Bacteria 1283
535 Ga0495604_0011774 3300047317 Bacteria 6954
536 Ga0495604_0027368 3300047317 Bacteria 4535
537 Ga0495636_0006337 3300047318 Bacteria 4648
538 Ga0495636_0097376 3300047318 Bacteria 1283
539 Ga0495674_0019553 3300047319 Bacteria 6284
540 Ga0495672_0000019 3300047320 Bacteria 448153
541 Ga0495672_0000391 3300047320 Bacteria 53759
542 Ga0495672_0000565 3300047320 Bacteria 41841
543 Ga0495672_0000614 3300047320 Bacteria 39876
544 Ga0495672_0001197 3300047320 Bacteria 26222
545 Ga0495672_0001908 3300047320 Bacteria 19799
546 Ga0495672_0007590 3300047320 Bacteria 8140
547 Ga0495672_0076198 3300047320 Bacteria 1884
548 Ga0495672_0160040 3300047320 Bacteria 1158
549 Ga0495676_0000281 3300047321 Bacteria 41181
550 Ga0495676_0023451 3300047321 Bacteria 5358
551 Ga0495676_0028585 3300047321 Bacteria 4758
552 Ga0495676_0103035 3300047321 Bacteria 2108
553 Ga0495676_0236658 3300047321 Bacteria 1252
554 Ga0495676_0269740 3300047321 Bacteria 1155
555 Ga0495680_0016559 3300047322 Bacteria 6329
556 Ga0495680_0261754 3300047322 Bacteria 1223
557 Ga0495683_0000470 3300047323 Bacteria 31364
558 Ga0495683_0000528 3300047323 Bacteria 28943
559 Ga0495683_0014871 3300047323 Bacteria 4052
560 Ga0495683_0025230 3300047323 Bacteria 3048
561 Ga0495683_0039714 3300047323 Bacteria 2378
562 Ga0495683_0052613 3300047323 Bacteria 2032
563 Ga0495683_0085094 3300047323 Bacteria 1538
564 Ga0495683_0088310 3300047323 Bacteria 1505
565 Ga0495687_000110 3300047443 Bacteria 125363
566 Ga0495687_000117 3300047443 Bacteria 122591
567 Ga0495687_000203 3300047443 Bacteria 84774
568 Ga0495687_000772 3300047443 Bacteria 34667
569 Ga0495687_001912 3300047443 Bacteria 17877
570 Ga0495687_003627 3300047443 Bacteria 11032
571 Ga0495687_051835 3300047443 Bacteria 1738
572 Ga0495675_0015626 3300047444 Bacteria 4798
573 Ga0495675_0047227 3300047444 Bacteria 2739
574 Ga0495675_0126241 3300047444 Bacteria 1592
575 Ga0495677_0000036 3300047445 Bacteria 81332
576 Ga0495677_0003242 3300047445 Bacteria 6345
577 Ga0495677_0003655 3300047445 Bacteria 5954
578 Ga0495677_0014072 3300047445 Bacteria 2914
579 Ga0495677_0016807 3300047445 Bacteria 2653
580 Ga0495677_0016971 3300047445 Bacteria 2640
581 Ga0495677_0020215 3300047445 Bacteria 2414
582 Ga0495677_0027169 3300047445 Bacteria 2076
583 Ga0495677_0033173 3300047445 Bacteria 1881
584 Ga0495677_0049503 3300047445 Bacteria 1544
585 Ga0495677_0078260 3300047445 Bacteria 1237
586 Ga0495677_0082622 3300047445 Bacteria 1205
587 Ga0495677_0104067 3300047445 Bacteria 1076
588 Ga0495677_0138429 3300047445 Bacteria 934
589 Ga0495679_002549 3300047446 Bacteria 9194
590 Ga0495679_004140 3300047446 Bacteria 6774
591 Ga0495679_006398 3300047446 Bacteria 5078
592 Ga0495679_006550 3300047446 Bacteria 4985
593 Ga0495685_006558 3300047447 Bacteria 3817
594 Ga0495685_007962 3300047447 Bacteria 3509
595 Ga0495685_010349 3300047447 Bacteria 3126
596 Ga0495673_0000008 3300047469 Bacteria 752462
597 Ga0495673_0025777 3300047469 Bacteria 2818
598 Ga0495673_0067756 3300047469 Bacteria 1510
599 Ga0495681_0000429 3300047470 Bacteria 32218
600 Ga0495681_0001239 3300047470 Bacteria 19392
601 Ga0495681_0001376 3300047470 Bacteria 18374
602 Ga0495681_0003161 3300047470 Bacteria 11529
603 Ga0495681_0004591 3300047470 Bacteria 9399
604 Ga0495681_0005059 3300047470 Bacteria 8889
605 Ga0495681_0040063 3300047470 Bacteria 2283
606 Ga0495681_0058999 3300047470 Bacteria 1776
607 Ga0495681_0104484 3300047470 Bacteria 1234
608 Ga0495681_0155482 3300047470 Bacteria 956
609 Ga0495686_0000148 3300047472 Bacteria 137236
610 Ga0495686_0000211 3300047472 Bacteria 107517
611 Ga0495686_0005565 3300047472 Bacteria 9907
612 Ga0495686_0009158 3300047472 Bacteria 7167
613 Ga0495686_0129622 3300047472 Bacteria 1496
614 Ga0495593_0002163 3300047673 Bacteria 11750
615 Ga0495593_0063507 3300047673 Bacteria 1928
616 Ga0495602_0012422 3300048088 Bacteria 8755
617 Ga0495602_0212932 3300048088 Bacteria 1465
618 Ga0495614_0000755 3300048089 Bacteria 13717
619 Ga0495614_0005799 3300048089 Bacteria 5563
620 Ga0495626_0000248 3300048091 Bacteria 62661
621 Ga0495626_0000922 3300048091 Bacteria 25785
622 Ga0495626_0001905 3300048091 Bacteria 15559
623 Ga0495626_0007451 3300048091 Bacteria 6090
624 Ga0495626_0008067 3300048091 Bacteria 5810
625 Ga0495626_0009726 3300048091 Bacteria 5181
626 Ga0495626_0021489 3300048091 Bacteria 3202
627 Ga0495626_0023926 3300048091 Bacteria 3000
628 Ga0495626_0028676 3300048091 Bacteria 2696
629 Ga0495626_0029886 3300048091 Bacteria 2631
630 Ga0495626_0053381 3300048091 Bacteria 1860
631 Ga0496102_0000024 3300048905 Bacteria 227873
632 Ga0496102_0000854 3300048905 Bacteria 29260
633 Ga0496102_0018168 3300048905 Bacteria 6172
634 Ga0496102_0056042 3300048905 Bacteria 3595
635 Ga0496102_0106390 3300048905 Bacteria 2611
636 Ga0496102_0149687 3300048905 Bacteria 2192
637 Ga0496102_0600648 3300048905 Bacteria 1023
638 Ga0496102_0659047 3300048905 Bacteria 970
639 Ga0496103_0003836 3300048906 Bacteria 9147
640 Ga0496103_0014927 3300048906 Bacteria 4617
641 Ga0496103_0044825 3300048906 Bacteria 2726
642 Ga0496105_0142054 3300048908 Bacteria 1976
643 Ga0496106_0004558 3300048909 Bacteria 10269
644 Ga0496106_0158512 3300048909 Bacteria 1789
645 Ga0496107_0049727 3300048910 Bacteria 3022
646 Ga0496107_0081381 3300048910 Bacteria 2362
647 Ga0496109_0690802 3300048912 Bacteria 958
648 Ga0496110_0000432 3300048913 Bacteria 28461
649 Ga0496110_0033262 3300048913 Bacteria 4458
650 Ga0496111_0014268 3300048914 Bacteria 5423
651 Ga0496113_0023614 3300048916 Bacteria 4361
652 Ga0496115_0004918 3300048918 Bacteria 9704
653 Ga0496115_0486968 3300048918 Bacteria 992
654 Ga0496116_0034826 3300048919 Bacteria 3545
655 Ga0496117_0000005 3300048920 Bacteria 777468
656 Ga0496118_0000022 3300048921 Bacteria 438602
657 Ga0496120_0053151 3300048923 Bacteria 2303
658 Ga0496121_0026329 3300048924 Bacteria 5483
659 Ga0496121_0070962 3300048924 Bacteria 2803
660 Ga0496122_0027724 3300048925 Bacteria 4833
661 Ga0496122_0073737 3300048925 Bacteria 2418
662 Ga0496122_0099944 3300048925 Bacteria 1943
663 Ga0496122_0100825 3300048925 Bacteria 1931
664 Ga0496123_0000904 3300048926 Bacteria 46774
665 Ga0496123_0002872 3300048926 Bacteria 20237
666 Ga0496123_0004448 3300048926 Bacteria 14734
667 Ga0496123_0039836 3300048926 Bacteria 3281
668 Ga0496124_0008198 3300048927 Bacteria 10961
669 Ga0496124_0131052 3300048927 Bacteria 1992
670 Ga0496124_0140038 3300048927 Bacteria 1910
671 Ga0496124_0176232 3300048927 Bacteria 1650
672 Ga0496124_0182901 3300048927 Bacteria 1611
673 Ga0496124_0190692 3300048927 Bacteria 1569
674 Ga0496124_0272158 3300048927 Bacteria 1239
675 Ga0496125_0003465 3300048928 Bacteria 19100
676 Ga0496125_0040215 3300048928 Bacteria 4013
677 Ga0495678_000012 3300049459 Bacteria 333905
678 Ga0495678_000130 3300049459 Bacteria 88909
679 Ga0495678_000136 3300049459 Bacteria 87649
680 Ga0495678_000227 3300049459 Bacteria 64986
681 Ga0495678_000931 3300049459 Bacteria 25533
682 Ga0495678_001791 3300049459 Bacteria 15870
683 Ga0495678_003369 3300049459 Bacteria 9944
684 Ga0495678_003639 3300049459 Bacteria 9367
685 Ga0495678_006824 3300049459 Bacteria 6005
686 Ga0495678_034471 3300049459 Bacteria 2082
687 Ga0495682_0000286 3300049460 Bacteria 39332
688 Ga0495682_0001484 3300049460 Bacteria 12516
689 Ga0495682_0001646 3300049460 Bacteria 11507
690 Ga0495682_0013703 3300049460 Bacteria 3082
691 Ga0495682_0032808 3300049460 Bacteria 1918
692 Ga0501034_0000225 3300049571 Bacteria 107163
693 Ga0501269_000593 3300049766 Bacteria 6563
694 Ga0501035_0015389 3300049822 Bacteria 7057
695 nmdc:mga03683_34456_c1 3300050489 Bacteria 2049
696 nmdc:mga03n38_98369_c1 3300050490 Bacteria 1407
697 nmdc:mga00v17_251552_c1 3300050491 Bacteria 1146
698 nmdc:mga00v17_73838_c1 3300050491 Bacteria 2119
699 Ga0500594_0067466 3300053118 Bacteria 1045
700 Ga0500618_002489 3300053125 Bacteria 6905
701 Ga0500586_000653 3300053145 Bacteria 7072
702 Ga0500586_014724 3300053145 Bacteria 2334
703 2601671451 2600255292 Bacteria 6300551
704 2643801887 2643221556 Bacteria 7251154
705 2644474319 2643221684 Bacteria 7145183
706 2738826378 2738541297 Bacteria 6549566
707 2739150175 2738541357 Bacteria 6549408
708 2739192094 2738543003 Bacteria 6549560
709 2739318571 2738543026 Bacteria 6549408
710 2739336812 2738543029 Bacteria 6549249
711 2821134830 2821131069 Bacteria 6108407
712 2842716960 2842711865 Bacteria 7155354
713 2855733187 2855730933 Bacteria 7047938
714 2857548712 2857547612 Bacteria 6179999
715 2857558933 2857558681 Bacteria 6617694
716 2857567577 2857564685 Bacteria 6290584
717 2881416001 2881412998 Bacteria 6492157
718 2885082163 2885080285 Bacteria 6355622
719 2904428181 2904424332 Bacteria 7633521
720 2932415965 2932410948 Bacteria 6312192
721 2932422022 2932416698 Bacteria 6315112
722 8047674481 8047673197 Bacteria 7395230
723 Ga0496124_0013044
724 JGI25154J39366_1000436
725 JGI25150J39212_1000518
726 JGI25151J46595_10000778
727 rootL2_10048618
728 rootL2_10048626
729 rootL2_10052342
730 Ga0055529_1000015
731 Ga0055526_1000007
732 Ga0070666_10230580
733 Ga0070680_100041276
734 Ga0070660_100089134
735 Ga0070660_100173293
736 Ga0070660_100322332
737 Ga0070661_100143245
738 Ga0070659_100091407
739 Ga0070659_100113438
740 Ga0070663_100062990
741 Ga0070662_100210353
742 Ga0068855_100006000
743 Ga0068855_100536112
744 Ga0070664_100102366
745 Ga0070664_100193079
746 Ga0068857_100321283
747 Ga0068852_100357050
748 Ga0070717_10079001
749 Ga0075363_100052926
750 Ga0075364_10144923
751 Ga0075362_10011219
752 Ga0097621_100299942
753 Ga0105244_10001653
754 Ga0105244_10003305
755 Ga0105244_10021468
756 Ga0105240_10339693
757 Ga0105245_10114926
758 Ga0105243_10257882
759 Ga0105242_10056657
760 Ga0105242_10066652
761 Ga0105238_10249752
762 Ga0105239_10156431
763 Ga0157371_10000003
764 Ga0157370_10229453
765 Ga0157374_10256690
766 Ga0157372_10049812
767 Ga0182008_10003135
768 Ga0182008_10008129
769 Ga0157376_10295272
770 Ga0182006_1000007
771 Ga0182006_1000023
772 Ga0182007_10000022
773 Ga0182007_10006126
774 Ga0182005_1000006
775 Ga0182005_1000010
776 Ga0163161_10018403
777 Ga0163161_10078914
778 Ga0213872_10000108
779 Ga0213872_10000642
780 Ga0213872_10000745
781 Ga0213872_10032067
782 Ga0209563_100011
783 Ga0209437_102479
784 Ga0209437_107340
785 Ga0207425_1000257
786 Ga0209646_1000042
787 Ga0209677_100566
788 Ga0209148_1000580
789 Ga0209455_1000031
790 Ga0209025_1003139
791 Ga0209564_1000010
792 Ga0209564_1000042
793 Ga0209758_1000379
794 Ga0207655_1000933
795 Ga0207655_1001881
796 Ga0207705_10001434
797 Ga0207654_10002736
798 Ga0207660_10039246
799 Ga0207657_10017508
800 Ga0207649_10244710
801 Ga0207694_10204503
802 Ga0207687_10224867
803 Ga0207690_10213203
804 Ga0207686_10004493
805 Ga0207709_10098284
806 Ga0207689_10268830
807 Ga0207679_10080801
808 Ga0207679_10282364
809 Ga0207667_10005031
810 Ga0207639_10546467
811 Ga0207648_10282081
812 Ga0207674_10222947
813 Ga0207698_10213133
814 Ga0316180_1180700
815 Ga0316181_1129638
816 Ga0316181_1199303
817 Ga0316182_1271808
818 Ga0316182_1358504
819 Ga0307414_10011223
820 Ga0373939_0059011
821 Ga0395899_0000019
822 Ga0395899_0003649
823 Ga0395899_0005285
824 Ga0395899_0007031
825 Ga0395899_0010061
826 Ga0395899_0147074
827 Ga0395899_0158726
828 Ga0395900_0001043
829 Ga0395900_0001113
830 Ga0395900_0001479
831 Ga0395900_0024595
832 Ga0395900_0146256
833 Ga0395900_0162218
834 Ga0395900_0221245
835 Ga0395898_0006387
836 Ga0395898_0167004
837 Ga0395898_0174287
838 Ga0395898_0670191
839 Ga0395905_0090520
840 Ga0395905_0204391
841 Ga0395905_0277630
842 Ga0395901_0000278
843 Ga0395901_0001341
844 Ga0395901_0149846
845 Ga0395901_0268521
846 Ga0436361_0147055
847 Ga0436361_0183975
848 Ga0436361_0605709
849 Ga0436361_0683298
850 Ga0436361_0797816
851 Ga0439449_0041316
852 Ga0439455_0048889
853 Ga0450904_000223
854 Ga0466972_0001809
855 Ga0466965_0032952
856 Ga0466965_0039596
857 Ga0466965_0054629
858 Ga0466965_0147485
859 Ga0466966_0008186
860 Ga0466966_0020912
861 Ga0466966_0043082
862 Ga0466966_0080439
863 Ga0466966_0227174
864 Ga0466964_0004327
865 Ga0466971_0147173
866 Ga0466968_0034835
867 Ga0466957_0000018
868 Ga0466957_0022654
869 Ga0466957_0076963
870 Ga0466959_0015548
871 Ga0466959_0138641
872 Ga0466959_0309929
873 Ga0466959_0309986
874 Ga0466958_0089787
875 Ga0466958_0230536
876 Ga0466967_0068239
877 Ga0495617_000179
878 Ga0495617_000662
879 Ga0495617_002766
880 Ga0495627_000004
881 Ga0495627_000583
882 Ga0495627_030695
883 Ga0495627_047635
884 Ga0495603_0155052
885 Ga0495590_0000012
886 Ga0495590_0000575
887 Ga0495590_0001081
888 Ga0495590_0005303
889 Ga0495591_000494
890 Ga0495629_0066104
891 Ga0495638_0000047
892 Ga0495638_0072855
893 Ga0495638_0117144
894 Ga0495638_0275933
895 Ga0495638_0295970
896 Ga0495653_0000082
897 Ga0495653_0011424
898 Ga0495653_0023637
899 Ga0495653_0026879
900 Ga0495653_0242422
901 Ga0495650_0000077
902 Ga0495650_0000265
903 Ga0495650_0000826
904 Ga0495650_0000899
905 Ga0495650_0000931
906 Ga0495650_0003104
907 Ga0495650_0028330
908 Ga0495650_0035428
909 Ga0495650_0039162
910 Ga0495580_0007047
911 Ga0495582_0013573
912 Ga0495582_0029173
913 Ga0495582_0300031
914 Ga0495605_0000399
915 Ga0495605_0000400
916 Ga0495605_0003060
917 Ga0495605_0005857
918 Ga0495605_0008291
919 Ga0495605_0015580
920 Ga0495584_0000004
921 Ga0495584_0000760
922 Ga0495584_0001006
923 Ga0495584_0002503
924 Ga0495584_0007301
925 Ga0495584_0008592
926 Ga0495584_0009364
927 Ga0495584_0025129
928 Ga0495584_0038063
929 Ga0495585_0000050
930 Ga0495585_0000053
931 Ga0495585_0000420
932 Ga0495585_0001104
933 Ga0495585_0001162
934 Ga0495585_0002628
935 Ga0495585_0003115
936 Ga0495585_0005092
937 Ga0495585_0007144
938 Ga0495585_0027664
939 Ga0495585_0057585
940 Ga0495585_0074491
941 Ga0495585_0079595
942 Ga0495594_0000634
943 Ga0495594_0000954
944 Ga0495594_0003009
945 Ga0495594_0008961
946 Ga0495594_0071670
947 Ga0495594_0085854
948 Ga0495594_0151767
949 Ga0495596_0000606
950 Ga0495596_0001244
951 Ga0495596_0005196
952 Ga0495596_0006666
953 Ga0495596_0021585
954 Ga0495596_0021836
955 Ga0495596_0023113
956 Ga0495596_0037308
957 Ga0495596_0043444
958 Ga0495596_0052325
959 Ga0495596_0058954
960 Ga0495607_0000638
961 Ga0495607_0001742
962 Ga0495607_0002137
963 Ga0495607_0004083
964 Ga0495607_0005155
965 Ga0495607_0005235
966 Ga0495607_0011197
967 Ga0495607_0020767
968 Ga0495607_0039222
969 Ga0495607_0049634
970 Ga0495607_0133300
971 Ga0495607_0156896
972 Ga0495607_0179288
973 Ga0495583_0000092
974 Ga0495583_0000862
975 Ga0495583_0000926
976 Ga0495583_0001605
977 Ga0495583_0006011
978 Ga0495583_0009905
979 Ga0495583_0011528
980 Ga0495583_0012394
981 Ga0495583_0048388
982 Ga0495583_0081388
983 Ga0495583_0159846
984 Ga0495606_0000101
985 Ga0495606_0000201
986 Ga0495606_0000409
987 Ga0495606_0000623
988 Ga0495606_0001015
989 Ga0495606_0001399
990 Ga0495606_0007028
991 Ga0495606_0013533
992 Ga0495606_0014004
993 Ga0495606_0015466
994 Ga0495606_0024874
995 Ga0495606_0183653
996 Ga0495606_0224118
997 Ga0495610_0000293
998 Ga0495610_0000381
999 Ga0495610_0000400
1000 Ga0495610_0005911
1001 Ga0495610_0006591
1002 Ga0495610_0034204
1003 Ga0495610_0064705
1004 Ga0495610_0076766
1005 Ga0495616_0000313
1006 Ga0495616_0000776
1007 Ga0495616_0002505
1008 Ga0495616_0003745
1009 Ga0495616_0007297
1010 Ga0495616_0008618
1011 Ga0495616_0017522
1012 Ga0495616_0018666
1013 Ga0495616_0020062
1014 Ga0495616_0032208
1015 Ga0495616_0053589
1016 Ga0495616_0065148
1017 Ga0495620_0085240
1018 Ga0495630_0352880
1019 Ga0495631_0000402
1020 Ga0495631_0001253
1021 Ga0495631_0007541
1022 Ga0495631_0013364
1023 Ga0495631_0013543
1024 Ga0495631_0016262
1025 Ga0495631_0024044
1026 Ga0495631_0027321
1027 Ga0495631_0037263
1028 Ga0495631_0078769
1029 Ga0495631_0091509
1030 Ga0495632_0000447
1031 Ga0495632_0000523
1032 Ga0495632_0000632
1033 Ga0495632_0001828
1034 Ga0495632_0041744
1035 Ga0495632_0074838
1036 Ga0495632_0094360
1037 Ga0495637_0000003
1038 Ga0495637_0000263
1039 Ga0495637_0000620
1040 Ga0495643_0000234
1041 Ga0495643_0000235
1042 Ga0495643_0000388
1043 Ga0495643_0001408
1044 Ga0495643_0003651
1045 Ga0495643_0013811
1046 Ga0495643_0020015
1047 Ga0495643_0043408
1048 Ga0495643_0050841
1049 Ga0495644_0014074
1050 Ga0495644_0023963
1051 Ga0495644_0037640
1052 Ga0495644_0039463
1053 Ga0495644_0066031
1054 Ga0495644_0106723
1055 Ga0495648_0000019
1056 Ga0495648_0000451
1057 Ga0495648_0000716
1058 Ga0495648_0005778
1059 Ga0495648_0005848
1060 Ga0495648_0007461
1061 Ga0495648_0019862
1062 Ga0495648_0021156
1063 Ga0495648_0037586
1064 Ga0495648_0044982
1065 Ga0495648_0111242
1066 Ga0495648_0258534
1067 Ga0495663_0009455
1068 Ga0495666_0017788
1069 Ga0495666_0114171
1070 Ga0495642_0000197
1071 Ga0495642_0000454
1072 Ga0495642_0000636
1073 Ga0495642_0001145
1074 Ga0495642_0003250
1075 Ga0495642_0004143
1076 Ga0495642_0004192
1077 Ga0495642_0007195
1078 Ga0495642_0015655
1079 Ga0495642_0025496
1080 Ga0495642_0032439
1081 Ga0495642_0036593
1082 Ga0495642_0084986
1083 Ga0495642_0142331
1084 Ga0495652_0018190
1085 Ga0495654_0000022
1086 Ga0495654_0005038
1087 Ga0495654_0007858
1088 Ga0495654_0019479
1089 Ga0495654_0070615
1090 Ga0495654_0118607
1091 Ga0495665_0005293
1092 Ga0495586_0007219
1093 Ga0495586_0009979
1094 Ga0495586_0298604
1095 Ga0495587_0028124
1096 Ga0495587_0032239
1097 Ga0495587_0139262
1098 Ga0495609_0000117
1099 Ga0495609_0000638
1100 Ga0495609_0000741
1101 Ga0495609_0007027
1102 Ga0495609_0007753
1103 Ga0495609_0022220
1104 Ga0495609_0059981
1105 Ga0495609_0068345
1106 Ga0495609_0073213
1107 Ga0495609_0083760
1108 Ga0495609_0127829
1109 Ga0495597_0000075
1110 Ga0495597_0000247
1111 Ga0495597_0000500
1112 Ga0495597_0000681
1113 Ga0495597_0000886
1114 Ga0495597_0017518
1115 Ga0495597_0018852
1116 Ga0495597_0042178
1117 Ga0495597_0051957
1118 Ga0495645_0338219
1119 Ga0495622_0000019
1120 Ga0495622_0000037
1121 Ga0495622_0025372
1122 Ga0495622_0059210
1123 Ga0495622_0063105
1124 Ga0495633_0000221
1125 Ga0495633_0000489
1126 Ga0495633_0001948
1127 Ga0495633_0001978
1128 Ga0495633_0004764
1129 Ga0495633_0005394
1130 Ga0495633_0007241
1131 Ga0495633_0008933
1132 Ga0495633_0025142
1133 Ga0495633_0044824
1134 Ga0495633_0081829
1135 Ga0495633_0111366
1136 Ga0495633_0116165
1137 Ga0495633_0158826
1138 Ga0495656_0074407
1139 Ga0495656_0121505
1140 Ga0495656_0254930
1141 Ga0495668_0000398
1142 Ga0495668_0000496
1143 Ga0495668_0000961
1144 Ga0495668_0001559
1145 Ga0495668_0001745
1146 Ga0495668_0001864
1147 Ga0495668_0003424
1148 Ga0495668_0004995
1149 Ga0495668_0005718
1150 Ga0495668_0013940
1151 Ga0495668_0015465
1152 Ga0495668_0018929
1153 Ga0495668_0020341
1154 Ga0495668_0021966
1155 Ga0495668_0037418
1156 Ga0495668_0080336
1157 Ga0495668_0090106
1158 Ga0495634_0027322
1159 Ga0495634_0196341
1160 Ga0495611_0001262
1161 Ga0495611_0001740
1162 Ga0495611_0002290
1163 Ga0495611_0003996
1164 Ga0495611_0013464
1165 Ga0495611_0018188
1166 Ga0495611_0076766
1167 Ga0495611_0092767
1168 Ga0495625_0000432
1169 Ga0495625_0010083
1170 Ga0495625_0012643
1171 Ga0495625_0025283
1172 Ga0495625_0134648
1173 Ga0495635_0035039
1174 Ga0495635_0400615
1175 Ga0495659_0143940
1176 Ga0495661_0000650
1177 Ga0495661_0001359
1178 Ga0495661_0001854
1179 Ga0495661_0003398
1180 Ga0495661_0007453
1181 Ga0495661_0011354
1182 Ga0495661_0011453
1183 Ga0495661_0023785
1184 Ga0495661_0029698
1185 Ga0495661_0048858
1186 Ga0495661_0073224
1187 Ga0495661_0145374
1188 Ga0495661_0199216
1189 Ga0495588_0000094
1190 Ga0495588_0006574
1191 Ga0495588_0007338
1192 Ga0495588_0007619
1193 Ga0495588_0025571
1194 Ga0495588_0082365
1195 Ga0495588_0105363
1196 Ga0495588_0135351
1197 Ga0495588_0199970
1198 Ga0495669_0000015
1199 Ga0495669_0003046
1200 Ga0495669_0008762
1201 Ga0495669_0045641
1202 Ga0495669_0074051
1203 Ga0495624_0017844
1204 Ga0495624_0059389
1205 Ga0495624_0141814
1206 Ga0495670_0000278
1207 Ga0495670_0000315
1208 Ga0495670_0002848
1209 Ga0495670_0036650
1210 Ga0495670_0038367
1211 Ga0495670_0038790
1212 Ga0495670_0081675
1213 Ga0495670_0143618
1214 Ga0495670_0190905
1215 Ga0495670_0378808
1216 Ga0495671_0000301
1217 Ga0495671_0001957
1218 Ga0495671_0011330
1219 Ga0495671_0022280
1220 Ga0495671_0077262
1221 Ga0495671_0091360
1222 Ga0495671_0172281
1223 Ga0495649_0000268
1224 Ga0495649_0001458
1225 Ga0495649_0016287
1226 Ga0495649_0016588
1227 Ga0495649_0027637
1228 Ga0495649_0200831
1229 Ga0495589_0000096
1230 Ga0495589_0000351
1231 Ga0495589_0000626
1232 Ga0495589_0007724
1233 Ga0495589_0028640
1234 Ga0495589_0032591
1235 Ga0495589_0109227
1236 Ga0495589_0120688
1237 Ga0495589_0162513
1238 Ga0495600_0033257
1239 Ga0495600_0043681
1240 Ga0495660_0000497
1241 Ga0495660_0000526
1242 Ga0495660_0000661
1243 Ga0495660_0003743
1244 Ga0495660_0005475
1245 Ga0495660_0008077
1246 Ga0495660_0016406
1247 Ga0495660_0027981
1248 Ga0495660_0036766
1249 Ga0495660_0042789
1250 Ga0495660_0092536
1251 Ga0495660_0188626
1252 Ga0495660_0219373
1253 Ga0495581_0016403
1254 Ga0495581_0056896
1255 Ga0495581_0119670
1256 Ga0495581_0167880
1257 Ga0495604_0011774
1258 Ga0495604_0027368
1259 Ga0495636_0006337
1260 Ga0495636_0097376
1261 Ga0495674_0019553
1262 Ga0495672_0000019
1263 Ga0495672_0000391
1264 Ga0495672_0000565
1265 Ga0495672_0000614
1266 Ga0495672_0001197
1267 Ga0495672_0001908
1268 Ga0495672_0007590
1269 Ga0495672_0076198
1270 Ga0495672_0160040
1271 Ga0495676_0000281
1272 Ga0495676_0023451
1273 Ga0495676_0028585
1274 Ga0495676_0103035
1275 Ga0495676_0236658
1276 Ga0495676_0269740
1277 Ga0495680_0016559
1278 Ga0495680_0261754
1279 Ga0495683_0000470
1280 Ga0495683_0000528
1281 Ga0495683_0014871
1282 Ga0495683_0025230
1283 Ga0495683_0039714
1284 Ga0495683_0052613
1285 Ga0495683_0085094
1286 Ga0495683_0088310
1287 Ga0495687_000110
1288 Ga0495687_000117
1289 Ga0495687_000203
1290 Ga0495687_000772
1291 Ga0495687_001912
1292 Ga0495687_003627
1293 Ga0495687_051835
1294 Ga0495675_0015626
1295 Ga0495675_0047227
1296 Ga0495675_0126241
1297 Ga0495677_0000036
1298 Ga0495677_0003242
1299 Ga0495677_0003655
1300 Ga0495677_0014072
1301 Ga0495677_0016807
1302 Ga0495677_0016971
1303 Ga0495677_0020215
1304 Ga0495677_0027169
1305 Ga0495677_0033173
1306 Ga0495677_0049503
1307 Ga0495677_0078260
1308 Ga0495677_0082622
1309 Ga0495677_0104067
1310 Ga0495677_0138429
1311 Ga0495679_002549
1312 Ga0495679_004140
1313 Ga0495679_006398
1314 Ga0495679_006550
1315 Ga0495685_006558
1316 Ga0495685_007962
1317 Ga0495685_010349
1318 Ga0495673_0000008
1319 Ga0495673_0025777
1320 Ga0495673_0067756
1321 Ga0495681_0000429
1322 Ga0495681_0001239
1323 Ga0495681_0001376
1324 Ga0495681_0003161
1325 Ga0495681_0004591
1326 Ga0495681_0005059
1327 Ga0495681_0040063
1328 Ga0495681_0058999
1329 Ga0495681_0104484
1330 Ga0495681_0155482
1331 Ga0495686_0000148
1332 Ga0495686_0000211
1333 Ga0495686_0005565
1334 Ga0495686_0009158
1335 Ga0495686_0129622
1336 Ga0495593_0002163
1337 Ga0495593_0063507
1338 Ga0495602_0012422
1339 Ga0495602_0212932
1340 Ga0495614_0000755
1341 Ga0495614_0005799
1342 Ga0495626_0000248
1343 Ga0495626_0000922
1344 Ga0495626_0001905
1345 Ga0495626_0007451
1346 Ga0495626_0008067
1347 Ga0495626_0009726
1348 Ga0495626_0021489
1349 Ga0495626_0023926
1350 Ga0495626_0028676
1351 Ga0495626_0029886
1352 Ga0495626_0053381
1353 Ga0496102_0000024
1354 Ga0496102_0000854
1355 Ga0496102_0018168
1356 Ga0496102_0056042
1357 Ga0496102_0106390
1358 Ga0496102_0149687
1359 Ga0496102_0600648
1360 Ga0496102_0659047
1361 Ga0496103_0003836
1362 Ga0496103_0014927
1363 Ga0496103_0044825
1364 Ga0496105_0142054
1365 Ga0496106_0004558
1366 Ga0496106_0158512
1367 Ga0496107_0049727
1368 Ga0496107_0081381
1369 Ga0496109_0690802
1370 Ga0496110_0000432
1371 Ga0496110_0033262
1372 Ga0496111_0014268
1373 Ga0496113_0023614
1374 Ga0496115_0004918
1375 Ga0496115_0486968
1376 Ga0496116_0034826
1377 Ga0496117_0000005
1378 Ga0496118_0000022
1379 Ga0496120_0053151
1380 Ga0496121_0026329
1381 Ga0496121_0070962
1382 Ga0496122_0027724
1383 Ga0496122_0073737
1384 Ga0496122_0099944
1385 Ga0496122_0100825
1386 Ga0496123_0000904
1387 Ga0496123_0002872
1388 Ga0496123_0004448
1389 Ga0496123_0039836
1390 Ga0496124_0008198
1391 Ga0496124_0131052
1392 Ga0496124_0140038
1393 Ga0496124_0176232
1394 Ga0496124_0182901
1395 Ga0496124_0190692
1396 Ga0496124_0272158
1397 Ga0496125_0003465
1398 Ga0496125_0040215
1399 Ga0495678_000012
1400 Ga0495678_000130
1401 Ga0495678_000136
1402 Ga0495678_000227
1403 Ga0495678_000931
1404 Ga0495678_001791
1405 Ga0495678_003369
1406 Ga0495678_003639
1407 Ga0495678_006824
1408 Ga0495678_034471
1409 Ga0495682_0000286
1410 Ga0495682_0001484
1411 Ga0495682_0001646
1412 Ga0495682_0013703
1413 Ga0495682_0032808
1414 Ga0501034_0000225
1415 Ga0501269_000593
1416 Ga0501035_0015389
1417 nmdc:mga03683_34456_c1
1418 nmdc:mga03n38_98369_c1
1419 nmdc:mga00v17_251552_c1
1420 nmdc:mga00v17_73838_c1
1421 Ga0500594_0067466
1422 Ga0500618_002489
1423 Ga0500586_000653
1424 Ga0500586_014724
1425 2601671451
1426 2643801887
1427 2644474319
1428 2738826378
1429 2739150175
1430 2739192094
1431 2739318571
1432 2739336812
1433 2821134830
1434 2842716960
1435 2855733187
1436 2857548712
1437 2857558933
1438 2857567577
1439 2881416001
1440 2885082163
1441 2904428181
1442 2932415965
1443 2932422022
1444 8047674481

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01048

PNP_UDP_1

Phosphorylase superfamily

36

282

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1jys-assembly1.cif.gz_B crystal structure of e. coli mta/adohcy nucleosidase 0.9415 1 229
1jys-assembly1.cif.gz_B crystal structure of e. coli mta/adohcy nucleosidase 0.9335 1 229
3mms-assembly1.cif.gz_A-2 crystal structure of streptococcus pneumoniae mta/sah nucleosidase in complex with 8-aminoadenine 0.9312 1 228
3bl6-assembly1.cif.gz_A-2 crystal structure of staphylococcus aureus 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase in complex with formycin a 0.9311 1 228
1z5p-assembly1.cif.gz_A-2 crystal structure of mta/adohcy nucleosidase with a ligand-free purine binding site 0.9297 1 230
ID Description Score Start End Superfamily
3mmsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9312 1 228 3.40.50.1580
3eeiB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9284 2 228 3.40.50.1580
1z5oA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9236 1 230 3.40.50.1580
3mmsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9234 1 228 3.40.50.1580
4bmzB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.9101 1 228 3.40.50.1580
ID Description Score Start End GO Terms
AF-A0A4V2A4D0-F1-model_v4 5'-methylthioadenosine/adenosylhomocysteine nucleosidase 0.992 1 135 GO:0005829
GO:0008782
GO:0008930
GO:0009116
GO:0019284
AF-A0A7W1MJA1-F1-model_v4 deleted 0.9819 9 135
AF-A0A542LW77-F1-model_v4 adenosylhomocysteine nucleosidase (EC 3.2.2.9) 0.9765 1 233 GO:0005829
GO:0008782
GO:0008930
GO:0009164
GO:0019284
GO:0019509
AF-A0A7W8YE79-F1-model_v4 adenosylhomocysteine nucleosidase (EC 3.2.2.9) 0.9758 1 230 GO:0005829
GO:0008782
GO:0008930
GO:0009164
GO:0019284
GO:0019509
AF-A0A2N7RUW3-F1-model_v4 adenosylhomocysteine nucleosidase (EC 3.2.2.9) 0.9741 1 230 GO:0005829
GO:0008782
GO:0008930
GO:0009164
GO:0019284
GO:0019509

Map