F477453

General Info

Members Datasets Scaffolds Average Seq Length
722 316 721 189

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0140138|Ga0501083_0140138_791_1483
Length 230
Sequence MASYSTNEFRSGLKILMDGDPYAIVENEFVKPGKGQAFNRVKVRNLKTGRVIERTFKSGETVEAADVVDTEMQYLYTDGDFWHFMVPENFEQYVAGKAVVGDGAIWLKDGDVCIITLWNNVPLVVTPPAHVELKVIETDPGVRGDTATGGQKPAKLETGAVVRVPLFINEGEVIRVDTRTGAYISRAKQQADVSRSFPNSLPDAAVLVEMQLAPVGVSVRDCYGHLPGAG

Samples

Sample ID Description Type Environment
1 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
76 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
157 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
158 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
159 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
160 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
161 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
162 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
171 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
172 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
173 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
188 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
189 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
192 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
193 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
194 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
195 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
196 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
197 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
198 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
203 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
204 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
205 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
206 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
207 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
208 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
209 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
210 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
211 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
212 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
213 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
214 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
215 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
216 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
217 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
220 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
221 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
222 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
223 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
226 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
229 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
230 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
231 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
232 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
233 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
234 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
238 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
239 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
244 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
254 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
255 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
256 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
292 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
295 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
300 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
301 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
302 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
303 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
309 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
310 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
311 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
312 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
313 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
314 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
315 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
316 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.54
Metatranscriptomes 3.32
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 1.8
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 6.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10164463 3300003316 Bacteria 1143
2 Ga0065712_10043345 3300005290 Bacteria 822
3 Ga0065715_10708533 3300005293 Bacteria 649
4 Ga0065707_10081830 3300005295 Bacteria 35453
5 Ga0070676_10424221 3300005328 Bacteria 930
6 Ga0070670_100244689 3300005331 Bacteria 1562
7 Ga0070670_100304224 3300005331 Bacteria 1395
8 Ga0070677_10163256 3300005333 Bacteria 1047
9 Ga0068869_100287374 3300005334 Bacteria 1324
10 Ga0068869_100950098 3300005334 Bacteria 746
11 Ga0070666_10003946 3300005335 Bacteria 9008
12 Ga0070680_100039008 3300005336 Bacteria 3842
13 Ga0070682_100513204 3300005337 Bacteria 931
14 Ga0068868_100010077 3300005338 Bacteria 6827
15 Ga0070689_101026157 3300005340 Bacteria 735
16 Ga0070661_100402956 3300005344 Bacteria 1082
17 Ga0070661_100407410 3300005344 Bacteria 1076
18 Ga0070692_10114467 3300005345 Bacteria 1496
19 Ga0070692_10408415 3300005345 Bacteria 859
20 Ga0070668_100016735 3300005347 Bacteria 5481
21 Ga0070669_100006860 3300005353 Bacteria 8190
22 Ga0070675_100014787 3300005354 Bacteria 6159
23 Ga0070675_100107813 3300005354 Bacteria 2352
24 Ga0070671_100001122 3300005355 Bacteria 19877
25 Ga0070671_100149840 3300005355 Bacteria 1969
26 Ga0070671_101058306 3300005355 Bacteria 712
27 Ga0070674_100008237 3300005356 Bacteria 6194
28 Ga0070674_101006415 3300005356 Bacteria 731
29 Ga0070673_100162927 3300005364 Bacteria 1898
30 Ga0070673_100259696 3300005364 Bacteria 1517
31 Ga0070667_100000057 3300005367 Bacteria 150501
32 Ga0070667_100003459 3300005367 Bacteria 13450
33 Ga0070714_100002469 3300005435 Bacteria 13641
34 Ga0070713_100050204 3300005436 Bacteria 3445
35 Ga0070713_101014263 3300005436 Bacteria 801
36 Ga0070701_10000431 3300005438 Bacteria 14307
37 Ga0070711_100074211 3300005439 Bacteria 2405
38 Ga0070705_100434479 3300005440 Bacteria 981
39 Ga0070694_100105738 3300005444 Bacteria 1998
40 Ga0070694_100225662 3300005444 Bacteria 1407
41 Ga0070662_100001466 3300005457 Bacteria 14526
42 Ga0068867_100024206 3300005459 Bacteria 4350
43 Ga0070684_100340880 3300005535 Bacteria 1378
44 Ga0070672_100002589 3300005543 Bacteria 11554
45 Ga0070672_100498998 3300005543 Bacteria 1053
46 Ga0070672_100651918 3300005543 Bacteria 920
47 Ga0070686_100006322 3300005544 Bacteria 6578
48 Ga0070695_100676633 3300005545 Bacteria 817
49 Ga0070665_100019642 3300005548 Bacteria 6781
50 Ga0070665_100087190 3300005548 Bacteria 3126
51 Ga0070704_100006386 3300005549 Bacteria 6949
52 Ga0070704_100037467 3300005549 Bacteria 3313
53 Ga0070664_100005398 3300005564 Bacteria 10261
54 Ga0068856_100812794 3300005614 Unclassified 954
55 Ga0070702_100068038 3300005615 Bacteria 2094
56 Ga0068852_100145339 3300005616 Bacteria 2199
57 Ga0068859_100031182 3300005617 Bacteria 5351
58 Ga0068859_100056395 3300005617 Bacteria 3954
59 Ga0068859_100255010 3300005617 Bacteria 1845
60 Ga0068859_101028974 3300005617 Bacteria 905
61 Ga0068864_100003919 3300005618 Bacteria 12262
62 Ga0068864_100076795 3300005618 Bacteria 2919
63 Ga0068861_100054591 3300005719 Bacteria 3044
64 Ga0068861_100792627 3300005719 Bacteria 889
65 Ga0068870_10025601 3300005840 Bacteria 2931
66 Ga0068870_10079413 3300005840 Bacteria 1810
67 Ga0068863_100001117 3300005841 Bacteria 26783
68 Ga0068858_100024492 3300005842 Bacteria 5622
69 Ga0068858_100040342 3300005842 Bacteria 4329
70 Ga0068860_100036640 3300005843 Bacteria 4699
71 Ga0068860_100243968 3300005843 Bacteria 1748
72 Ga0068862_100019309 3300005844 Bacteria 5688
73 Ga0068862_100218545 3300005844 Bacteria 1724
74 Ga0070712_100062834 3300006175 Bacteria 2627
75 Ga0075427_10019405 3300006194 Bacteria 1072
76 Ga0097621_100023783 3300006237 Bacteria 4774
77 Ga0097621_100133484 3300006237 Bacteria 2115
78 Ga0068871_100018593 3300006358 Bacteria 5287
79 Ga0068871_100095366 3300006358 Bacteria 2484
80 Ga0068871_100522531 3300006358 Bacteria 1072
81 Ga0075428_100006380 3300006844 Bacteria 13126
82 Ga0075428_100007135 3300006844 Bacteria 12379
83 Ga0075428_100025918 3300006844 Bacteria 6493
84 Ga0075428_100061093 3300006844 Bacteria 4126
85 Ga0075428_100126578 3300006844 Bacteria 2780
86 Ga0075430_100003451 3300006846 Bacteria 13224
87 Ga0075430_100062492 3300006846 Bacteria 3128
88 Ga0075430_100219009 3300006846 Bacteria 1579
89 Ga0075430_100229917 3300006846 Bacteria 1538
90 Ga0075430_100248649 3300006846 Bacteria 1473
91 Ga0075431_100015225 3300006847 Bacteria 7793
92 Ga0075431_100015713 3300006847 Bacteria 7676
93 Ga0075431_100016725 3300006847 Bacteria 7449
94 Ga0075433_10012077 3300006852 Bacteria 6967
95 Ga0075429_100022299 3300006880 Bacteria 5493
96 Ga0075429_100063954 3300006880 Bacteria 3205
97 Ga0075429_100073706 3300006880 Bacteria 2973
98 Ga0068865_100020120 3300006881 Bacteria 4328
99 Ga0068865_100329234 3300006881 Bacteria 1231
100 Ga0097620_100031181 3300006931 Bacteria 5351
101 Ga0097620_100056396 3300006931 Bacteria 3954
102 Ga0097620_100255002 3300006931 Bacteria 1845
103 Ga0097620_101028990 3300006931 Bacteria 905
104 Ga0075435_100273939 3300007076 Bacteria 1440
105 Ga0099795_10000016 3300007788 Bacteria 63930
106 Ga0105250_10189431 3300009092 Bacteria 865
107 Ga0105240_10000101 3300009093 Bacteria 175584
108 Ga0105240_10281241 3300009093 Unclassified 1911
109 Ga0105240_10344033 3300009093 Bacteria 1693
110 Ga0111539_10006436 3300009094 Bacteria 15137
111 Ga0111539_10006586 3300009094 Bacteria 14967
112 Ga0111539_10044904 3300009094 Bacteria 5291
113 Ga0111539_10070320 3300009094 Bacteria 4132
114 Ga0111539_10190009 3300009094 Unclassified 2397
115 Ga0105245_10002513 3300009098 Bacteria 16535
116 Ga0105245_10091944 3300009098 Bacteria 2793
117 Ga0114129_10000484 3300009147 Bacteria 48049
118 Ga0114129_10135002 3300009147 Bacteria 3386
119 Ga0114129_10318070 3300009147 Bacteria 2070
120 Ga0114129_10784810 3300009147 Bacteria 1217
121 Ga0105243_10626727 3300009148 Bacteria 1039
122 Ga0105241_10194687 3300009174 Bacteria 1689
123 Ga0105242_10033199 3300009176 Bacteria 4132
124 Ga0105242_10217876 3300009176 Bacteria 1704
125 Ga0105248_10046833 3300009177 Bacteria 4848
126 Ga0105248_10124153 3300009177 Bacteria 2912
127 Ga0105248_11175915 3300009177 Bacteria 867
128 Ga0105237_10245672 3300009545 Bacteria 1791
129 Ga0105238_10026253 3300009551 Bacteria 5936
130 Ga0105238_11652782 3300009551 Bacteria 671
131 Ga0105249_12107841 3300009553 Bacteria 637
132 Ga0105029_102958 3300009984 Bacteria 1120
133 Ga0105030_100295 3300009987 Bacteria 4339
134 Ga0099796_10112701 3300010159 Bacteria 1037
135 Ga0105239_10024104 3300010375 Bacteria 6702
136 Ga0105239_10924686 3300010375 Bacteria 1001
137 Ga0105246_10004016 3300011119 Bacteria 8935
138 Ga0105246_10284653 3300011119 Bacteria 1328
139 Ga0157371_10357552 3300013102 Bacteria 1064
140 Ga0157374_10000998 3300013296 Bacteria 24538
141 Ga0157374_10012516 3300013296 Bacteria 7384
142 Ga0157378_10085479 3300013297 Bacteria 2857
143 Ga0163162_10005163 3300013306 Bacteria 12587
144 Ga0163162_10129404 3300013306 Bacteria 2633
145 Ga0157375_10027005 3300013308 Bacteria 5360
146 Ga0157375_10083926 3300013308 Bacteria 3232
147 Ga0163163_10001153 3300014325 Bacteria 22447
148 Ga0163163_10005365 3300014325 Bacteria 11076
149 Ga0163163_10008089 3300014325 Bacteria 9316
150 Ga0163163_10029771 3300014325 Bacteria 5254
151 Ga0163163_10700698 3300014325 Bacteria 1076
152 Ga0157380_10000204 3300014326 Bacteria 34955
153 Ga0157380_10010405 3300014326 Bacteria 6692
154 Ga0157380_10038954 3300014326 Bacteria 3694
155 Ga0157380_10062125 3300014326 Bacteria 2991
156 Ga0157380_10232736 3300014326 Bacteria 1656
157 Ga0157380_10785351 3300014326 Bacteria 968
158 Ga0157380_10954651 3300014326 Bacteria 888
159 Ga0157377_10014955 3300014745 Bacteria 3957
160 Ga0157377_10446375 3300014745 Bacteria 892
161 Ga0157379_10004734 3300014968 Bacteria 11677
162 Ga0157379_10019822 3300014968 Bacteria 5943
163 Ga0157376_10005590 3300014969 Bacteria 8797
164 Ga0157376_10019028 3300014969 Bacteria 5282
165 Ga0213873_10077997 3300021358 Bacteria 923
166 Ga0213876_10004444 3300021384 Bacteria 7851
167 Ga0213876_10019875 3300021384 Bacteria 3548
168 Ga0213876_10083935 3300021384 Bacteria 1685
169 Ga0213875_10020553 3300021388 Bacteria 3167
170 Ga0207696_1091905 3300025711 Bacteria 831
171 Ga0207682_10080166 3300025893 Bacteria 1398
172 Ga0207642_10007513 3300025899 Bacteria 3687
173 Ga0207688_10165595 3300025901 Bacteria 1312
174 Ga0207680_10003496 3300025903 Bacteria 7399
175 Ga0207680_10085972 3300025903 Bacteria 1988
176 Ga0207680_10145208 3300025903 Bacteria 1576
177 Ga0207680_10934754 3300025903 Bacteria 621
178 Ga0207699_10045218 3300025906 Bacteria 2569
179 Ga0207645_10000405 3300025907 Bacteria 35647
180 Ga0207645_10391099 3300025907 Bacteria 934
181 Ga0207643_10008333 3300025908 Bacteria 5563
182 Ga0207654_10552732 3300025911 Bacteria 818
183 Ga0207695_10078683 3300025913 Bacteria 3344
184 Ga0207695_10559093 3300025913 Bacteria 1025
185 Ga0207671_10184152 3300025914 Bacteria 1626
186 Ga0207693_10096623 3300025915 Bacteria 2316
187 Ga0207663_10037520 3300025916 Bacteria 2922
188 Ga0207662_10717722 3300025918 Bacteria 701
189 Ga0207649_10342428 3300025920 Bacteria 1104
190 Ga0207650_10023090 3300025925 Bacteria 4410
191 Ga0207659_10019401 3300025926 Bacteria 4476
192 Ga0207687_10019628 3300025927 Bacteria 4480
193 Ga0207687_10123810 3300025927 Bacteria 1938
194 Ga0207700_10014832 3300025928 Bacteria 5119
195 Ga0207664_10000775 3300025929 Bacteria 21577
196 Ga0207664_10213879 3300025929 Bacteria 1669
197 Ga0207644_10038556 3300025931 Bacteria 3367
198 Ga0207690_10249486 3300025932 Bacteria 1370
199 Ga0207706_10001790 3300025933 Bacteria 21120
200 Ga0207686_10097646 3300025934 Bacteria 1954
201 Ga0207670_10335453 3300025936 Bacteria 1193
202 Ga0207704_10253500 3300025938 Bacteria 1322
203 Ga0207691_10001027 3300025940 Bacteria 27633
204 Ga0207691_10067881 3300025940 Bacteria 3223
205 Ga0207711_10002654 3300025941 Bacteria 15811
206 Ga0207689_10171369 3300025942 Bacteria 1789
207 Ga0207661_10363375 3300025944 Bacteria 1308
208 Ga0207651_10038107 3300025960 Bacteria 3156
209 Ga0207651_10141667 3300025960 Bacteria 1858
210 Ga0207668_10173980 3300025972 Bacteria 1691
211 Ga0207658_10000186 3300025986 Bacteria 66622
212 Ga0207658_10009925 3300025986 Bacteria 6468
213 Ga0207677_10011639 3300026023 Bacteria 5022
214 Ga0207677_10174557 3300026023 Bacteria 1684
215 Ga0207703_10001486 3300026035 Bacteria 21387
216 Ga0207703_10001744 3300026035 Bacteria 19465
217 Ga0207708_10026816 3300026075 Bacteria 4361
218 Ga0207708_10134655 3300026075 Bacteria 1934
219 Ga0207702_10764864 3300026078 Unclassified 954
220 Ga0207641_10088617 3300026088 Bacteria 2702
221 Ga0207641_10222603 3300026088 Bacteria 1750
222 Ga0207648_10001055 3300026089 Bacteria 30851
223 Ga0207648_10073680 3300026089 Bacteria 2976
224 Ga0207676_10001802 3300026095 Bacteria 15704
225 Ga0207676_10037050 3300026095 Bacteria 3714
226 Ga0207674_11183490 3300026116 Unclassified 734
227 Ga0207675_100002054 3300026118 Bacteria 20079
228 Ga0207675_100020391 3300026118 Bacteria 6179
229 Ga0207675_101326344 3300026118 Bacteria 740
230 Ga0207683_10183379 3300026121 Bacteria 1898
231 Ga0207698_10044748 3300026142 Bacteria 3330
232 Ga0209179_1000114 3300027512 Bacteria 9571
233 Ga0210002_1002615 3300027617 Bacteria 2605
234 Ga0210002_1013203 3300027617 Bacteria 1287
235 Ga0209983_1005483 3300027665 Bacteria 2626
236 Ga0209971_1000201 3300027682 Bacteria 17930
237 Ga0209966_1021264 3300027695 Bacteria 1261
238 Ga0209998_10000396 3300027717 Bacteria 12475
239 Ga0209974_10002740 3300027876 Bacteria 6387
240 Ga0209974_10053400 3300027876 Bacteria 1361
241 Ga0207428_10014539 3300027907 Bacteria 6828
242 Ga0207428_10082979 3300027907 Bacteria 2500
243 Ga0268266_10032473 3300028379 Bacteria 4435
244 Ga0268266_10046536 3300028379 Bacteria 3714
245 Ga0268265_11021922 3300028380 Bacteria 817
246 Ga0268264_10012855 3300028381 Bacteria 6887
247 Ga0268264_10647495 3300028381 Bacteria 1045
248 Ga0265334_10000008 3300028573 Bacteria 200602
249 Ga0265334_10008371 3300028573 Bacteria 4399
250 Ga0265338_10030934 3300028800 Bacteria 5258
251 Ga0265338_10073443 3300028800 Unclassified 2915
252 Ga0265338_10367745 3300028800 Bacteria 1030
253 Ga0265325_10110575 3300031241 Bacteria 1336
254 Ga0265340_10011441 3300031247 Bacteria 4713
255 Ga0265340_10059055 3300031247 Bacteria 1840
256 Ga0265327_10000005 3300031251 Bacteria 790146
257 Ga0265327_10000098 3300031251 Bacteria 190693
258 Ga0307513_10075796 3300031456 Bacteria 3491
259 Ga0307509_10001421 3300031507 Bacteria 40413
260 Ga0307408_100056372 3300031548 Bacteria 2849
261 Ga0307408_100243512 3300031548 Bacteria 1479
262 Ga0307408_101044834 3300031548 Bacteria 755
263 Ga0265313_10000807 3300031595 Bacteria 31618
264 Ga0265313_10016684 3300031595 Bacteria 4213
265 Ga0316575_10000434 3300031665 Bacteria 11939
266 Ga0316575_10006068 3300031665 Bacteria 4330
267 Ga0316575_10006908 3300031665 Bacteria 4107
268 Ga0316575_10011102 3300031665 Bacteria 3326
269 Ga0316575_10014122 3300031665 Bacteria 2994
270 Ga0316575_10039087 3300031665 Bacteria 1872
271 Ga0316575_10062069 3300031665 Bacteria 1494
272 Ga0316575_10108905 3300031665 Bacteria 1130
273 Ga0316575_10123216 3300031665 Bacteria 1061
274 Ga0316575_10124053 3300031665 Bacteria 1057
275 Ga0316575_10203574 3300031665 Bacteria 824
276 Ga0316579_10017663 3300031691 Bacteria 3131
277 Ga0316579_10051329 3300031691 Bacteria 1930
278 Ga0316579_10102701 3300031691 Bacteria 1369
279 Ga0316579_10118325 3300031691 Bacteria 1272
280 Ga0316579_10132037 3300031691 Bacteria 1203
281 Ga0316579_10190841 3300031691 Bacteria 990
282 Ga0316576_10004519 3300031727 Bacteria 8360
283 Ga0316576_10009417 3300031727 Bacteria 6301
284 Ga0316576_10012742 3300031727 Bacteria 5563
285 Ga0316576_10014106 3300031727 Bacteria 5329
286 Ga0316576_10023890 3300031727 Bacteria 4264
287 Ga0316576_10045352 3300031727 Bacteria 3178
288 Ga0316576_10050305 3300031727 Unclassified 3030
289 Ga0316576_10063498 3300031727 Bacteria 2711
290 Ga0316576_10071043 3300031727 Bacteria 2567
291 Ga0316576_10074666 3300031727 Bacteria 2507
292 Ga0316576_10074865 3300031727 Unclassified 2504
293 Ga0316576_10113345 3300031727 Bacteria 2033
294 Ga0316576_10147296 3300031727 Bacteria 1774
295 Ga0316576_10176524 3300031727 Bacteria 1611
296 Ga0316576_10227417 3300031727 Bacteria 1403
297 Ga0316576_10257052 3300031727 Bacteria 1311
298 Ga0316576_10302135 3300031727 Bacteria 1196
299 Ga0316576_10307835 3300031727 Bacteria 1183
300 Ga0316576_10560186 3300031727 Bacteria 837
301 Ga0316576_10874747 3300031727 Bacteria 644
302 Ga0316578_10000045 3300031728 Bacteria 25677
303 Ga0316578_10014837 3300031728 Bacteria 4175
304 Ga0316578_10021669 3300031728 Bacteria 3569
305 Ga0316578_10029909 3300031728 Bacteria 3093
306 Ga0316578_10091959 3300031728 Bacteria 1812
307 Ga0316578_10213479 3300031728 Bacteria 1160
308 Ga0307405_10016582 3300031731 Bacteria 4020
309 Ga0316577_10005479 3300031733 Bacteria 6654
310 Ga0316577_10011805 3300031733 Bacteria 4741
311 Ga0316577_10015548 3300031733 Bacteria 4187
312 Ga0316577_10018147 3300031733 Bacteria 3888
313 Ga0316577_10021930 3300031733 Bacteria 3544
314 Ga0316577_10053984 3300031733 Bacteria 2243
315 Ga0316577_10098927 3300031733 Unclassified 1634
316 Ga0316577_10102366 3300031733 Bacteria 1605
317 Ga0316577_10157442 3300031733 Bacteria 1281
318 Ga0316577_10158405 3300031733 Unclassified 1277
319 Ga0307413_10087136 3300031824 Bacteria 2021
320 Ga0307410_10117924 3300031852 Bacteria 1931
321 Ga0307410_10534514 3300031852 Bacteria 969
322 Ga0307406_10280103 3300031901 Bacteria 1271
323 Ga0307412_10063121 3300031911 Bacteria 2498
324 Ga0307412_10461548 3300031911 Bacteria 1049
325 Ga0307409_100005677 3300031995 Bacteria 7226
326 Ga0307409_100284382 3300031995 Bacteria 1530
327 Ga0307416_100137802 3300032002 Bacteria 2212
328 Ga0307416_101174864 3300032002 Bacteria 873
329 Ga0307415_100001848 3300032126 Bacteria 10376
330 Ga0316583_10008392 3300032133 Bacteria 3727
331 Ga0316583_10031567 3300032133 Bacteria 1885
332 Ga0316583_10031610 3300032133 Bacteria 1884
333 Ga0316583_10037455 3300032133 Bacteria 1719
334 Ga0316583_10039661 3300032133 Bacteria 1667
335 Ga0316583_10073060 3300032133 Unclassified 1200
336 Ga0316585_10004539 3300032137 Bacteria 3871
337 Ga0316585_10008553 3300032137 Bacteria 2973
338 Ga0316585_10022801 3300032137 Bacteria 1927
339 Ga0316585_10060090 3300032137 Bacteria 1227
340 Ga0316585_10070034 3300032137 Bacteria 1137
341 Ga0316585_10075987 3300032137 Bacteria 1092
342 Ga0316585_10093628 3300032137 Unclassified 983
343 Ga0316580_10000990 3300032139 Bacteria 7074
344 Ga0316580_10002043 3300032139 Bacteria 5469
345 Ga0316580_10005631 3300032139 Bacteria 3666
346 Ga0316580_10014022 3300032139 Bacteria 2444
347 Ga0316580_10014141 3300032139 Bacteria 2436
348 Ga0316580_10032209 3300032139 Bacteria 1623
349 Ga0316580_10117113 3300032139 Bacteria 816
350 Ga0316593_10038658 3300032168 Bacteria 1580
351 Ga0316593_10041535 3300032168 Bacteria 1531
352 Ga0316593_10133842 3300032168 Bacteria 895
353 Ga0316593_10151807 3300032168 Bacteria 843
354 Ga0316593_10151988 3300032168 Unclassified 842
355 Ga0316592_1002612 3300033524 Bacteria 3138
356 Ga0316592_1005685 3300033524 Bacteria 2377
357 Ga0316592_1008935 3300033524 Bacteria 1995
358 Ga0316592_1022851 3300033524 Bacteria 1339
359 Ga0316592_1030401 3300033524 Bacteria 1174
360 Ga0316592_1044878 3300033524 Bacteria 983
361 Ga0316586_1002622 3300033527 Bacteria 2267
362 Ga0316586_1008710 3300033527 Bacteria 1508
363 Ga0316586_1043149 3300033527 Bacteria 797
364 Ga0316588_1014477 3300033528 Bacteria 1727
365 Ga0316588_1023579 3300033528 Bacteria 1413
366 Ga0316588_1032334 3300033528 Bacteria 1230
367 Ga0316588_1052625 3300033528 Bacteria 988
368 Ga0316587_1053063 3300033529 Bacteria 745
369 Ga0316596_1003576 3300033541 Bacteria 3422
370 Ga0316596_1039416 3300033541 Bacteria 1239
371 Ga0316596_1052025 3300033541 Bacteria 1085
372 Ga0316596_1149458 3300033541 Unclassified 641
373 Ga0316596_1155787 3300033541 Bacteria 628
374 Ga0373926_0030472 3300035083 Bacteria 1900
375 Ga0373955_0032310 3300035172 Bacteria 2746
376 Ga0373961_0046137 3300035241 Bacteria 1276
377 Ga0316574_0000421 3300035398 Bacteria 16816
378 Ga0316574_0001360 3300035398 Bacteria 11514
379 Ga0316574_0006599 3300035398 Bacteria 6285
380 Ga0316574_0009475 3300035398 Bacteria 5457
381 Ga0316574_0019775 3300035398 Bacteria 3978
382 Ga0316574_0020832 3300035398 Bacteria 3885
383 Ga0316574_0035364 3300035398 Bacteria 3052
384 Ga0316574_0065558 3300035398 Bacteria 2286
385 Ga0316574_0091297 3300035398 Bacteria 1942
386 Ga0316574_0101862 3300035398 Bacteria 1838
387 Ga0316574_0180963 3300035398 Bacteria 1356
388 Ga0316574_0199949 3300035398 Bacteria 1284
389 Ga0316574_0485208 3300035398 Bacteria 772
390 Ga0316574_0621254 3300035398 Bacteria 666
391 Ga0373931_0396110 3300035691 Bacteria 873
392 Ga0373927_0000010 3300035695 Bacteria 183458
393 Ga0373927_0206284 3300035695 Bacteria 1291
394 Ga0373933_0032118 3300035724 Bacteria 3050
395 Ga0373937_0018232 3300036401 Bacteria 6264
396 Ga0373937_0033260 3300036401 Bacteria 4682
397 Ga0373937_0137044 3300036401 Bacteria 2289
398 Ga0373937_0281635 3300036401 Bacteria 1570
399 Ga0373937_1523114 3300036401 Bacteria 616
400 Ga0316582_0002483 3300036647 Bacteria 8682
401 Ga0316582_0013924 3300036647 Bacteria 4547
402 Ga0316582_0020709 3300036647 Bacteria 3872
403 Ga0316582_0038093 3300036647 Bacteria 2986
404 Ga0316582_0039759 3300036647 Bacteria 2930
405 Ga0316582_0066851 3300036647 Bacteria 2318
406 Ga0316582_0067366 3300036647 Bacteria 2309
407 Ga0316582_0112197 3300036647 Bacteria 1816
408 Ga0316582_0129449 3300036647 Bacteria 1694
409 Ga0316582_0220749 3300036647 Bacteria 1296
410 Ga0316582_0396960 3300036647 Bacteria 950
411 Ga0316582_0429823 3300036647 Bacteria 910
412 Ga0316582_0799790 3300036647 Unclassified 646
413 Ga0316584_0004581 3300036712 Bacteria 9162
414 Ga0316584_0009145 3300036712 Bacteria 6862
415 Ga0316584_0011037 3300036712 Bacteria 6331
416 Ga0316584_0015880 3300036712 Bacteria 5393
417 Ga0316584_0016629 3300036712 Bacteria 5276
418 Ga0316584_0018538 3300036712 Bacteria 5022
419 Ga0316584_0022323 3300036712 Unclassified 4614
420 Ga0316584_0024910 3300036712 Bacteria 4384
421 Ga0316584_0033854 3300036712 Bacteria 3785
422 Ga0316584_0054156 3300036712 Bacteria 3002
423 Ga0316584_0070531 3300036712 Bacteria 2619
424 Ga0316584_0087967 3300036712 Bacteria 2326
425 Ga0316584_0132967 3300036712 Bacteria 1857
426 Ga0316584_0149188 3300036712 Bacteria 1741
427 Ga0316584_0224506 3300036712 Unclassified 1379
428 Ga0316584_0263823 3300036712 Bacteria 1255
429 Ga0316584_0335186 3300036712 Bacteria 1088
430 Ga0316581_0013894 3300037588 Bacteria 2288
431 Ga0316581_0082354 3300037588 Bacteria 990
432 Ga0436364_0095069 3300037853 Bacteria 1294
433 Ga0436364_0472331 3300037853 Bacteria 1447
434 Ga0436364_0782091 3300037853 Bacteria 2731
435 Ga0436364_1384597 3300037853 Bacteria 1264
436 Ga0436364_1458736 3300037853 Bacteria 1391
437 Ga0436364_1521721 3300037853 Bacteria 19288
438 Ga0400484_09769 3300038725 Bacteria 8280
439 Ga0400484_35465 3300038725 Bacteria 21483
440 Ga0400490_06983 3300038726 Unclassified 1070
441 Ga0400490_11650 3300038726 Bacteria 5940
442 Ga0400490_16309 3300038726 Bacteria 3979
443 Ga0400490_35540 3300038726 Bacteria 51775
444 Ga0400485_08473 3300038735 Unclassified 1109
445 Ga0400485_09701 3300038735 Bacteria 12422
446 Ga0400485_13509 3300038735 Bacteria 18578
447 Ga0400488_25302 3300038741 Bacteria 4899
448 Ga0400488_53784 3300038741 Bacteria 8477
449 Ga0400488_53787 3300038741 Bacteria 1955
450 Ga0400486_16046 3300038742 Bacteria 6828
451 Ga0400486_26096 3300038742 Bacteria 60268
452 Ga0400486_30859 3300038742 Bacteria 26609
453 Ga0400483_005648 3300039062 Bacteria 15651
454 Ga0400483_029989 3300039062 Bacteria 58053
455 Ga0400483_242281 3300039062 Bacteria 55044
456 Ga0400483_252490 3300039062 Bacteria 1352
457 Ga0400483_269206 3300039062 Bacteria 85448
458 Ga0400489_35275 3300039093 Bacteria 72456
459 Ga0400489_55657 3300039093 Bacteria 17425
460 Ga0400489_68375 3300039093 Bacteria 25878
461 Ga0400489_76049 3300039093 Bacteria 1372
462 Ga0400487_46349 3300039110 Bacteria 6014
463 Ga0436365_0551274 3300039437 Bacteria 4839
464 Ga0436365_0985493 3300039437 Bacteria 6323
465 Ga0436365_1224743 3300039437 Bacteria 5397
466 Ga0436365_1406444 3300039437 Bacteria 25793
467 Ga0436363_0997300 3300039450 Bacteria 7459
468 Ga0436362_0154526 3300039453 Bacteria 2082
469 Ga0436362_0621652 3300039453 Bacteria 1126
470 Ga0436362_1108905 3300039453 Bacteria 3210
471 Ga0439461_0016797 3300041410 Bacteria 1417
472 Ga0439431_0185873 3300041997 Bacteria 601
473 Ga0439443_000428 3300042003 Bacteria 3645
474 Ga0450920_002953 3300042122 Bacteria 2926
475 Ga0450896_007368 3300042133 Bacteria 1518
476 Ga0450899_037656 3300042135 Bacteria 600
477 Ga0450906_014059 3300042145 Bacteria 1469
478 Ga0450910_024919 3300042147 Bacteria 919
479 Ga0439446_0014380 3300042156 Bacteria 2184
480 Ga0450908_009560 3300042184 Bacteria 1800
481 Ga0439434_0031556 3300042435 Bacteria 1611
482 Ga0439434_0127105 3300042435 Bacteria 834
483 Ga0439435_0025063 3300042436 Bacteria 1578
484 Ga0439464_0065427 3300042439 Bacteria 1069
485 Ga0450916_015540 3300042530 Bacteria 1001
486 Ga0450918_006465 3300042531 Bacteria 2090
487 Ga0450893_0013123 3300042532 Bacteria 1380
488 Ga0450893_0095757 3300042532 Bacteria 600
489 Ga0451577_0000195 3300042876 Bacteria 127456
490 Ga0451577_0295487 3300042876 Bacteria 1468
491 Ga0466969_0125122 3300044656 Bacteria 1194
492 Ga0453683_0003297 3300044673 Bacteria 11966
493 Ga0453683_0008865 3300044673 Bacteria 6733
494 Ga0466965_0073005 3300044683 Bacteria 1727
495 Ga0466965_0113651 3300044683 Bacteria 1393
496 Ga0466961_0353683 3300044693 Bacteria 894
497 Ga0466963_0001470 3300044694 Bacteria 12720
498 Ga0466963_0025272 3300044694 Bacteria 3786
499 Ga0466963_0165967 3300044694 Bacteria 1538
500 Ga0466963_0208457 3300044694 Bacteria 1367
501 Ga0466963_0425998 3300044694 Bacteria 936
502 Ga0466963_0495143 3300044694 Bacteria 863
503 Ga0453684_0000017 3300044712 Bacteria 925696
504 Ga0453684_0000036 3300044712 Bacteria 711481
505 Ga0453684_0000635 3300044712 Bacteria 127456
506 Ga0453684_0123258 3300044712 Bacteria 3125
507 Ga0453684_0267466 3300044712 Bacteria 1955
508 Ga0453684_0319046 3300044712 Bacteria 1760
509 Ga0453684_0445675 3300044712 Unclassified 1442
510 Ga0466971_0050995 3300044719 Bacteria 1862
511 Ga0466968_0051375 3300044735 Bacteria 1761
512 Ga0466968_0080260 3300044735 Bacteria 1432
513 Ga0466968_0134507 3300044735 Bacteria 1127
514 Ga0466968_0189850 3300044735 Bacteria 958
515 Ga0466968_0268326 3300044735 Bacteria 814
516 Ga0466970_0016470 3300044765 Bacteria 3813
517 Ga0466970_0033911 3300044765 Bacteria 2700
518 Ga0466957_0039036 3300044842 Bacteria 2863
519 Ga0466959_0138376 3300045049 Bacteria 1722
520 Ga0466959_0162928 3300045049 Bacteria 1567
521 Ga0451576_0248548 3300045051 Bacteria 1859
522 Ga0451576_1029938 3300045051 Bacteria 862
523 Ga0466958_0002260 3300045836 Bacteria 9596
524 Ga0466958_0011885 3300045836 Bacteria 4915
525 Ga0466958_0028047 3300045836 Bacteria 3335
526 Ga0466958_0040257 3300045836 Bacteria 2809
527 Ga0466967_0007683 3300045976 Bacteria 7810
528 Ga0466967_0190306 3300045976 Bacteria 1939
529 Ga0466967_0846585 3300045976 Bacteria 909
530 Ga0466967_1057445 3300045976 Bacteria 808
531 Ga0466967_1518777 3300045976 Bacteria 667
532 Ga0495603_0008315 3300046455 Bacteria 6273
533 Ga0495603_0089474 3300046455 Bacteria 1801
534 Ga0495590_0044441 3300046457 Bacteria 1549
535 Ga0495638_0032047 3300046460 Bacteria 3372
536 Ga0495651_0366657 3300046462 Bacteria 948
537 Ga0495582_0565145 3300046473 Bacteria 658
538 Ga0495607_0275241 3300046501 Bacteria 801
539 Ga0495630_0249078 3300046517 Bacteria 1357
540 Ga0495630_0462120 3300046517 Bacteria 973
541 Ga0495652_0441204 3300046529 Bacteria 913
542 Ga0495654_0086515 3300046530 Bacteria 1460
543 Ga0495586_0011357 3300046535 Bacteria 4736
544 Ga0495621_0000098 3300046539 Bacteria 17925
545 Ga0495597_0199030 3300046542 Unclassified 803
546 Ga0495667_0276210 3300046559 Bacteria 1067
547 Ga0495656_0080458 3300046615 Bacteria 1469
548 Ga0495656_0418056 3300046615 Bacteria 703
549 Ga0495634_0138229 3300046642 Bacteria 1549
550 Ga0495611_0085346 3300046648 Bacteria 1456
551 Ga0495635_0576678 3300046663 Bacteria 736
552 Ga0495657_0360552 3300046675 Bacteria 859
553 Ga0495647_0018427 3300046681 Bacteria 2485
554 Ga0495647_0158842 3300046681 Bacteria 973
555 Ga0495658_0027956 3300046683 Bacteria 3040
556 Ga0495670_0204618 3300046691 Bacteria 1046
557 Ga0495671_0004008 3300046692 Bacteria 8900
558 Ga0495673_0119506 3300047469 Bacteria 1045
559 Ga0495681_0139306 3300047470 Bacteria 1026
560 Ga0496104_0001449 3300048907 Bacteria 20492
561 Ga0496105_0001567 3300048908 Bacteria 16198
562 Ga0496108_0028591 3300048911 Bacteria 4613
563 Ga0496108_0103094 3300048911 Bacteria 2434
564 Ga0496109_0012615 3300048912 Bacteria 7297
565 Ga0496109_0032320 3300048912 Bacteria 4704
566 Ga0496111_0002880 3300048914 Bacteria 10508
567 Ga0496112_0001440 3300048915 Bacteria 18264
568 Ga0496113_0034515 3300048916 Bacteria 3691
569 Ga0496113_0276979 3300048916 Bacteria 1341
570 Ga0496114_0000244 3300048917 Bacteria 39586
571 Ga0496115_0040651 3300048918 Bacteria 3698
572 Ga0496115_0864378 3300048918 Bacteria 700
573 Ga0496116_0011339 3300048919 Bacteria 7392
574 Ga0496117_0072927 3300048920 Bacteria 2292
575 Ga0496117_0163096 3300048920 Bacteria 1303
576 Ga0496126_0071417 3300048929 Unclassified 3090
577 Ga0501031_0039301 3300049568 Bacteria 3087
578 Ga0501032_0252420 3300049569 Bacteria 1145
579 Ga0501034_0267271 3300049571 Bacteria 1652
580 Ga0501034_0289008 3300049571 Bacteria 1578
581 Ga0501036_0007849 3300049572 Bacteria 8731
582 Ga0501036_0151126 3300049572 Bacteria 1959
583 Ga0501036_0680824 3300049572 Bacteria 850
584 Ga0501037_0197202 3300049573 Bacteria 1424
585 Ga0501037_0317145 3300049573 Bacteria 1080
586 Ga0501037_0559223 3300049573 Bacteria 771
587 Ga0501038_0019453 3300049574 Bacteria 6120
588 Ga0501038_0028666 3300049574 Bacteria 4945
589 Ga0501039_0003853 3300049575 Bacteria 11261
590 Ga0501039_0028077 3300049575 Bacteria 4329
591 Ga0501039_0207631 3300049575 Bacteria 1540
592 Ga0501039_0363304 3300049575 Bacteria 1137
593 Ga0501040_0000023 3300049576 Bacteria 69444
594 Ga0501040_0001206 3300049576 Bacteria 16460
595 Ga0501040_0015429 3300049576 Bacteria 5051
596 Ga0501040_0076176 3300049576 Bacteria 2319
597 Ga0501040_0184312 3300049576 Bacteria 1480
598 Ga0501040_0245839 3300049576 Bacteria 1276
599 Ga0501040_0385437 3300049576 Bacteria 1006
600 Ga0501041_0001968 3300049577 Bacteria 11551
601 Ga0501041_0007930 3300049577 Bacteria 6243
602 Ga0501041_0031523 3300049577 Bacteria 3203
603 Ga0501041_0250870 3300049577 Bacteria 1113
604 Ga0501042_0000263 3300049578 Bacteria 25646
605 Ga0501042_0000931 3300049578 Bacteria 16497
606 Ga0501042_0761393 3300049578 Bacteria 704
607 Ga0501042_0782791 3300049578 Bacteria 694
608 Ga0501043_0061394 3300049579 Bacteria 2952
609 Ga0501046_0011112 3300049580 Bacteria 7710
610 Ga0501046_0128320 3300049580 Bacteria 1924
611 Ga0501046_0238421 3300049580 Bacteria 1342
612 Ga0501046_0394763 3300049580 Bacteria 1000
613 Ga0501048_0011120 3300049582 Bacteria 6710
614 Ga0501048_0437559 3300049582 Bacteria 936
615 Ga0501048_0602687 3300049582 Bacteria 788
616 Ga0501068_0000860 3300049584 Bacteria 15814
617 Ga0501068_0064121 3300049584 Bacteria 2236
618 Ga0501068_0164144 3300049584 Bacteria 1400
619 Ga0501069_0099195 3300049585 Bacteria 1653
620 Ga0501070_0340121 3300049586 Bacteria 1219
621 Ga0501071_0006996 3300049587 Bacteria 7366
622 Ga0501071_0014535 3300049587 Bacteria 5385
623 Ga0501071_0149593 3300049587 Bacteria 1741
624 Ga0501071_0862456 3300049587 Bacteria 698
625 Ga0501072_0001665 3300049588 Bacteria 16559
626 Ga0501072_0024666 3300049588 Bacteria 4681
627 Ga0501072_0062383 3300049588 Bacteria 2940
628 Ga0501072_0248757 3300049588 Bacteria 1416
629 Ga0501072_0267261 3300049588 Bacteria 1361
630 Ga0501073_0105511 3300049589 Bacteria 1955
631 Ga0501073_0123504 3300049589 Bacteria 1794
632 Ga0501073_0312341 3300049589 Bacteria 1084
633 Ga0501073_0490057 3300049589 Bacteria 850
634 Ga0501074_0124231 3300049590 Bacteria 1845
635 Ga0501074_0523337 3300049590 Bacteria 840
636 Ga0501075_0000858 3300049591 Bacteria 19148
637 Ga0501075_0010706 3300049591 Bacteria 6455
638 Ga0501075_0078280 3300049591 Bacteria 2502
639 Ga0501075_0154177 3300049591 Bacteria 1751
640 Ga0501075_0378407 3300049591 Bacteria 1079
641 Ga0501076_0002159 3300049592 Bacteria 13483
642 Ga0501076_0008141 3300049592 Bacteria 7669
643 Ga0501076_0031032 3300049592 Bacteria 4165
644 Ga0501076_0036539 3300049592 Bacteria 3849
645 Ga0501077_0004578 3300049593 Bacteria 8401
646 Ga0501077_0030779 3300049593 Bacteria 3416
647 Ga0501077_0061930 3300049593 Bacteria 2374
648 Ga0501077_0317224 3300049593 Bacteria 994
649 Ga0501077_0424764 3300049593 Bacteria 850
650 Ga0501219_008464 3300049703 Bacteria 753
651 Ga0501079_0002189 3300049741 Bacteria 14087
652 Ga0501079_0008655 3300049741 Bacteria 7719
653 Ga0501079_0011210 3300049741 Bacteria 6838
654 Ga0501079_0218820 3300049741 Bacteria 1488
655 Ga0501079_0415736 3300049741 Bacteria 1055
656 Ga0501080_0009101 3300049742 Bacteria 9039
657 Ga0501080_0022228 3300049742 Bacteria 5875
658 Ga0501080_0030746 3300049742 Bacteria 5003
659 Ga0501080_0129864 3300049742 Bacteria 2332
660 Ga0501080_1105514 3300049742 Bacteria 684
661 Ga0501081_0000359 3300049743 Bacteria 24723
662 Ga0501081_0055340 3300049743 Bacteria 2741
663 Ga0501081_0352592 3300049743 Bacteria 1085
664 Ga0501083_0071631 3300049744 Bacteria 2304
665 Ga0501083_0140138 3300049744 Bacteria 1584
666 Ga0501083_0144745 3300049744 Bacteria 1556
667 Ga0501083_0342322 3300049744 Bacteria 972
668 Ga0501035_0078323 3300049822 Bacteria 2920
669 Ga0501035_0197866 3300049822 Bacteria 1725
670 Ga0501044_0955394 3300049823 Bacteria 730
671 Ga0501045_0025348 3300049824 Bacteria 4262
672 Ga0501045_0037227 3300049824 Bacteria 3536
673 Ga0501045_0096695 3300049824 Bacteria 2185
674 Ga0501045_0116947 3300049824 Bacteria 1979
675 Ga0501045_0185080 3300049824 Bacteria 1552
676 Ga0501045_0674051 3300049824 Bacteria 764
677 nmdc:mga0yw44_619439_c1 3300050492 Bacteria 735
678 nmdc:mga05p37_29644_c1 3300050507 Bacteria 6677
679 nmdc:mga05p37_949333_c1 3300050507 Bacteria 920
680 nmdc:mga09592_360_c1 3300050508 Bacteria 33201
681 nmdc:mga09592_37787_c1 3300050508 Bacteria 4051
682 nmdc:mga09592_503260_c1 3300050508 Bacteria 1043
683 nmdc:mga0qj67_19098_c1 3300050509 Bacteria 5234
684 nmdc:mga0qj67_28506_c1 3300050509 Bacteria 4334
685 nmdc:mga0qj67_40936_c1 3300050509 Bacteria 3643
686 nmdc:mga0qj67_6164_c1 3300050509 Bacteria 8792
687 nmdc:mga06r32_138256_c1 3300050510 Bacteria 2411
688 nmdc:mga06r32_22221_c1 3300050510 Bacteria 5862
689 nmdc:mga06r32_2483_c1 3300050510 Bacteria 16504
690 nmdc:mga06r32_9372_c1 3300050510 Bacteria 8828
691 nmdc:mga08y16_103071_c1 3300050511 Bacteria 2971
692 nmdc:mga08y16_21686_c1 3300050511 Bacteria 6781
693 nmdc:mga08y16_519422_c1 3300050511 Bacteria 1208
694 nmdc:mga08y16_584337_c1 3300050511 Bacteria 1127
695 nmdc:mga08y16_63940_c1 3300050511 Bacteria 3843
696 nmdc:mga0rr50_284275_c1 3300050513 Bacteria 1381
697 nmdc:mga0a205_18127_c1 3300050515 Bacteria 6614
698 Ga0495601_0514807 3300053077 Bacteria 771
699 Ga0500583_0157063 3300053092 Bacteria 1133
700 Ga0500641_0053391 3300053096 Bacteria 1668
701 Ga0500556_0000766 3300053104 Bacteria 19058
702 Ga0500652_164417 3300053131 Bacteria 916
703 Ga0501084_0007709 3300054114 Bacteria 8869
704 Ga0501084_0007827 3300054114 Bacteria 8793
705 Ga0501084_0105628 3300054114 Bacteria 2365
706 Ga0501084_0114844 3300054114 Bacteria 2263
707 Ga0501084_0671119 3300054114 Bacteria 875
708 Ga0501082_0000368 3300060353 Bacteria 39768
709 Ga0501082_0005816 3300060353 Bacteria 10707
710 Ga0501082_0018624 3300060353 Bacteria 5984
711 Ga0501082_0112658 3300060353 Bacteria 2355
712 Ga0501082_0258227 3300060353 Bacteria 1516
713 Ga0501082_0309457 3300060353 Bacteria 1376
714 Ga0466962_0021345 3300061719 Bacteria 3110
715 Ga0466962_0217762 3300061719 Bacteria 935
716 Ga0530510_0000025 3300061734 Bacteria 67946
717 Ga0530510_0029874 3300061734 Bacteria 3913
718 Ga0530510_0031934 3300061734 Bacteria 3786
719 Ga0530510_0179300 3300061734 Bacteria 1571
720 Ga0530510_0718303 3300061734 Bacteria 762
721 Ga0530510_0914008 3300061734 Bacteria 671

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0295487 Ga0451577_0295487_22_516 163
2 3300049571 Ga0501034_0267271 Ga0501034_0267271_34_609 169
3 3300046615 Ga0495656_0418056 Ga0495656_0418056_117_686 170
4 3300035172 Ga0373955_0032310 Ga0373955_0032310_1257_1865 171
5 3300036401 Ga0373937_0018232 Ga0373937_0018232_949_1557 171
6 3300044673 Ga0453683_0008865 Ga0453683_0008865_5670_6308 172
7 3300044712 Ga0453684_0319046 Ga0453684_0319046_835_1473 172
8 3300045051 Ga0451576_0248548 Ga0451576_0248548_1167_1805 172
9 3300005435 Ga0070714_100002469 Ga0070714_10000246911 174
10 3300025929 Ga0207664_10000775 Ga0207664_1000077511 174
11 3300035398 Ga0316574_0621254 Ga0316574_0621254_36_563 174
12 3300048919 Ga0496116_0011339 Ga0496116_0011339_4251_4832 174
13 3300048920 Ga0496117_0072927 Ga0496117_0072927_1657_2238 174
14 3300048929 Ga0496126_0071417 Ga0496126_0071417_2461_3042 174
15 3300035083 Ga0373926_0030472 Ga0373926_0030472_733_1368 176
16 3300035724 Ga0373933_0032118 Ga0373933_0032118_504_1070 176
17 3300005436 Ga0070713_100050204 Ga0070713_1000502043 179
18 3300005439 Ga0070711_100074211 Ga0070711_1000742111 179
19 3300025906 Ga0207699_10045218 Ga0207699_100452181 179
20 3300025916 Ga0207663_10037520 Ga0207663_100375203 179
21 3300025928 Ga0207700_10014832 Ga0207700_100148324 179
22 3300028573 Ga0265334_10000008 Ga0265334_1000000828 179
23 3300028573 Ga0265334_10008371 Ga0265334_100083712 179
24 3300028800 Ga0265338_10030934 Ga0265338_100309345 179
25 3300031241 Ga0265325_10110575 Ga0265325_101105752 179
26 3300031595 Ga0265313_10000807 Ga0265313_100008073 179
27 3300031595 Ga0265313_10016684 Ga0265313_100166843 179
28 3300046517 Ga0495630_0249078 Ga0495630_0249078_149_715 179
29 3300006175 Ga0070712_100062834 Ga0070712_1000628343 180
30 3300025915 Ga0207693_10096623 Ga0207693_100966232 180
31 3300035695 Ga0373927_0000010 Ga0373927_0000010_98116_98682 180
32 iso_pu_bacteria 2740891818 2740993888 182
33 3300005436 Ga0070713_101014263 Ga0070713_1010142631 185
34 3300005614 Ga0068856_100812794 Ga0068856_1008127942 185
35 3300021358 Ga0213873_10077997 Ga0213873_100779971 185
36 3300021384 Ga0213876_10004444 Ga0213876_100044442 185
37 3300021384 Ga0213876_10083935 Ga0213876_100839351 185
38 3300021388 Ga0213875_10020553 Ga0213875_100205535 185
39 3300025929 Ga0207664_10213879 Ga0207664_102138792 185
40 3300026078 Ga0207702_10764864 Ga0207702_107648642 185
41 3300031665 Ga0316575_10062069 Ga0316575_100620692 185
42 3300032168 Ga0316593_10151988 Ga0316593_101519881 185
43 3300037853 Ga0436364_0095069 Ga0436364_0095069_580_1140 185
44 3300037853 Ga0436364_0472331 Ga0436364_0472331_760_1323 185
45 3300037853 Ga0436364_0782091 Ga0436364_0782091_961_1671 185
46 3300037853 Ga0436364_1384597 Ga0436364_1384597_560_1120 185
47 3300037853 Ga0436364_1458736 Ga0436364_1458736_107_667 185
48 3300037853 Ga0436364_1521721 Ga0436364_1521721_14706_15266 185
49 3300039437 Ga0436365_0551274 Ga0436365_0551274_1415_1975 185
50 3300039437 Ga0436365_0985493 Ga0436365_0985493_4951_5514 185
51 3300039437 Ga0436365_1406444 Ga0436365_1406444_6731_7291 185
52 3300039453 Ga0436362_0154526 Ga0436362_0154526_1170_1733 185
53 3300039453 Ga0436362_0621652 Ga0436362_0621652_366_926 185
54 3300042876 Ga0451577_0000195 Ga0451577_0000195_110929_111489 185
55 3300044656 Ga0466969_0125122 Ga0466969_0125122_315_878 185
56 3300044683 Ga0466965_0073005 Ga0466965_0073005_581_1186 185
57 3300044683 Ga0466965_0113651 Ga0466965_0113651_225_800 185
58 3300044693 Ga0466961_0353683 Ga0466961_0353683_100_660 185
59 3300044694 Ga0466963_0001470 Ga0466963_0001470_8988_9593 185
60 3300044694 Ga0466963_0025272 Ga0466963_0025272_89_652 185
61 3300044694 Ga0466963_0165967 Ga0466963_0165967_395_955 185
62 3300044694 Ga0466963_0208457 Ga0466963_0208457_68_628 185
63 3300044694 Ga0466963_0425998 Ga0466963_0425998_99_659 185
64 3300044694 Ga0466963_0495143 Ga0466963_0495143_113_673 185
65 3300044712 Ga0453684_0000017 Ga0453684_0000017_456451_457017 185
66 3300044712 Ga0453684_0000635 Ga0453684_0000635_15968_16528 185
67 3300044712 Ga0453684_0267466 Ga0453684_0267466_626_1192 185
68 3300044719 Ga0466971_0050995 Ga0466971_0050995_318_923 185
69 3300044735 Ga0466968_0051375 Ga0466968_0051375_575_1138 185
70 3300044735 Ga0466968_0080260 Ga0466968_0080260_741_1304 185
71 3300044735 Ga0466968_0134507 Ga0466968_0134507_28_591 185
72 3300044735 Ga0466968_0189850 Ga0466968_0189850_247_810 185
73 3300044735 Ga0466968_0268326 Ga0466968_0268326_145_708 185
74 3300044765 Ga0466970_0016470 Ga0466970_0016470_38_601 185
75 3300044765 Ga0466970_0033911 Ga0466970_0033911_1098_1703 185
76 3300044842 Ga0466957_0039036 Ga0466957_0039036_1867_2472 185
77 3300045049 Ga0466959_0138376 Ga0466959_0138376_1149_1712 185
78 3300045049 Ga0466959_0162928 Ga0466959_0162928_648_1208 185
79 3300045836 Ga0466958_0002260 Ga0466958_0002260_8929_9492 185
80 3300045836 Ga0466958_0011885 Ga0466958_0011885_2698_3303 185
81 3300045836 Ga0466958_0028047 Ga0466958_0028047_1820_2380 185
82 3300045836 Ga0466958_0040257 Ga0466958_0040257_1438_1998 185
83 3300045976 Ga0466967_0007683 Ga0466967_0007683_6115_6720 185
84 3300045976 Ga0466967_0190306 Ga0466967_0190306_387_950 185
85 3300045976 Ga0466967_0846585 Ga0466967_0846585_254_814 185
86 3300045976 Ga0466967_1057445 Ga0466967_1057445_151_711 185
87 3300045976 Ga0466967_1518777 Ga0466967_1518777_85_648 185
88 3300046462 Ga0495651_0366657 Ga0495651_0366657_289_849 185
89 3300046529 Ga0495652_0441204 Ga0495652_0441204_249_809 185
90 3300046559 Ga0495667_0276210 Ga0495667_0276210_321_881 185
91 3300046663 Ga0495635_0576678 Ga0495635_0576678_16_576 185
92 3300046675 Ga0495657_0360552 Ga0495657_0360552_113_673 185
93 3300048918 Ga0496115_0864378 Ga0496115_0864378_85_645 185
94 3300049580 Ga0501046_0394763 Ga0501046_0394763_278_835 185
95 3300049591 Ga0501075_0154177 Ga0501075_0154177_1025_1582 185
96 3300049743 Ga0501081_0352592 Ga0501081_0352592_167_724 185
97 3300061719 Ga0466962_0021345 Ga0466962_0021345_841_1446 185
98 3300061719 Ga0466962_0217762 Ga0466962_0217762_65_625 185
99 3300005290 Ga0065712_10043345 Ga0065712_100433452 186
100 3300005293 Ga0065715_10708533 Ga0065715_107085331 186
101 3300005295 Ga0065707_10081830 Ga0065707_1008183019 186
102 3300005328 Ga0070676_10424221 Ga0070676_104242212 186
103 3300005331 Ga0070670_100244689 Ga0070670_1002446892 186
104 3300005331 Ga0070670_100304224 Ga0070670_1003042242 186
105 3300005333 Ga0070677_10163256 Ga0070677_101632562 186
106 3300005334 Ga0068869_100287374 Ga0068869_1002873742 186
107 3300005334 Ga0068869_100950098 Ga0068869_1009500981 186
108 3300005335 Ga0070666_10003946 Ga0070666_100039462 186
109 3300005336 Ga0070680_100039008 Ga0070680_1000390083 186
110 3300005337 Ga0070682_100513204 Ga0070682_1005132041 186
111 3300005338 Ga0068868_100010077 Ga0068868_1000100772 186
112 3300005340 Ga0070689_101026157 Ga0070689_1010261571 186
113 3300005344 Ga0070661_100402956 Ga0070661_1004029561 186
114 3300005344 Ga0070661_100407410 Ga0070661_1004074101 186
115 3300005345 Ga0070692_10114467 Ga0070692_101144672 186
116 3300005345 Ga0070692_10408415 Ga0070692_104084152 186
117 3300005347 Ga0070668_100016735 Ga0070668_1000167353 186
118 3300005353 Ga0070669_100006860 Ga0070669_1000068603 186
119 3300005354 Ga0070675_100014787 Ga0070675_1000147871 186
120 3300005354 Ga0070675_100107813 Ga0070675_1001078132 186
121 3300005355 Ga0070671_100001122 Ga0070671_1000011224 186
122 3300005355 Ga0070671_100149840 Ga0070671_1001498402 186
123 3300005355 Ga0070671_101058306 Ga0070671_1010583061 186
124 3300005356 Ga0070674_100008237 Ga0070674_1000082372 186
125 3300005356 Ga0070674_101006415 Ga0070674_1010064151 186
126 3300005364 Ga0070673_100162927 Ga0070673_1001629273 186
127 3300005364 Ga0070673_100259696 Ga0070673_1002596962 186
128 3300005367 Ga0070667_100000057 Ga0070667_10000005749 186
129 3300005367 Ga0070667_100003459 Ga0070667_10000345911 186
130 3300005438 Ga0070701_10000431 Ga0070701_100004317 186
131 3300005440 Ga0070705_100434479 Ga0070705_1004344791 186
132 3300005444 Ga0070694_100105738 Ga0070694_1001057382 186
133 3300005444 Ga0070694_100225662 Ga0070694_1002256622 186
134 3300005457 Ga0070662_100001466 Ga0070662_1000014666 186
135 3300005459 Ga0068867_100024206 Ga0068867_1000242063 186
136 3300005535 Ga0070684_100340880 Ga0070684_1003408802 186
137 3300005543 Ga0070672_100002589 Ga0070672_1000025899 186
138 3300005543 Ga0070672_100498998 Ga0070672_1004989982 186
139 3300005543 Ga0070672_100651918 Ga0070672_1006519182 186
140 3300005544 Ga0070686_100006322 Ga0070686_1000063227 186
141 3300005545 Ga0070695_100676633 Ga0070695_1006766332 186
142 3300005548 Ga0070665_100019642 Ga0070665_1000196426 186
143 3300005548 Ga0070665_100087190 Ga0070665_1000871903 186
144 3300005549 Ga0070704_100006386 Ga0070704_1000063866 186
145 3300005549 Ga0070704_100037467 Ga0070704_1000374673 186
146 3300005564 Ga0070664_100005398 Ga0070664_1000053981 186
147 3300005615 Ga0070702_100068038 Ga0070702_1000680383 186
148 3300005616 Ga0068852_100145339 Ga0068852_1001453393 186
149 3300005617 Ga0068859_100031182 Ga0068859_1000311823 186
150 3300005617 Ga0068859_100056395 Ga0068859_1000563954 186
151 3300005617 Ga0068859_100255010 Ga0068859_1002550102 186
152 3300005617 Ga0068859_101028974 Ga0068859_1010289742 186
153 3300005618 Ga0068864_100003919 Ga0068864_1000039194 186
154 3300005618 Ga0068864_100076795 Ga0068864_1000767952 186
155 3300005719 Ga0068861_100054591 Ga0068861_1000545912 186
156 3300005719 Ga0068861_100792627 Ga0068861_1007926272 186
157 3300005840 Ga0068870_10025601 Ga0068870_100256012 186
158 3300005840 Ga0068870_10079413 Ga0068870_100794132 186
159 3300005841 Ga0068863_100001117 Ga0068863_10000111722 186
160 3300005842 Ga0068858_100024492 Ga0068858_1000244925 186
161 3300005842 Ga0068858_100040342 Ga0068858_1000403422 186
162 3300005843 Ga0068860_100036640 Ga0068860_1000366402 186
163 3300005843 Ga0068860_100243968 Ga0068860_1002439682 186
164 3300005844 Ga0068862_100019309 Ga0068862_1000193095 186
165 3300005844 Ga0068862_100218545 Ga0068862_1002185451 186
166 3300006194 Ga0075427_10019405 Ga0075427_100194052 186
167 3300006237 Ga0097621_100023783 Ga0097621_1000237834 186
168 3300006237 Ga0097621_100133484 Ga0097621_1001334842 186
169 3300006358 Ga0068871_100018593 Ga0068871_1000185936 186
170 3300006358 Ga0068871_100095366 Ga0068871_1000953662 186
171 3300006358 Ga0068871_100522531 Ga0068871_1005225312 186
172 3300006844 Ga0075428_100006380 Ga0075428_1000063809 186
173 3300006844 Ga0075428_100007135 Ga0075428_1000071356 186
174 3300006844 Ga0075428_100025918 Ga0075428_1000259184 186
175 3300006844 Ga0075428_100061093 Ga0075428_1000610934 186
176 3300006844 Ga0075428_100126578 Ga0075428_1001265784 186
177 3300006846 Ga0075430_100003451 Ga0075430_1000034515 186
178 3300006846 Ga0075430_100062492 Ga0075430_1000624923 186
179 3300006846 Ga0075430_100219009 Ga0075430_1002190092 186
180 3300006846 Ga0075430_100229917 Ga0075430_1002299172 186
181 3300006846 Ga0075430_100248649 Ga0075430_1002486492 186
182 3300006847 Ga0075431_100015225 Ga0075431_1000152254 186
183 3300006847 Ga0075431_100015713 Ga0075431_1000157135 186
184 3300006847 Ga0075431_100016725 Ga0075431_1000167252 186
185 3300006852 Ga0075433_10012077 Ga0075433_100120774 186
186 3300006880 Ga0075429_100022299 Ga0075429_1000222993 186
187 3300006880 Ga0075429_100063954 Ga0075429_1000639542 186
188 3300006880 Ga0075429_100073706 Ga0075429_1000737062 186
189 3300006881 Ga0068865_100020120 Ga0068865_1000201202 186
190 3300006881 Ga0068865_100329234 Ga0068865_1003292342 186
191 3300006931 Ga0097620_100031181 Ga0097620_1000311814 186
192 3300006931 Ga0097620_100056396 Ga0097620_1000563964 186
193 3300006931 Ga0097620_100255002 Ga0097620_1002550022 186
194 3300006931 Ga0097620_101028990 Ga0097620_1010289902 186
195 3300007076 Ga0075435_100273939 Ga0075435_1002739392 186
196 3300007788 Ga0099795_10000016 Ga0099795_1000001650 186
197 3300009092 Ga0105250_10189431 Ga0105250_101894311 186
198 3300009093 Ga0105240_10000101 Ga0105240_1000010115 186
199 3300009093 Ga0105240_10281241 Ga0105240_102812412 186
200 3300009093 Ga0105240_10344033 Ga0105240_103440331 186
201 3300009094 Ga0111539_10006436 Ga0111539_1000643611 186
202 3300009094 Ga0111539_10006586 Ga0111539_100065864 186
203 3300009094 Ga0111539_10044904 Ga0111539_100449043 186
204 3300009094 Ga0111539_10070320 Ga0111539_100703206 186
205 3300009094 Ga0111539_10190009 Ga0111539_101900092 186
206 3300009098 Ga0105245_10002513 Ga0105245_100025134 186
207 3300009098 Ga0105245_10091944 Ga0105245_100919442 186
208 3300009147 Ga0114129_10000484 Ga0114129_1000048433 186
209 3300009147 Ga0114129_10135002 Ga0114129_101350023 186
210 3300009147 Ga0114129_10318070 Ga0114129_103180702 186
211 3300009147 Ga0114129_10784810 Ga0114129_107848102 186
212 3300009148 Ga0105243_10626727 Ga0105243_106267272 186
213 3300009174 Ga0105241_10194687 Ga0105241_101946871 186
214 3300009176 Ga0105242_10033199 Ga0105242_100331993 186
215 3300009176 Ga0105242_10217876 Ga0105242_102178762 186
216 3300009177 Ga0105248_10046833 Ga0105248_100468333 186
217 3300009177 Ga0105248_10124153 Ga0105248_101241531 186
218 3300009177 Ga0105248_11175915 Ga0105248_111759151 186
219 3300009545 Ga0105237_10245672 Ga0105237_102456721 186
220 3300009551 Ga0105238_10026253 Ga0105238_100262534 186
221 3300009551 Ga0105238_11652782 Ga0105238_116527821 186
222 3300009553 Ga0105249_12107841 Ga0105249_121078411 186
223 3300009984 Ga0105029_102958 Ga0105029_1029582 186
224 3300009987 Ga0105030_100295 Ga0105030_1002952 186
225 3300010159 Ga0099796_10112701 Ga0099796_101127012 186
226 3300010375 Ga0105239_10024104 Ga0105239_100241044 186
227 3300010375 Ga0105239_10924686 Ga0105239_109246862 186
228 3300011119 Ga0105246_10004016 Ga0105246_100040166 186
229 3300011119 Ga0105246_10284653 Ga0105246_102846532 186
230 3300013102 Ga0157371_10357552 Ga0157371_103575522 186
231 3300013296 Ga0157374_10000998 Ga0157374_1000099812 186
232 3300013296 Ga0157374_10012516 Ga0157374_100125166 186
233 3300013297 Ga0157378_10085479 Ga0157378_100854792 186
234 3300013306 Ga0163162_10005163 Ga0163162_100051637 186
235 3300013306 Ga0163162_10129404 Ga0163162_101294042 186
236 3300013308 Ga0157375_10027005 Ga0157375_100270053 186
237 3300013308 Ga0157375_10083926 Ga0157375_100839262 186
238 3300014325 Ga0163163_10001153 Ga0163163_100011535 186
239 3300014325 Ga0163163_10005365 Ga0163163_100053659 186
240 3300014325 Ga0163163_10008089 Ga0163163_100080895 186
241 3300014325 Ga0163163_10029771 Ga0163163_100297713 186
242 3300014325 Ga0163163_10700698 Ga0163163_107006982 186
243 3300014326 Ga0157380_10000204 Ga0157380_1000020411 186
244 3300014326 Ga0157380_10010405 Ga0157380_100104054 186
245 3300014326 Ga0157380_10038954 Ga0157380_100389542 186
246 3300014326 Ga0157380_10062125 Ga0157380_100621254 186
247 3300014326 Ga0157380_10232736 Ga0157380_102327362 186
248 3300014326 Ga0157380_10785351 Ga0157380_107853511 186
249 3300014326 Ga0157380_10954651 Ga0157380_109546512 186
250 3300014745 Ga0157377_10014955 Ga0157377_100149553 186
251 3300014745 Ga0157377_10446375 Ga0157377_104463752 186
252 3300014968 Ga0157379_10004734 Ga0157379_100047345 186
253 3300014968 Ga0157379_10019822 Ga0157379_100198224 186
254 3300014969 Ga0157376_10005590 Ga0157376_100055908 186
255 3300014969 Ga0157376_10019028 Ga0157376_100190282 186
256 3300021384 Ga0213876_10019875 Ga0213876_100198752 186
257 3300025711 Ga0207696_1091905 Ga0207696_10919051 186
258 3300025893 Ga0207682_10080166 Ga0207682_100801662 186
259 3300025899 Ga0207642_10007513 Ga0207642_100075132 186
260 3300025901 Ga0207688_10165595 Ga0207688_101655952 186
261 3300025903 Ga0207680_10003496 Ga0207680_100034964 186
262 3300025903 Ga0207680_10085972 Ga0207680_100859724 186
263 3300025903 Ga0207680_10145208 Ga0207680_101452082 186
264 3300025903 Ga0207680_10934754 Ga0207680_109347541 186
265 3300025907 Ga0207645_10000405 Ga0207645_1000040518 186
266 3300025907 Ga0207645_10391099 Ga0207645_103910992 186
267 3300025908 Ga0207643_10008333 Ga0207643_100083332 186
268 3300025911 Ga0207654_10552732 Ga0207654_105527321 186
269 3300025913 Ga0207695_10078683 Ga0207695_100786832 186
270 3300025913 Ga0207695_10559093 Ga0207695_105590931 186
271 3300025914 Ga0207671_10184152 Ga0207671_101841523 186
272 3300025918 Ga0207662_10717722 Ga0207662_107177221 186
273 3300025920 Ga0207649_10342428 Ga0207649_103424282 186
274 3300025925 Ga0207650_10023090 Ga0207650_100230905 186
275 3300025926 Ga0207659_10019401 Ga0207659_100194011 186
276 3300025927 Ga0207687_10019628 Ga0207687_100196283 186
277 3300025927 Ga0207687_10123810 Ga0207687_101238102 186
278 3300025931 Ga0207644_10038556 Ga0207644_100385562 186
279 3300025932 Ga0207690_10249486 Ga0207690_102494863 186
280 3300025933 Ga0207706_10001790 Ga0207706_100017907 186
281 3300025934 Ga0207686_10097646 Ga0207686_100976462 186
282 3300025936 Ga0207670_10335453 Ga0207670_103354532 186
283 3300025938 Ga0207704_10253500 Ga0207704_102535002 186
284 3300025940 Ga0207691_10001027 Ga0207691_1000102715 186
285 3300025940 Ga0207691_10067881 Ga0207691_100678812 186
286 3300025941 Ga0207711_10002654 Ga0207711_100026543 186
287 3300025942 Ga0207689_10171369 Ga0207689_101713692 186
288 3300025944 Ga0207661_10363375 Ga0207661_103633752 186
289 3300025960 Ga0207651_10038107 Ga0207651_100381072 186
290 3300025960 Ga0207651_10141667 Ga0207651_101416673 186
291 3300025972 Ga0207668_10173980 Ga0207668_101739802 186
292 3300025986 Ga0207658_10000186 Ga0207658_1000018657 186
293 3300025986 Ga0207658_10009925 Ga0207658_100099255 186
294 3300026023 Ga0207677_10011639 Ga0207677_100116392 186
295 3300026023 Ga0207677_10174557 Ga0207677_101745571 186
296 3300026035 Ga0207703_10001486 Ga0207703_1000148610 186
297 3300026035 Ga0207703_10001744 Ga0207703_1000174417 186
298 3300026075 Ga0207708_10026816 Ga0207708_100268166 186
299 3300026075 Ga0207708_10134655 Ga0207708_101346551 186
300 3300026088 Ga0207641_10088617 Ga0207641_100886172 186
301 3300026088 Ga0207641_10222603 Ga0207641_102226032 186
302 3300026089 Ga0207648_10001055 Ga0207648_1000105524 186
303 3300026089 Ga0207648_10073680 Ga0207648_100736803 186
304 3300026095 Ga0207676_10001802 Ga0207676_1000180213 186
305 3300026095 Ga0207676_10037050 Ga0207676_100370502 186
306 3300026116 Ga0207674_11183490 Ga0207674_111834901 186
307 3300026118 Ga0207675_100002054 Ga0207675_10000205410 186
308 3300026118 Ga0207675_100020391 Ga0207675_1000203911 186
309 3300026118 Ga0207675_101326344 Ga0207675_1013263441 186
310 3300026121 Ga0207683_10183379 Ga0207683_101833792 186
311 3300026142 Ga0207698_10044748 Ga0207698_100447482 186
312 3300027512 Ga0209179_1000114 Ga0209179_10001149 186
313 3300027617 Ga0210002_1002615 Ga0210002_10026153 186
314 3300027617 Ga0210002_1013203 Ga0210002_10132032 186
315 3300027665 Ga0209983_1005483 Ga0209983_10054831 186
316 3300027682 Ga0209971_1000201 Ga0209971_100020110 186
317 3300027695 Ga0209966_1021264 Ga0209966_10212642 186
318 3300027717 Ga0209998_10000396 Ga0209998_100003966 186
319 3300027876 Ga0209974_10002740 Ga0209974_100027404 186
320 3300027876 Ga0209974_10053400 Ga0209974_100534002 186
321 3300027907 Ga0207428_10014539 Ga0207428_100145392 186
322 3300027907 Ga0207428_10082979 Ga0207428_100829792 186
323 3300028379 Ga0268266_10032473 Ga0268266_100324732 186
324 3300028379 Ga0268266_10046536 Ga0268266_100465363 186
325 3300028380 Ga0268265_11021922 Ga0268265_110219221 186
326 3300028381 Ga0268264_10012855 Ga0268264_100128554 186
327 3300028381 Ga0268264_10647495 Ga0268264_106474952 186
328 3300028800 Ga0265338_10073443 Ga0265338_100734431 186
329 3300028800 Ga0265338_10367745 Ga0265338_103677451 186
330 3300031247 Ga0265340_10011441 Ga0265340_100114413 186
331 3300031247 Ga0265340_10059055 Ga0265340_100590552 186
332 3300031251 Ga0265327_10000005 Ga0265327_1000000598 186
333 3300031251 Ga0265327_10000098 Ga0265327_100000989 186
334 3300031456 Ga0307513_10075796 Ga0307513_100757963 186
335 3300031507 Ga0307509_10001421 Ga0307509_1000142135 186
336 3300031548 Ga0307408_100056372 Ga0307408_1000563724 186
337 3300031548 Ga0307408_100243512 Ga0307408_1002435122 186
338 3300031548 Ga0307408_101044834 Ga0307408_1010448341 186
339 3300031665 Ga0316575_10000434 Ga0316575_100004345 186
340 3300031665 Ga0316575_10006068 Ga0316575_100060685 186
341 3300031665 Ga0316575_10006908 Ga0316575_100069083 186
342 3300031665 Ga0316575_10011102 Ga0316575_100111024 186
343 3300031665 Ga0316575_10014122 Ga0316575_100141222 186
344 3300031665 Ga0316575_10039087 Ga0316575_100390872 186
345 3300031665 Ga0316575_10108905 Ga0316575_101089052 186
346 3300031665 Ga0316575_10123216 Ga0316575_101232162 186
347 3300031665 Ga0316575_10124053 Ga0316575_101240532 186
348 3300031665 Ga0316575_10203574 Ga0316575_102035741 186
349 3300031691 Ga0316579_10017663 Ga0316579_100176633 186
350 3300031691 Ga0316579_10051329 Ga0316579_100513292 186
351 3300031691 Ga0316579_10102701 Ga0316579_101027012 186
352 3300031691 Ga0316579_10118325 Ga0316579_101183252 186
353 3300031691 Ga0316579_10132037 Ga0316579_101320372 186
354 3300031691 Ga0316579_10190841 Ga0316579_101908411 186
355 3300031727 Ga0316576_10004519 Ga0316576_100045194 186
356 3300031727 Ga0316576_10009417 Ga0316576_100094175 186
357 3300031727 Ga0316576_10012742 Ga0316576_100127424 186
358 3300031727 Ga0316576_10014106 Ga0316576_100141063 186
359 3300031727 Ga0316576_10023890 Ga0316576_100238903 186
360 3300031727 Ga0316576_10045352 Ga0316576_100453525 186
361 3300031727 Ga0316576_10050305 Ga0316576_100503053 186
362 3300031727 Ga0316576_10063498 Ga0316576_100634983 186
363 3300031727 Ga0316576_10071043 Ga0316576_100710433 186
364 3300031727 Ga0316576_10074666 Ga0316576_100746662 186
365 3300031727 Ga0316576_10074865 Ga0316576_100748652 186
366 3300031727 Ga0316576_10113345 Ga0316576_101133452 186
367 3300031727 Ga0316576_10147296 Ga0316576_101472961 186
368 3300031727 Ga0316576_10176524 Ga0316576_101765242 186
369 3300031727 Ga0316576_10227417 Ga0316576_102274172 186
370 3300031727 Ga0316576_10257052 Ga0316576_102570522 186
371 3300031727 Ga0316576_10302135 Ga0316576_103021352 186
372 3300031727 Ga0316576_10307835 Ga0316576_103078351 186
373 3300031727 Ga0316576_10560186 Ga0316576_105601862 186
374 3300031727 Ga0316576_10874747 Ga0316576_108747471 186
375 3300031728 Ga0316578_10000045 Ga0316578_100000452 186
376 3300031728 Ga0316578_10014837 Ga0316578_100148374 186
377 3300031728 Ga0316578_10021669 Ga0316578_100216695 186
378 3300031728 Ga0316578_10029909 Ga0316578_100299092 186
379 3300031728 Ga0316578_10091959 Ga0316578_100919593 186
380 3300031728 Ga0316578_10213479 Ga0316578_102134792 186
381 3300031731 Ga0307405_10016582 Ga0307405_100165822 186
382 3300031733 Ga0316577_10005479 Ga0316577_100054792 186
383 3300031733 Ga0316577_10011805 Ga0316577_100118053 186
384 3300031733 Ga0316577_10015548 Ga0316577_100155482 186
385 3300031733 Ga0316577_10018147 Ga0316577_100181473 186
386 3300031733 Ga0316577_10021930 Ga0316577_100219301 186
387 3300031733 Ga0316577_10053984 Ga0316577_100539842 186
388 3300031733 Ga0316577_10098927 Ga0316577_100989272 186
389 3300031733 Ga0316577_10102366 Ga0316577_101023661 186
390 3300031733 Ga0316577_10157442 Ga0316577_101574421 186
391 3300031733 Ga0316577_10158405 Ga0316577_101584052 186
392 3300031824 Ga0307413_10087136 Ga0307413_100871363 186
393 3300031852 Ga0307410_10117924 Ga0307410_101179242 186
394 3300031852 Ga0307410_10534514 Ga0307410_105345141 186
395 3300031901 Ga0307406_10280103 Ga0307406_102801031 186
396 3300031911 Ga0307412_10063121 Ga0307412_100631213 186
397 3300031911 Ga0307412_10461548 Ga0307412_104615482 186
398 3300031995 Ga0307409_100005677 Ga0307409_1000056774 186
399 3300031995 Ga0307409_100284382 Ga0307409_1002843822 186
400 3300032002 Ga0307416_100137802 Ga0307416_1001378023 186
401 3300032002 Ga0307416_101174864 Ga0307416_1011748642 186
402 3300032126 Ga0307415_100001848 Ga0307415_1000018482 186
403 3300032133 Ga0316583_10008392 Ga0316583_100083922 186
404 3300032133 Ga0316583_10031567 Ga0316583_100315671 186
405 3300032133 Ga0316583_10031610 Ga0316583_100316102 186
406 3300032133 Ga0316583_10037455 Ga0316583_100374552 186
407 3300032133 Ga0316583_10039661 Ga0316583_100396612 186
408 3300032133 Ga0316583_10073060 Ga0316583_100730602 186
409 3300032137 Ga0316585_10004539 Ga0316585_100045393 186
410 3300032137 Ga0316585_10008553 Ga0316585_100085532 186
411 3300032137 Ga0316585_10022801 Ga0316585_100228012 186
412 3300032137 Ga0316585_10060090 Ga0316585_100600902 186
413 3300032137 Ga0316585_10070034 Ga0316585_100700341 186
414 3300032137 Ga0316585_10075987 Ga0316585_100759872 186
415 3300032137 Ga0316585_10093628 Ga0316585_100936282 186
416 3300032139 Ga0316580_10000990 Ga0316580_100009902 186
417 3300032139 Ga0316580_10002043 Ga0316580_100020432 186
418 3300032139 Ga0316580_10005631 Ga0316580_100056313 186
419 3300032139 Ga0316580_10014022 Ga0316580_100140222 186
420 3300032139 Ga0316580_10014141 Ga0316580_100141412 186
421 3300032139 Ga0316580_10032209 Ga0316580_100322092 186
422 3300032139 Ga0316580_10117113 Ga0316580_101171131 186
423 3300032168 Ga0316593_10038658 Ga0316593_100386582 186
424 3300032168 Ga0316593_10041535 Ga0316593_100415352 186
425 3300032168 Ga0316593_10133842 Ga0316593_101338422 186
426 3300032168 Ga0316593_10151807 Ga0316593_101518072 186
427 3300033524 Ga0316592_1002612 Ga0316592_10026123 186
428 3300033524 Ga0316592_1005685 Ga0316592_10056852 186
429 3300033524 Ga0316592_1008935 Ga0316592_10089352 186
430 3300033524 Ga0316592_1022851 Ga0316592_10228512 186
431 3300033524 Ga0316592_1030401 Ga0316592_10304012 186
432 3300033524 Ga0316592_1044878 Ga0316592_10448782 186
433 3300033527 Ga0316586_1002622 Ga0316586_10026222 186
434 3300033527 Ga0316586_1008710 Ga0316586_10087102 186
435 3300033527 Ga0316586_1043149 Ga0316586_10431491 186
436 3300033528 Ga0316588_1014477 Ga0316588_10144772 186
437 3300033528 Ga0316588_1023579 Ga0316588_10235792 186
438 3300033528 Ga0316588_1032334 Ga0316588_10323342 186
439 3300033528 Ga0316588_1052625 Ga0316588_10526251 186
440 3300033529 Ga0316587_1053063 Ga0316587_10530631 186
441 3300033541 Ga0316596_1003576 Ga0316596_10035763 186
442 3300033541 Ga0316596_1039416 Ga0316596_10394161 186
443 3300033541 Ga0316596_1052025 Ga0316596_10520251 186
444 3300033541 Ga0316596_1149458 Ga0316596_11494581 186
445 3300033541 Ga0316596_1155787 Ga0316596_11557871 186
446 3300035241 Ga0373961_0046137 Ga0373961_0046137_376_981 186
447 3300035398 Ga0316574_0000421 Ga0316574_0000421_10262_10831 186
448 3300035398 Ga0316574_0001360 Ga0316574_0001360_10814_11377 186
449 3300035398 Ga0316574_0006599 Ga0316574_0006599_503_1072 186
450 3300035398 Ga0316574_0009475 Ga0316574_0009475_4482_5054 186
451 3300035398 Ga0316574_0019775 Ga0316574_0019775_321_890 186
452 3300035398 Ga0316574_0020832 Ga0316574_0020832_112_678 186
453 3300035398 Ga0316574_0035364 Ga0316574_0035364_696_1259 186
454 3300035398 Ga0316574_0065558 Ga0316574_0065558_330_902 186
455 3300035398 Ga0316574_0091297 Ga0316574_0091297_670_1239 186
456 3300035398 Ga0316574_0101862 Ga0316574_0101862_638_1204 186
457 3300035398 Ga0316574_0180963 Ga0316574_0180963_695_1258 186
458 3300035398 Ga0316574_0199949 Ga0316574_0199949_541_1107 186
459 3300035398 Ga0316574_0485208 Ga0316574_0485208_42_614 186
460 3300035691 Ga0373931_0396110 Ga0373931_0396110_191_760 186
461 3300035695 Ga0373927_0206284 Ga0373927_0206284_11_580 186
462 3300036401 Ga0373937_0033260 Ga0373937_0033260_215_784 186
463 3300036401 Ga0373937_0137044 Ga0373937_0137044_1178_1747 186
464 3300036401 Ga0373937_0281635 Ga0373937_0281635_314_880 186
465 3300036401 Ga0373937_1523114 Ga0373937_1523114_17_583 186
466 3300036647 Ga0316582_0002483 Ga0316582_0002483_7569_8132 186
467 3300036647 Ga0316582_0013924 Ga0316582_0013924_236_808 186
468 3300036647 Ga0316582_0020709 Ga0316582_0020709_2675_3238 186
469 3300036647 Ga0316582_0038093 Ga0316582_0038093_2392_2955 186
470 3300036647 Ga0316582_0039759 Ga0316582_0039759_1221_1784 186
471 3300036647 Ga0316582_0066851 Ga0316582_0066851_27_590 186
472 3300036647 Ga0316582_0067366 Ga0316582_0067366_1649_2221 186
473 3300036647 Ga0316582_0112197 Ga0316582_0112197_1026_1595 186
474 3300036647 Ga0316582_0129449 Ga0316582_0129449_1052_1615 186
475 3300036647 Ga0316582_0220749 Ga0316582_0220749_176_736 186
476 3300036647 Ga0316582_0396960 Ga0316582_0396960_86_649 186
477 3300036647 Ga0316582_0429823 Ga0316582_0429823_301_861 186
478 3300036647 Ga0316582_0799790 Ga0316582_0799790_66_629 186
479 3300036712 Ga0316584_0004581 Ga0316584_0004581_6468_7028 186
480 3300036712 Ga0316584_0009145 Ga0316584_0009145_5866_6438 186
481 3300036712 Ga0316584_0011037 Ga0316584_0011037_2269_2841 186
482 3300036712 Ga0316584_0015880 Ga0316584_0015880_2920_3528 186
483 3300036712 Ga0316584_0016629 Ga0316584_0016629_928_1500 186
484 3300036712 Ga0316584_0018538 Ga0316584_0018538_1727_2290 186
485 3300036712 Ga0316584_0022323 Ga0316584_0022323_3471_4031 186
486 3300036712 Ga0316584_0024910 Ga0316584_0024910_3618_4181 186
487 3300036712 Ga0316584_0033854 Ga0316584_0033854_3046_3615 186
488 3300036712 Ga0316584_0054156 Ga0316584_0054156_1494_2057 186
489 3300036712 Ga0316584_0070531 Ga0316584_0070531_2026_2598 186
490 3300036712 Ga0316584_0087967 Ga0316584_0087967_1256_1825 186
491 3300036712 Ga0316584_0132967 Ga0316584_0132967_416_988 186
492 3300036712 Ga0316584_0149188 Ga0316584_0149188_688_1251 186
493 3300036712 Ga0316584_0224506 Ga0316584_0224506_758_1321 186
494 3300036712 Ga0316584_0263823 Ga0316584_0263823_548_1114 186
495 3300036712 Ga0316584_0335186 Ga0316584_0335186_78_641 186
496 3300037588 Ga0316581_0013894 Ga0316581_0013894_126_698 186
497 3300037588 Ga0316581_0082354 Ga0316581_0082354_212_775 186
498 3300038725 Ga0400484_09769 Ga0400484_09769_5922_6485 186
499 3300038725 Ga0400484_35465 Ga0400484_35465_13281_13844 186
500 3300038726 Ga0400490_06983 Ga0400490_06983_180_743 186
501 3300038726 Ga0400490_11650 Ga0400490_11650_1539_2102 186
502 3300038726 Ga0400490_16309 Ga0400490_16309_897_1460 186
503 3300038726 Ga0400490_35540 Ga0400490_35540_27933_28496 186
504 3300038735 Ga0400485_08473 Ga0400485_08473_171_734 186
505 3300038735 Ga0400485_09701 Ga0400485_09701_275_838 186
506 3300038735 Ga0400485_13509 Ga0400485_13509_14477_15040 186
507 3300038741 Ga0400488_25302 Ga0400488_25302_3658_4221 186
508 3300038741 Ga0400488_53784 Ga0400488_53784_6340_6903 186
509 3300038741 Ga0400488_53787 Ga0400488_53787_34_597 186
510 3300038742 Ga0400486_16046 Ga0400486_16046_847_1449 186
511 3300038742 Ga0400486_26096 Ga0400486_26096_47414_47977 186
512 3300038742 Ga0400486_30859 Ga0400486_30859_3533_4096 186
513 3300039062 Ga0400483_005648 Ga0400483_005648_13652_14215 186
514 3300039062 Ga0400483_029989 Ga0400483_029989_40691_41263 186
515 3300039062 Ga0400483_242281 Ga0400483_242281_51592_52164 186
516 3300039062 Ga0400483_252490 Ga0400483_252490_507_1070 186
517 3300039062 Ga0400483_269206 Ga0400483_269206_64316_64879 186
518 3300039093 Ga0400489_35275 Ga0400489_35275_16173_16736 186
519 3300039093 Ga0400489_55657 Ga0400489_55657_12573_13136 186
520 3300039093 Ga0400489_68375 Ga0400489_68375_6199_6810 186
521 3300039093 Ga0400489_76049 Ga0400489_76049_413_976 186
522 3300039110 Ga0400487_46349 Ga0400487_46349_1112_1675 186
523 3300039437 Ga0436365_1224743 Ga0436365_1224743_3095_3664 186
524 3300039450 Ga0436363_0997300 Ga0436363_0997300_2849_3481 186
525 3300039453 Ga0436362_1108905 Ga0436362_1108905_2386_3009 186
526 3300041410 Ga0439461_0016797 Ga0439461_0016797_830_1396 186
527 3300041997 Ga0439431_0185873 Ga0439431_0185873_17_583 186
528 3300042003 Ga0439443_000428 Ga0439443_000428_2268_2894 186
529 3300042122 Ga0450920_002953 Ga0450920_002953_176_742 186
530 3300042133 Ga0450896_007368 Ga0450896_007368_687_1253 186
531 3300042135 Ga0450899_037656 Ga0450899_037656_21_587 186
532 3300042145 Ga0450906_014059 Ga0450906_014059_733_1299 186
533 3300042147 Ga0450910_024919 Ga0450910_024919_36_662 186
534 3300042156 Ga0439446_0014380 Ga0439446_0014380_76_642 186
535 3300042184 Ga0450908_009560 Ga0450908_009560_959_1585 186
536 3300042435 Ga0439434_0031556 Ga0439434_0031556_1011_1577 186
537 3300042435 Ga0439434_0127105 Ga0439434_0127105_172_738 186
538 3300042436 Ga0439435_0025063 Ga0439435_0025063_72_698 186
539 3300042439 Ga0439464_0065427 Ga0439464_0065427_444_1013 186
540 3300042530 Ga0450916_015540 Ga0450916_015540_154_720 186
541 3300042531 Ga0450918_006465 Ga0450918_006465_815_1381 186
542 3300042532 Ga0450893_0013123 Ga0450893_0013123_338_907 186
543 3300042532 Ga0450893_0095757 Ga0450893_0095757_16_585 186
544 3300044673 Ga0453683_0003297 Ga0453683_0003297_6465_7028 186
545 3300044712 Ga0453684_0000036 Ga0453684_0000036_416123_416689 186
546 3300044712 Ga0453684_0123258 Ga0453684_0123258_1145_1708 186
547 3300044712 Ga0453684_0445675 Ga0453684_0445675_106_675 186
548 3300045051 Ga0451576_1029938 Ga0451576_1029938_67_672 186
549 3300046455 Ga0495603_0008315 Ga0495603_0008315_4195_4764 186
550 3300046455 Ga0495603_0089474 Ga0495603_0089474_72_638 186
551 3300046457 Ga0495590_0044441 Ga0495590_0044441_248_817 186
552 3300046460 Ga0495638_0032047 Ga0495638_0032047_288_857 186
553 3300046473 Ga0495582_0565145 Ga0495582_0565145_28_594 186
554 3300046501 Ga0495607_0275241 Ga0495607_0275241_79_645 186
555 3300046517 Ga0495630_0462120 Ga0495630_0462120_353_922 186
556 3300046530 Ga0495654_0086515 Ga0495654_0086515_527_1093 186
557 3300046535 Ga0495586_0011357 Ga0495586_0011357_262_834 186
558 3300046539 Ga0495621_0000098 Ga0495621_0000098_10700_11266 186
559 3300046542 Ga0495597_0199030 Ga0495597_0199030_82_654 186
560 3300046615 Ga0495656_0080458 Ga0495656_0080458_388_954 186
561 3300046642 Ga0495634_0138229 Ga0495634_0138229_765_1334 186
562 3300046648 Ga0495611_0085346 Ga0495611_0085346_664_1236 186
563 3300046681 Ga0495647_0018427 Ga0495647_0018427_1855_2421 186
564 3300046681 Ga0495647_0158842 Ga0495647_0158842_202_771 186
565 3300046683 Ga0495658_0027956 Ga0495658_0027956_1353_1919 186
566 3300046691 Ga0495670_0204618 Ga0495670_0204618_279_845 186
567 3300046692 Ga0495671_0004008 Ga0495671_0004008_2451_3020 186
568 3300047469 Ga0495673_0119506 Ga0495673_0119506_272_841 186
569 3300047470 Ga0495681_0139306 Ga0495681_0139306_312_878 186
570 3300048907 Ga0496104_0001449 Ga0496104_0001449_2303_2872 186
571 3300048908 Ga0496105_0001567 Ga0496105_0001567_3390_3959 186
572 3300048911 Ga0496108_0028591 Ga0496108_0028591_1663_2232 186
573 3300048911 Ga0496108_0103094 Ga0496108_0103094_691_1260 186
574 3300048912 Ga0496109_0012615 Ga0496109_0012615_4636_5205 186
575 3300048912 Ga0496109_0032320 Ga0496109_0032320_3869_4474 186
576 3300048914 Ga0496111_0002880 Ga0496111_0002880_144_713 186
577 3300048915 Ga0496112_0001440 Ga0496112_0001440_7128_7733 186
578 3300048916 Ga0496113_0034515 Ga0496113_0034515_405_974 186
579 3300048916 Ga0496113_0276979 Ga0496113_0276979_138_707 186
580 3300048917 Ga0496114_0000244 Ga0496114_0000244_2169_2735 186
581 3300048918 Ga0496115_0040651 Ga0496115_0040651_606_1214 186
582 3300048920 Ga0496117_0163096 Ga0496117_0163096_381_1019 186
583 3300049568 Ga0501031_0039301 Ga0501031_0039301_1971_2540 186
584 3300049569 Ga0501032_0252420 Ga0501032_0252420_88_654 186
585 3300049571 Ga0501034_0289008 Ga0501034_0289008_557_1132 186
586 3300049572 Ga0501036_0007849 Ga0501036_0007849_6893_7462 186
587 3300049572 Ga0501036_0151126 Ga0501036_0151126_341_907 186
588 3300049572 Ga0501036_0680824 Ga0501036_0680824_248_817 186
589 3300049573 Ga0501037_0197202 Ga0501037_0197202_163_732 186
590 3300049573 Ga0501037_0317145 Ga0501037_0317145_168_737 186
591 3300049573 Ga0501037_0559223 Ga0501037_0559223_101_667 186
592 3300049574 Ga0501038_0019453 Ga0501038_0019453_4267_4911 186
593 3300049574 Ga0501038_0028666 Ga0501038_0028666_1871_2440 186
594 3300049575 Ga0501039_0003853 Ga0501039_0003853_6783_7352 186
595 3300049575 Ga0501039_0028077 Ga0501039_0028077_2247_2816 186
596 3300049575 Ga0501039_0207631 Ga0501039_0207631_408_974 186
597 3300049575 Ga0501039_0363304 Ga0501039_0363304_335_904 186
598 3300049576 Ga0501040_0000023 Ga0501040_0000023_40155_40724 186
599 3300049576 Ga0501040_0001206 Ga0501040_0001206_5495_6064 186
600 3300049576 Ga0501040_0015429 Ga0501040_0015429_4294_4863 186
601 3300049576 Ga0501040_0076176 Ga0501040_0076176_356_925 186
602 3300049576 Ga0501040_0184312 Ga0501040_0184312_120_689 186
603 3300049576 Ga0501040_0245839 Ga0501040_0245839_471_1037 186
604 3300049576 Ga0501040_0385437 Ga0501040_0385437_281_850 186
605 3300049577 Ga0501041_0001968 Ga0501041_0001968_8301_8870 186
606 3300049577 Ga0501041_0007930 Ga0501041_0007930_3801_4445 186
607 3300049577 Ga0501041_0031523 Ga0501041_0031523_2446_3015 186
608 3300049577 Ga0501041_0250870 Ga0501041_0250870_449_1015 186
609 3300049578 Ga0501042_0000263 Ga0501042_0000263_9346_9915 186
610 3300049578 Ga0501042_0000931 Ga0501042_0000931_8677_9246 186
611 3300049578 Ga0501042_0761393 Ga0501042_0761393_111_680 186
612 3300049578 Ga0501042_0782791 Ga0501042_0782791_87_656 186
613 3300049579 Ga0501043_0061394 Ga0501043_0061394_1790_2359 186
614 3300049580 Ga0501046_0011112 Ga0501046_0011112_1623_2192 186
615 3300049580 Ga0501046_0128320 Ga0501046_0128320_790_1359 186
616 3300049580 Ga0501046_0238421 Ga0501046_0238421_344_913 186
617 3300049582 Ga0501048_0011120 Ga0501048_0011120_2415_2984 186
618 3300049582 Ga0501048_0437559 Ga0501048_0437559_244_813 186
619 3300049582 Ga0501048_0602687 Ga0501048_0602687_137_703 186
620 3300049584 Ga0501068_0000860 Ga0501068_0000860_12965_13534 186
621 3300049584 Ga0501068_0064121 Ga0501068_0064121_751_1320 186
622 3300049584 Ga0501068_0164144 Ga0501068_0164144_47_616 186
623 3300049585 Ga0501069_0099195 Ga0501069_0099195_1022_1591 186
624 3300049586 Ga0501070_0340121 Ga0501070_0340121_610_1176 186
625 3300049587 Ga0501071_0006996 Ga0501071_0006996_1401_1970 186
626 3300049587 Ga0501071_0014535 Ga0501071_0014535_3881_4447 186
627 3300049587 Ga0501071_0149593 Ga0501071_0149593_868_1437 186
628 3300049587 Ga0501071_0862456 Ga0501071_0862456_31_597 186
629 3300049588 Ga0501072_0001665 Ga0501072_0001665_14779_15348 186
630 3300049588 Ga0501072_0024666 Ga0501072_0024666_3392_4036 186
631 3300049588 Ga0501072_0062383 Ga0501072_0062383_1379_1948 186
632 3300049588 Ga0501072_0248757 Ga0501072_0248757_181_747 186
633 3300049588 Ga0501072_0267261 Ga0501072_0267261_307_873 186
634 3300049589 Ga0501073_0105511 Ga0501073_0105511_264_833 186
635 3300049589 Ga0501073_0123504 Ga0501073_0123504_45_611 186
636 3300049589 Ga0501073_0312341 Ga0501073_0312341_323_889 186
637 3300049589 Ga0501073_0490057 Ga0501073_0490057_110_754 186
638 3300049590 Ga0501074_0124231 Ga0501074_0124231_586_1155 186
639 3300049590 Ga0501074_0523337 Ga0501074_0523337_47_613 186
640 3300049591 Ga0501075_0000858 Ga0501075_0000858_14200_14769 186
641 3300049591 Ga0501075_0010706 Ga0501075_0010706_2208_2777 186
642 3300049591 Ga0501075_0078280 Ga0501075_0078280_1366_2010 186
643 3300049591 Ga0501075_0378407 Ga0501075_0378407_323_889 186
644 3300049592 Ga0501076_0002159 Ga0501076_0002159_3977_4546 186
645 3300049592 Ga0501076_0008141 Ga0501076_0008141_1916_2485 186
646 3300049592 Ga0501076_0031032 Ga0501076_0031032_3319_3888 186
647 3300049592 Ga0501076_0036539 Ga0501076_0036539_1645_2214 186
648 3300049593 Ga0501077_0004578 Ga0501077_0004578_3436_4005 186
649 3300049593 Ga0501077_0030779 Ga0501077_0030779_485_1054 186
650 3300049593 Ga0501077_0061930 Ga0501077_0061930_1782_2348 186
651 3300049593 Ga0501077_0317224 Ga0501077_0317224_127_696 186
652 3300049593 Ga0501077_0424764 Ga0501077_0424764_159_725 186
653 3300049703 Ga0501219_008464 Ga0501219_008464_65_634 186
654 3300049741 Ga0501079_0002189 Ga0501079_0002189_9956_10525 186
655 3300049741 Ga0501079_0008655 Ga0501079_0008655_5841_6410 186
656 3300049741 Ga0501079_0011210 Ga0501079_0011210_4013_4582 186
657 3300049741 Ga0501079_0218820 Ga0501079_0218820_382_951 186
658 3300049741 Ga0501079_0415736 Ga0501079_0415736_475_1044 186
659 3300049742 Ga0501080_0009101 Ga0501080_0009101_8226_8795 186
660 3300049742 Ga0501080_0022228 Ga0501080_0022228_5243_5809 186
661 3300049742 Ga0501080_0030746 Ga0501080_0030746_4388_4957 186
662 3300049742 Ga0501080_0129864 Ga0501080_0129864_1456_2025 186
663 3300049742 Ga0501080_1105514 Ga0501080_1105514_84_653 186
664 3300049743 Ga0501081_0000359 Ga0501081_0000359_16929_17498 186
665 3300049743 Ga0501081_0055340 Ga0501081_0055340_1102_1671 186
666 3300049744 Ga0501083_0071631 Ga0501083_0071631_930_1499 186
667 3300049744 Ga0501083_0140138 Ga0501083_0140138_791_1483 186
668 3300049744 Ga0501083_0144745 Ga0501083_0144745_181_747 186
669 3300049744 Ga0501083_0342322 Ga0501083_0342322_33_602 186
670 3300049822 Ga0501035_0078323 Ga0501035_0078323_40_609 186
671 3300049822 Ga0501035_0197866 Ga0501035_0197866_271_840 186
672 3300049823 Ga0501044_0955394 Ga0501044_0955394_92_661 186
673 3300049824 Ga0501045_0025348 Ga0501045_0025348_2047_2616 186
674 3300049824 Ga0501045_0037227 Ga0501045_0037227_792_1361 186
675 3300049824 Ga0501045_0096695 Ga0501045_0096695_550_1119 186
676 3300049824 Ga0501045_0116947 Ga0501045_0116947_45_614 186
677 3300049824 Ga0501045_0185080 Ga0501045_0185080_193_762 186
678 3300049824 Ga0501045_0674051 Ga0501045_0674051_156_722 186
679 3300050492 nmdc:mga0yw44_619439_c1 nmdc:mga0yw44_619439_c1_120_725 186
680 3300050507 nmdc:mga05p37_29644_c1 nmdc:mga05p37_29644_c1_1566_2135 186
681 3300050507 nmdc:mga05p37_949333_c1 nmdc:mga05p37_949333_c1_205_774 186
682 3300050508 nmdc:mga09592_360_c1 nmdc:mga09592_360_c1_375_944 186
683 3300050508 nmdc:mga09592_37787_c1 nmdc:mga09592_37787_c1_2222_2791 186
684 3300050508 nmdc:mga09592_503260_c1 nmdc:mga09592_503260_c1_187_756 186
685 3300050509 nmdc:mga0qj67_19098_c1 nmdc:mga0qj67_19098_c1_131_700 186
686 3300050509 nmdc:mga0qj67_28506_c1 nmdc:mga0qj67_28506_c1_1601_2170 186
687 3300050509 nmdc:mga0qj67_40936_c1 nmdc:mga0qj67_40936_c1_1211_1780 186
688 3300050509 nmdc:mga0qj67_6164_c1 nmdc:mga0qj67_6164_c1_1347_1916 186
689 3300050510 nmdc:mga06r32_138256_c1 nmdc:mga06r32_138256_c1_1309_1878 186
690 3300050510 nmdc:mga06r32_22221_c1 nmdc:mga06r32_22221_c1_4385_4954 186
691 3300050510 nmdc:mga06r32_2483_c1 nmdc:mga06r32_2483_c1_3281_3850 186
692 3300050510 nmdc:mga06r32_9372_c1 nmdc:mga06r32_9372_c1_7297_7866 186
693 3300050511 nmdc:mga08y16_103071_c1 nmdc:mga08y16_103071_c1_383_952 186
694 3300050511 nmdc:mga08y16_21686_c1 nmdc:mga08y16_21686_c1_2248_2814 186
695 3300050511 nmdc:mga08y16_519422_c1 nmdc:mga08y16_519422_c1_118_687 186
696 3300050511 nmdc:mga08y16_584337_c1 nmdc:mga08y16_584337_c1_245_814 186
697 3300050511 nmdc:mga08y16_63940_c1 nmdc:mga08y16_63940_c1_1986_2555 186
698 3300050513 nmdc:mga0rr50_284275_c1 nmdc:mga0rr50_284275_c1_227_796 186
699 3300050515 nmdc:mga0a205_18127_c1 nmdc:mga0a205_18127_c1_1075_1683 186
700 3300053077 Ga0495601_0514807 Ga0495601_0514807_124_693 186
701 3300053092 Ga0500583_0157063 Ga0500583_0157063_257_826 186
702 3300053096 Ga0500641_0053391 Ga0500641_0053391_71_640 186
703 3300053104 Ga0500556_0000766 Ga0500556_0000766_393_965 186
704 3300053131 Ga0500652_164417 Ga0500652_164417_124_693 186
705 3300054114 Ga0501084_0007709 Ga0501084_0007709_7498_8067 186
706 3300054114 Ga0501084_0007827 Ga0501084_0007827_1052_1696 186
707 3300054114 Ga0501084_0105628 Ga0501084_0105628_1782_2348 186
708 3300054114 Ga0501084_0114844 Ga0501084_0114844_421_990 186
709 3300054114 Ga0501084_0671119 Ga0501084_0671119_55_624 186
710 3300060353 Ga0501082_0000368 Ga0501082_0000368_34850_35419 186
711 3300060353 Ga0501082_0005816 Ga0501082_0005816_8868_9437 186
712 3300060353 Ga0501082_0018624 Ga0501082_0018624_1451_2020 186
713 3300060353 Ga0501082_0112658 Ga0501082_0112658_774_1340 186
714 3300060353 Ga0501082_0258227 Ga0501082_0258227_14_580 186
715 3300060353 Ga0501082_0309457 Ga0501082_0309457_605_1171 186
716 3300061734 Ga0530510_0000025 Ga0530510_0000025_22374_22943 186
717 3300061734 Ga0530510_0029874 Ga0530510_0029874_2191_2760 186
718 3300061734 Ga0530510_0031934 Ga0530510_0031934_2966_3535 186
719 3300061734 Ga0530510_0179300 Ga0530510_0179300_654_1220 186
720 3300061734 Ga0530510_0718303 Ga0530510_0718303_17_586 186
721 3300061734 Ga0530510_0914008 Ga0530510_0914008_76_645 186
722 3300003316 rootH1_10164463 rootH1_101644632 187

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09285

Elong-fact-P_C

Elongation factor P, C-terminal

131

186

0.99

PF08207

EFP_N

Elongation factor P (EF-P) KOW-like domain

5

62

0.98

PF01132

EFP

Elongation factor P (EF-P) OB domain

70

123

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.9416 1 59
3a5z-assembly2.cif.gz_F crystal structure of escherichia coli genx in complex with elongation factor p 0.9268 1 59
4v6a-assembly2.cif.gz_CV structure of ef-p bound to the 70s ribosome. 0.9106 1 186
1ueb-assembly1.cif.gz_A crystal structure of translation elongation factor p from thermus thermophilus hb8 0.9096 1 186
4v6a-assembly2.cif.gz_CV structure of ef-p bound to the 70s ribosome. 0.9058 1 186
ID Description Score Start End Superfamily
5j3bA03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9704 130 186 2.40.50.140
3a5zF01 Mainly Beta;Roll;SH3 type barrels.; 0.9647 12 56 2.30.30.30
5j3bB01 Mainly Beta;Roll;SH3 type barrels.; 0.9587 1 62 2.30.30.30
af_Q2QYK4_39_108_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.9587 2 62 2.30.30.30
1ybyB03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.951 130 186 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A4Q3TGV3-F1-model_v4 deleted 0.9678 80 187
AF-A0A4Q3TGV3-F1-model_v4 deleted 0.959 80 187
AF-A0A3D4ISU4-F1-model_v4 Elongation factor P 0.9541 68 187 GO:0003746
GO:0005737
GO:0043043
AF-A0A7X8W8K1-F1-model_v4 Elongation factor P 0.9541 83 187 GO:0003746
GO:0005737
GO:0043043
AF-A0A7Y6PPL6-F1-model_v4 Elongation factor P 0.951 63 187 GO:0003746
GO:0005737
GO:0043043

Feature Viewer

pLDDT pTM Quality
92.74 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map