F477453
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 722 | 316 | 721 | 189 |
Family's Representative Sequence
| Representative Sequence | 3300049744|Ga0501083_0140138|Ga0501083_0140138_791_1483 |
| Length | 230 |
| Sequence | MASYSTNEFRSGLKILMDGDPYAIVENEFVKPGKGQAFNRVKVRNLKTGRVIERTFKSGETVEAADVVDTEMQYLYTDGDFWHFMVPENFEQYVAGKAVVGDGAIWLKDGDVCIITLWNNVPLVVTPPAHVELKVIETDPGVRGDTATGGQKPAKLETGAVVRVPLFINEGEVIRVDTRTGAYISRAKQQADVSRSFPNSLPDAAVLVEMQLAPVGVSVRDCYGHLPGAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2740891818 | Desulfofaba hansenii DSM 12642 | Isolate | Unclassified |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 63 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 76 | 3300009987 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 93 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 151 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 154 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 155 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 156 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 157 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 158 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 159 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 160 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 161 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 163 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 166 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 171 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 172 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 173 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 178 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 179 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 180 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 188 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 189 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 190 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 191 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 192 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 193 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 194 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 195 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 196 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 197 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 198 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 199 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 202 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 203 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 204 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 205 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 206 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 207 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 208 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 209 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 210 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 211 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 212 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 213 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 214 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 215 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 216 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 217 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 222 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 223 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 224 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 225 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 226 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 227 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 228 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 229 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 230 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 231 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 232 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 233 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 262 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 267 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 293 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 301 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 310 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 311 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 312 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 313 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 316 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.54 |
| Metatranscriptomes | 3.32 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.69 |
| Nodule | 0 |
| Rhizoplane | 1.8 |
| Rhizosphere | 90.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10164463 | 3300003316 | Bacteria | 1143 |
| 2 | Ga0065712_10043345 | 3300005290 | Bacteria | 822 |
| 3 | Ga0065715_10708533 | 3300005293 | Bacteria | 649 |
| 4 | Ga0065707_10081830 | 3300005295 | Bacteria | 35453 |
| 5 | Ga0070676_10424221 | 3300005328 | Bacteria | 930 |
| 6 | Ga0070670_100244689 | 3300005331 | Bacteria | 1562 |
| 7 | Ga0070670_100304224 | 3300005331 | Bacteria | 1395 |
| 8 | Ga0070677_10163256 | 3300005333 | Bacteria | 1047 |
| 9 | Ga0068869_100287374 | 3300005334 | Bacteria | 1324 |
| 10 | Ga0068869_100950098 | 3300005334 | Bacteria | 746 |
| 11 | Ga0070666_10003946 | 3300005335 | Bacteria | 9008 |
| 12 | Ga0070680_100039008 | 3300005336 | Bacteria | 3842 |
| 13 | Ga0070682_100513204 | 3300005337 | Bacteria | 931 |
| 14 | Ga0068868_100010077 | 3300005338 | Bacteria | 6827 |
| 15 | Ga0070689_101026157 | 3300005340 | Bacteria | 735 |
| 16 | Ga0070661_100402956 | 3300005344 | Bacteria | 1082 |
| 17 | Ga0070661_100407410 | 3300005344 | Bacteria | 1076 |
| 18 | Ga0070692_10114467 | 3300005345 | Bacteria | 1496 |
| 19 | Ga0070692_10408415 | 3300005345 | Bacteria | 859 |
| 20 | Ga0070668_100016735 | 3300005347 | Bacteria | 5481 |
| 21 | Ga0070669_100006860 | 3300005353 | Bacteria | 8190 |
| 22 | Ga0070675_100014787 | 3300005354 | Bacteria | 6159 |
| 23 | Ga0070675_100107813 | 3300005354 | Bacteria | 2352 |
| 24 | Ga0070671_100001122 | 3300005355 | Bacteria | 19877 |
| 25 | Ga0070671_100149840 | 3300005355 | Bacteria | 1969 |
| 26 | Ga0070671_101058306 | 3300005355 | Bacteria | 712 |
| 27 | Ga0070674_100008237 | 3300005356 | Bacteria | 6194 |
| 28 | Ga0070674_101006415 | 3300005356 | Bacteria | 731 |
| 29 | Ga0070673_100162927 | 3300005364 | Bacteria | 1898 |
| 30 | Ga0070673_100259696 | 3300005364 | Bacteria | 1517 |
| 31 | Ga0070667_100000057 | 3300005367 | Bacteria | 150501 |
| 32 | Ga0070667_100003459 | 3300005367 | Bacteria | 13450 |
| 33 | Ga0070714_100002469 | 3300005435 | Bacteria | 13641 |
| 34 | Ga0070713_100050204 | 3300005436 | Bacteria | 3445 |
| 35 | Ga0070713_101014263 | 3300005436 | Bacteria | 801 |
| 36 | Ga0070701_10000431 | 3300005438 | Bacteria | 14307 |
| 37 | Ga0070711_100074211 | 3300005439 | Bacteria | 2405 |
| 38 | Ga0070705_100434479 | 3300005440 | Bacteria | 981 |
| 39 | Ga0070694_100105738 | 3300005444 | Bacteria | 1998 |
| 40 | Ga0070694_100225662 | 3300005444 | Bacteria | 1407 |
| 41 | Ga0070662_100001466 | 3300005457 | Bacteria | 14526 |
| 42 | Ga0068867_100024206 | 3300005459 | Bacteria | 4350 |
| 43 | Ga0070684_100340880 | 3300005535 | Bacteria | 1378 |
| 44 | Ga0070672_100002589 | 3300005543 | Bacteria | 11554 |
| 45 | Ga0070672_100498998 | 3300005543 | Bacteria | 1053 |
| 46 | Ga0070672_100651918 | 3300005543 | Bacteria | 920 |
| 47 | Ga0070686_100006322 | 3300005544 | Bacteria | 6578 |
| 48 | Ga0070695_100676633 | 3300005545 | Bacteria | 817 |
| 49 | Ga0070665_100019642 | 3300005548 | Bacteria | 6781 |
| 50 | Ga0070665_100087190 | 3300005548 | Bacteria | 3126 |
| 51 | Ga0070704_100006386 | 3300005549 | Bacteria | 6949 |
| 52 | Ga0070704_100037467 | 3300005549 | Bacteria | 3313 |
| 53 | Ga0070664_100005398 | 3300005564 | Bacteria | 10261 |
| 54 | Ga0068856_100812794 | 3300005614 | Unclassified | 954 |
| 55 | Ga0070702_100068038 | 3300005615 | Bacteria | 2094 |
| 56 | Ga0068852_100145339 | 3300005616 | Bacteria | 2199 |
| 57 | Ga0068859_100031182 | 3300005617 | Bacteria | 5351 |
| 58 | Ga0068859_100056395 | 3300005617 | Bacteria | 3954 |
| 59 | Ga0068859_100255010 | 3300005617 | Bacteria | 1845 |
| 60 | Ga0068859_101028974 | 3300005617 | Bacteria | 905 |
| 61 | Ga0068864_100003919 | 3300005618 | Bacteria | 12262 |
| 62 | Ga0068864_100076795 | 3300005618 | Bacteria | 2919 |
| 63 | Ga0068861_100054591 | 3300005719 | Bacteria | 3044 |
| 64 | Ga0068861_100792627 | 3300005719 | Bacteria | 889 |
| 65 | Ga0068870_10025601 | 3300005840 | Bacteria | 2931 |
| 66 | Ga0068870_10079413 | 3300005840 | Bacteria | 1810 |
| 67 | Ga0068863_100001117 | 3300005841 | Bacteria | 26783 |
| 68 | Ga0068858_100024492 | 3300005842 | Bacteria | 5622 |
| 69 | Ga0068858_100040342 | 3300005842 | Bacteria | 4329 |
| 70 | Ga0068860_100036640 | 3300005843 | Bacteria | 4699 |
| 71 | Ga0068860_100243968 | 3300005843 | Bacteria | 1748 |
| 72 | Ga0068862_100019309 | 3300005844 | Bacteria | 5688 |
| 73 | Ga0068862_100218545 | 3300005844 | Bacteria | 1724 |
| 74 | Ga0070712_100062834 | 3300006175 | Bacteria | 2627 |
| 75 | Ga0075427_10019405 | 3300006194 | Bacteria | 1072 |
| 76 | Ga0097621_100023783 | 3300006237 | Bacteria | 4774 |
| 77 | Ga0097621_100133484 | 3300006237 | Bacteria | 2115 |
| 78 | Ga0068871_100018593 | 3300006358 | Bacteria | 5287 |
| 79 | Ga0068871_100095366 | 3300006358 | Bacteria | 2484 |
| 80 | Ga0068871_100522531 | 3300006358 | Bacteria | 1072 |
| 81 | Ga0075428_100006380 | 3300006844 | Bacteria | 13126 |
| 82 | Ga0075428_100007135 | 3300006844 | Bacteria | 12379 |
| 83 | Ga0075428_100025918 | 3300006844 | Bacteria | 6493 |
| 84 | Ga0075428_100061093 | 3300006844 | Bacteria | 4126 |
| 85 | Ga0075428_100126578 | 3300006844 | Bacteria | 2780 |
| 86 | Ga0075430_100003451 | 3300006846 | Bacteria | 13224 |
| 87 | Ga0075430_100062492 | 3300006846 | Bacteria | 3128 |
| 88 | Ga0075430_100219009 | 3300006846 | Bacteria | 1579 |
| 89 | Ga0075430_100229917 | 3300006846 | Bacteria | 1538 |
| 90 | Ga0075430_100248649 | 3300006846 | Bacteria | 1473 |
| 91 | Ga0075431_100015225 | 3300006847 | Bacteria | 7793 |
| 92 | Ga0075431_100015713 | 3300006847 | Bacteria | 7676 |
| 93 | Ga0075431_100016725 | 3300006847 | Bacteria | 7449 |
| 94 | Ga0075433_10012077 | 3300006852 | Bacteria | 6967 |
| 95 | Ga0075429_100022299 | 3300006880 | Bacteria | 5493 |
| 96 | Ga0075429_100063954 | 3300006880 | Bacteria | 3205 |
| 97 | Ga0075429_100073706 | 3300006880 | Bacteria | 2973 |
| 98 | Ga0068865_100020120 | 3300006881 | Bacteria | 4328 |
| 99 | Ga0068865_100329234 | 3300006881 | Bacteria | 1231 |
| 100 | Ga0097620_100031181 | 3300006931 | Bacteria | 5351 |
| 101 | Ga0097620_100056396 | 3300006931 | Bacteria | 3954 |
| 102 | Ga0097620_100255002 | 3300006931 | Bacteria | 1845 |
| 103 | Ga0097620_101028990 | 3300006931 | Bacteria | 905 |
| 104 | Ga0075435_100273939 | 3300007076 | Bacteria | 1440 |
| 105 | Ga0099795_10000016 | 3300007788 | Bacteria | 63930 |
| 106 | Ga0105250_10189431 | 3300009092 | Bacteria | 865 |
| 107 | Ga0105240_10000101 | 3300009093 | Bacteria | 175584 |
| 108 | Ga0105240_10281241 | 3300009093 | Unclassified | 1911 |
| 109 | Ga0105240_10344033 | 3300009093 | Bacteria | 1693 |
| 110 | Ga0111539_10006436 | 3300009094 | Bacteria | 15137 |
| 111 | Ga0111539_10006586 | 3300009094 | Bacteria | 14967 |
| 112 | Ga0111539_10044904 | 3300009094 | Bacteria | 5291 |
| 113 | Ga0111539_10070320 | 3300009094 | Bacteria | 4132 |
| 114 | Ga0111539_10190009 | 3300009094 | Unclassified | 2397 |
| 115 | Ga0105245_10002513 | 3300009098 | Bacteria | 16535 |
| 116 | Ga0105245_10091944 | 3300009098 | Bacteria | 2793 |
| 117 | Ga0114129_10000484 | 3300009147 | Bacteria | 48049 |
| 118 | Ga0114129_10135002 | 3300009147 | Bacteria | 3386 |
| 119 | Ga0114129_10318070 | 3300009147 | Bacteria | 2070 |
| 120 | Ga0114129_10784810 | 3300009147 | Bacteria | 1217 |
| 121 | Ga0105243_10626727 | 3300009148 | Bacteria | 1039 |
| 122 | Ga0105241_10194687 | 3300009174 | Bacteria | 1689 |
| 123 | Ga0105242_10033199 | 3300009176 | Bacteria | 4132 |
| 124 | Ga0105242_10217876 | 3300009176 | Bacteria | 1704 |
| 125 | Ga0105248_10046833 | 3300009177 | Bacteria | 4848 |
| 126 | Ga0105248_10124153 | 3300009177 | Bacteria | 2912 |
| 127 | Ga0105248_11175915 | 3300009177 | Bacteria | 867 |
| 128 | Ga0105237_10245672 | 3300009545 | Bacteria | 1791 |
| 129 | Ga0105238_10026253 | 3300009551 | Bacteria | 5936 |
| 130 | Ga0105238_11652782 | 3300009551 | Bacteria | 671 |
| 131 | Ga0105249_12107841 | 3300009553 | Bacteria | 637 |
| 132 | Ga0105029_102958 | 3300009984 | Bacteria | 1120 |
| 133 | Ga0105030_100295 | 3300009987 | Bacteria | 4339 |
| 134 | Ga0099796_10112701 | 3300010159 | Bacteria | 1037 |
| 135 | Ga0105239_10024104 | 3300010375 | Bacteria | 6702 |
| 136 | Ga0105239_10924686 | 3300010375 | Bacteria | 1001 |
| 137 | Ga0105246_10004016 | 3300011119 | Bacteria | 8935 |
| 138 | Ga0105246_10284653 | 3300011119 | Bacteria | 1328 |
| 139 | Ga0157371_10357552 | 3300013102 | Bacteria | 1064 |
| 140 | Ga0157374_10000998 | 3300013296 | Bacteria | 24538 |
| 141 | Ga0157374_10012516 | 3300013296 | Bacteria | 7384 |
| 142 | Ga0157378_10085479 | 3300013297 | Bacteria | 2857 |
| 143 | Ga0163162_10005163 | 3300013306 | Bacteria | 12587 |
| 144 | Ga0163162_10129404 | 3300013306 | Bacteria | 2633 |
| 145 | Ga0157375_10027005 | 3300013308 | Bacteria | 5360 |
| 146 | Ga0157375_10083926 | 3300013308 | Bacteria | 3232 |
| 147 | Ga0163163_10001153 | 3300014325 | Bacteria | 22447 |
| 148 | Ga0163163_10005365 | 3300014325 | Bacteria | 11076 |
| 149 | Ga0163163_10008089 | 3300014325 | Bacteria | 9316 |
| 150 | Ga0163163_10029771 | 3300014325 | Bacteria | 5254 |
| 151 | Ga0163163_10700698 | 3300014325 | Bacteria | 1076 |
| 152 | Ga0157380_10000204 | 3300014326 | Bacteria | 34955 |
| 153 | Ga0157380_10010405 | 3300014326 | Bacteria | 6692 |
| 154 | Ga0157380_10038954 | 3300014326 | Bacteria | 3694 |
| 155 | Ga0157380_10062125 | 3300014326 | Bacteria | 2991 |
| 156 | Ga0157380_10232736 | 3300014326 | Bacteria | 1656 |
| 157 | Ga0157380_10785351 | 3300014326 | Bacteria | 968 |
| 158 | Ga0157380_10954651 | 3300014326 | Bacteria | 888 |
| 159 | Ga0157377_10014955 | 3300014745 | Bacteria | 3957 |
| 160 | Ga0157377_10446375 | 3300014745 | Bacteria | 892 |
| 161 | Ga0157379_10004734 | 3300014968 | Bacteria | 11677 |
| 162 | Ga0157379_10019822 | 3300014968 | Bacteria | 5943 |
| 163 | Ga0157376_10005590 | 3300014969 | Bacteria | 8797 |
| 164 | Ga0157376_10019028 | 3300014969 | Bacteria | 5282 |
| 165 | Ga0213873_10077997 | 3300021358 | Bacteria | 923 |
| 166 | Ga0213876_10004444 | 3300021384 | Bacteria | 7851 |
| 167 | Ga0213876_10019875 | 3300021384 | Bacteria | 3548 |
| 168 | Ga0213876_10083935 | 3300021384 | Bacteria | 1685 |
| 169 | Ga0213875_10020553 | 3300021388 | Bacteria | 3167 |
| 170 | Ga0207696_1091905 | 3300025711 | Bacteria | 831 |
| 171 | Ga0207682_10080166 | 3300025893 | Bacteria | 1398 |
| 172 | Ga0207642_10007513 | 3300025899 | Bacteria | 3687 |
| 173 | Ga0207688_10165595 | 3300025901 | Bacteria | 1312 |
| 174 | Ga0207680_10003496 | 3300025903 | Bacteria | 7399 |
| 175 | Ga0207680_10085972 | 3300025903 | Bacteria | 1988 |
| 176 | Ga0207680_10145208 | 3300025903 | Bacteria | 1576 |
| 177 | Ga0207680_10934754 | 3300025903 | Bacteria | 621 |
| 178 | Ga0207699_10045218 | 3300025906 | Bacteria | 2569 |
| 179 | Ga0207645_10000405 | 3300025907 | Bacteria | 35647 |
| 180 | Ga0207645_10391099 | 3300025907 | Bacteria | 934 |
| 181 | Ga0207643_10008333 | 3300025908 | Bacteria | 5563 |
| 182 | Ga0207654_10552732 | 3300025911 | Bacteria | 818 |
| 183 | Ga0207695_10078683 | 3300025913 | Bacteria | 3344 |
| 184 | Ga0207695_10559093 | 3300025913 | Bacteria | 1025 |
| 185 | Ga0207671_10184152 | 3300025914 | Bacteria | 1626 |
| 186 | Ga0207693_10096623 | 3300025915 | Bacteria | 2316 |
| 187 | Ga0207663_10037520 | 3300025916 | Bacteria | 2922 |
| 188 | Ga0207662_10717722 | 3300025918 | Bacteria | 701 |
| 189 | Ga0207649_10342428 | 3300025920 | Bacteria | 1104 |
| 190 | Ga0207650_10023090 | 3300025925 | Bacteria | 4410 |
| 191 | Ga0207659_10019401 | 3300025926 | Bacteria | 4476 |
| 192 | Ga0207687_10019628 | 3300025927 | Bacteria | 4480 |
| 193 | Ga0207687_10123810 | 3300025927 | Bacteria | 1938 |
| 194 | Ga0207700_10014832 | 3300025928 | Bacteria | 5119 |
| 195 | Ga0207664_10000775 | 3300025929 | Bacteria | 21577 |
| 196 | Ga0207664_10213879 | 3300025929 | Bacteria | 1669 |
| 197 | Ga0207644_10038556 | 3300025931 | Bacteria | 3367 |
| 198 | Ga0207690_10249486 | 3300025932 | Bacteria | 1370 |
| 199 | Ga0207706_10001790 | 3300025933 | Bacteria | 21120 |
| 200 | Ga0207686_10097646 | 3300025934 | Bacteria | 1954 |
| 201 | Ga0207670_10335453 | 3300025936 | Bacteria | 1193 |
| 202 | Ga0207704_10253500 | 3300025938 | Bacteria | 1322 |
| 203 | Ga0207691_10001027 | 3300025940 | Bacteria | 27633 |
| 204 | Ga0207691_10067881 | 3300025940 | Bacteria | 3223 |
| 205 | Ga0207711_10002654 | 3300025941 | Bacteria | 15811 |
| 206 | Ga0207689_10171369 | 3300025942 | Bacteria | 1789 |
| 207 | Ga0207661_10363375 | 3300025944 | Bacteria | 1308 |
| 208 | Ga0207651_10038107 | 3300025960 | Bacteria | 3156 |
| 209 | Ga0207651_10141667 | 3300025960 | Bacteria | 1858 |
| 210 | Ga0207668_10173980 | 3300025972 | Bacteria | 1691 |
| 211 | Ga0207658_10000186 | 3300025986 | Bacteria | 66622 |
| 212 | Ga0207658_10009925 | 3300025986 | Bacteria | 6468 |
| 213 | Ga0207677_10011639 | 3300026023 | Bacteria | 5022 |
| 214 | Ga0207677_10174557 | 3300026023 | Bacteria | 1684 |
| 215 | Ga0207703_10001486 | 3300026035 | Bacteria | 21387 |
| 216 | Ga0207703_10001744 | 3300026035 | Bacteria | 19465 |
| 217 | Ga0207708_10026816 | 3300026075 | Bacteria | 4361 |
| 218 | Ga0207708_10134655 | 3300026075 | Bacteria | 1934 |
| 219 | Ga0207702_10764864 | 3300026078 | Unclassified | 954 |
| 220 | Ga0207641_10088617 | 3300026088 | Bacteria | 2702 |
| 221 | Ga0207641_10222603 | 3300026088 | Bacteria | 1750 |
| 222 | Ga0207648_10001055 | 3300026089 | Bacteria | 30851 |
| 223 | Ga0207648_10073680 | 3300026089 | Bacteria | 2976 |
| 224 | Ga0207676_10001802 | 3300026095 | Bacteria | 15704 |
| 225 | Ga0207676_10037050 | 3300026095 | Bacteria | 3714 |
| 226 | Ga0207674_11183490 | 3300026116 | Unclassified | 734 |
| 227 | Ga0207675_100002054 | 3300026118 | Bacteria | 20079 |
| 228 | Ga0207675_100020391 | 3300026118 | Bacteria | 6179 |
| 229 | Ga0207675_101326344 | 3300026118 | Bacteria | 740 |
| 230 | Ga0207683_10183379 | 3300026121 | Bacteria | 1898 |
| 231 | Ga0207698_10044748 | 3300026142 | Bacteria | 3330 |
| 232 | Ga0209179_1000114 | 3300027512 | Bacteria | 9571 |
| 233 | Ga0210002_1002615 | 3300027617 | Bacteria | 2605 |
| 234 | Ga0210002_1013203 | 3300027617 | Bacteria | 1287 |
| 235 | Ga0209983_1005483 | 3300027665 | Bacteria | 2626 |
| 236 | Ga0209971_1000201 | 3300027682 | Bacteria | 17930 |
| 237 | Ga0209966_1021264 | 3300027695 | Bacteria | 1261 |
| 238 | Ga0209998_10000396 | 3300027717 | Bacteria | 12475 |
| 239 | Ga0209974_10002740 | 3300027876 | Bacteria | 6387 |
| 240 | Ga0209974_10053400 | 3300027876 | Bacteria | 1361 |
| 241 | Ga0207428_10014539 | 3300027907 | Bacteria | 6828 |
| 242 | Ga0207428_10082979 | 3300027907 | Bacteria | 2500 |
| 243 | Ga0268266_10032473 | 3300028379 | Bacteria | 4435 |
| 244 | Ga0268266_10046536 | 3300028379 | Bacteria | 3714 |
| 245 | Ga0268265_11021922 | 3300028380 | Bacteria | 817 |
| 246 | Ga0268264_10012855 | 3300028381 | Bacteria | 6887 |
| 247 | Ga0268264_10647495 | 3300028381 | Bacteria | 1045 |
| 248 | Ga0265334_10000008 | 3300028573 | Bacteria | 200602 |
| 249 | Ga0265334_10008371 | 3300028573 | Bacteria | 4399 |
| 250 | Ga0265338_10030934 | 3300028800 | Bacteria | 5258 |
| 251 | Ga0265338_10073443 | 3300028800 | Unclassified | 2915 |
| 252 | Ga0265338_10367745 | 3300028800 | Bacteria | 1030 |
| 253 | Ga0265325_10110575 | 3300031241 | Bacteria | 1336 |
| 254 | Ga0265340_10011441 | 3300031247 | Bacteria | 4713 |
| 255 | Ga0265340_10059055 | 3300031247 | Bacteria | 1840 |
| 256 | Ga0265327_10000005 | 3300031251 | Bacteria | 790146 |
| 257 | Ga0265327_10000098 | 3300031251 | Bacteria | 190693 |
| 258 | Ga0307513_10075796 | 3300031456 | Bacteria | 3491 |
| 259 | Ga0307509_10001421 | 3300031507 | Bacteria | 40413 |
| 260 | Ga0307408_100056372 | 3300031548 | Bacteria | 2849 |
| 261 | Ga0307408_100243512 | 3300031548 | Bacteria | 1479 |
| 262 | Ga0307408_101044834 | 3300031548 | Bacteria | 755 |
| 263 | Ga0265313_10000807 | 3300031595 | Bacteria | 31618 |
| 264 | Ga0265313_10016684 | 3300031595 | Bacteria | 4213 |
| 265 | Ga0316575_10000434 | 3300031665 | Bacteria | 11939 |
| 266 | Ga0316575_10006068 | 3300031665 | Bacteria | 4330 |
| 267 | Ga0316575_10006908 | 3300031665 | Bacteria | 4107 |
| 268 | Ga0316575_10011102 | 3300031665 | Bacteria | 3326 |
| 269 | Ga0316575_10014122 | 3300031665 | Bacteria | 2994 |
| 270 | Ga0316575_10039087 | 3300031665 | Bacteria | 1872 |
| 271 | Ga0316575_10062069 | 3300031665 | Bacteria | 1494 |
| 272 | Ga0316575_10108905 | 3300031665 | Bacteria | 1130 |
| 273 | Ga0316575_10123216 | 3300031665 | Bacteria | 1061 |
| 274 | Ga0316575_10124053 | 3300031665 | Bacteria | 1057 |
| 275 | Ga0316575_10203574 | 3300031665 | Bacteria | 824 |
| 276 | Ga0316579_10017663 | 3300031691 | Bacteria | 3131 |
| 277 | Ga0316579_10051329 | 3300031691 | Bacteria | 1930 |
| 278 | Ga0316579_10102701 | 3300031691 | Bacteria | 1369 |
| 279 | Ga0316579_10118325 | 3300031691 | Bacteria | 1272 |
| 280 | Ga0316579_10132037 | 3300031691 | Bacteria | 1203 |
| 281 | Ga0316579_10190841 | 3300031691 | Bacteria | 990 |
| 282 | Ga0316576_10004519 | 3300031727 | Bacteria | 8360 |
| 283 | Ga0316576_10009417 | 3300031727 | Bacteria | 6301 |
| 284 | Ga0316576_10012742 | 3300031727 | Bacteria | 5563 |
| 285 | Ga0316576_10014106 | 3300031727 | Bacteria | 5329 |
| 286 | Ga0316576_10023890 | 3300031727 | Bacteria | 4264 |
| 287 | Ga0316576_10045352 | 3300031727 | Bacteria | 3178 |
| 288 | Ga0316576_10050305 | 3300031727 | Unclassified | 3030 |
| 289 | Ga0316576_10063498 | 3300031727 | Bacteria | 2711 |
| 290 | Ga0316576_10071043 | 3300031727 | Bacteria | 2567 |
| 291 | Ga0316576_10074666 | 3300031727 | Bacteria | 2507 |
| 292 | Ga0316576_10074865 | 3300031727 | Unclassified | 2504 |
| 293 | Ga0316576_10113345 | 3300031727 | Bacteria | 2033 |
| 294 | Ga0316576_10147296 | 3300031727 | Bacteria | 1774 |
| 295 | Ga0316576_10176524 | 3300031727 | Bacteria | 1611 |
| 296 | Ga0316576_10227417 | 3300031727 | Bacteria | 1403 |
| 297 | Ga0316576_10257052 | 3300031727 | Bacteria | 1311 |
| 298 | Ga0316576_10302135 | 3300031727 | Bacteria | 1196 |
| 299 | Ga0316576_10307835 | 3300031727 | Bacteria | 1183 |
| 300 | Ga0316576_10560186 | 3300031727 | Bacteria | 837 |
| 301 | Ga0316576_10874747 | 3300031727 | Bacteria | 644 |
| 302 | Ga0316578_10000045 | 3300031728 | Bacteria | 25677 |
| 303 | Ga0316578_10014837 | 3300031728 | Bacteria | 4175 |
| 304 | Ga0316578_10021669 | 3300031728 | Bacteria | 3569 |
| 305 | Ga0316578_10029909 | 3300031728 | Bacteria | 3093 |
| 306 | Ga0316578_10091959 | 3300031728 | Bacteria | 1812 |
| 307 | Ga0316578_10213479 | 3300031728 | Bacteria | 1160 |
| 308 | Ga0307405_10016582 | 3300031731 | Bacteria | 4020 |
| 309 | Ga0316577_10005479 | 3300031733 | Bacteria | 6654 |
| 310 | Ga0316577_10011805 | 3300031733 | Bacteria | 4741 |
| 311 | Ga0316577_10015548 | 3300031733 | Bacteria | 4187 |
| 312 | Ga0316577_10018147 | 3300031733 | Bacteria | 3888 |
| 313 | Ga0316577_10021930 | 3300031733 | Bacteria | 3544 |
| 314 | Ga0316577_10053984 | 3300031733 | Bacteria | 2243 |
| 315 | Ga0316577_10098927 | 3300031733 | Unclassified | 1634 |
| 316 | Ga0316577_10102366 | 3300031733 | Bacteria | 1605 |
| 317 | Ga0316577_10157442 | 3300031733 | Bacteria | 1281 |
| 318 | Ga0316577_10158405 | 3300031733 | Unclassified | 1277 |
| 319 | Ga0307413_10087136 | 3300031824 | Bacteria | 2021 |
| 320 | Ga0307410_10117924 | 3300031852 | Bacteria | 1931 |
| 321 | Ga0307410_10534514 | 3300031852 | Bacteria | 969 |
| 322 | Ga0307406_10280103 | 3300031901 | Bacteria | 1271 |
| 323 | Ga0307412_10063121 | 3300031911 | Bacteria | 2498 |
| 324 | Ga0307412_10461548 | 3300031911 | Bacteria | 1049 |
| 325 | Ga0307409_100005677 | 3300031995 | Bacteria | 7226 |
| 326 | Ga0307409_100284382 | 3300031995 | Bacteria | 1530 |
| 327 | Ga0307416_100137802 | 3300032002 | Bacteria | 2212 |
| 328 | Ga0307416_101174864 | 3300032002 | Bacteria | 873 |
| 329 | Ga0307415_100001848 | 3300032126 | Bacteria | 10376 |
| 330 | Ga0316583_10008392 | 3300032133 | Bacteria | 3727 |
| 331 | Ga0316583_10031567 | 3300032133 | Bacteria | 1885 |
| 332 | Ga0316583_10031610 | 3300032133 | Bacteria | 1884 |
| 333 | Ga0316583_10037455 | 3300032133 | Bacteria | 1719 |
| 334 | Ga0316583_10039661 | 3300032133 | Bacteria | 1667 |
| 335 | Ga0316583_10073060 | 3300032133 | Unclassified | 1200 |
| 336 | Ga0316585_10004539 | 3300032137 | Bacteria | 3871 |
| 337 | Ga0316585_10008553 | 3300032137 | Bacteria | 2973 |
| 338 | Ga0316585_10022801 | 3300032137 | Bacteria | 1927 |
| 339 | Ga0316585_10060090 | 3300032137 | Bacteria | 1227 |
| 340 | Ga0316585_10070034 | 3300032137 | Bacteria | 1137 |
| 341 | Ga0316585_10075987 | 3300032137 | Bacteria | 1092 |
| 342 | Ga0316585_10093628 | 3300032137 | Unclassified | 983 |
| 343 | Ga0316580_10000990 | 3300032139 | Bacteria | 7074 |
| 344 | Ga0316580_10002043 | 3300032139 | Bacteria | 5469 |
| 345 | Ga0316580_10005631 | 3300032139 | Bacteria | 3666 |
| 346 | Ga0316580_10014022 | 3300032139 | Bacteria | 2444 |
| 347 | Ga0316580_10014141 | 3300032139 | Bacteria | 2436 |
| 348 | Ga0316580_10032209 | 3300032139 | Bacteria | 1623 |
| 349 | Ga0316580_10117113 | 3300032139 | Bacteria | 816 |
| 350 | Ga0316593_10038658 | 3300032168 | Bacteria | 1580 |
| 351 | Ga0316593_10041535 | 3300032168 | Bacteria | 1531 |
| 352 | Ga0316593_10133842 | 3300032168 | Bacteria | 895 |
| 353 | Ga0316593_10151807 | 3300032168 | Bacteria | 843 |
| 354 | Ga0316593_10151988 | 3300032168 | Unclassified | 842 |
| 355 | Ga0316592_1002612 | 3300033524 | Bacteria | 3138 |
| 356 | Ga0316592_1005685 | 3300033524 | Bacteria | 2377 |
| 357 | Ga0316592_1008935 | 3300033524 | Bacteria | 1995 |
| 358 | Ga0316592_1022851 | 3300033524 | Bacteria | 1339 |
| 359 | Ga0316592_1030401 | 3300033524 | Bacteria | 1174 |
| 360 | Ga0316592_1044878 | 3300033524 | Bacteria | 983 |
| 361 | Ga0316586_1002622 | 3300033527 | Bacteria | 2267 |
| 362 | Ga0316586_1008710 | 3300033527 | Bacteria | 1508 |
| 363 | Ga0316586_1043149 | 3300033527 | Bacteria | 797 |
| 364 | Ga0316588_1014477 | 3300033528 | Bacteria | 1727 |
| 365 | Ga0316588_1023579 | 3300033528 | Bacteria | 1413 |
| 366 | Ga0316588_1032334 | 3300033528 | Bacteria | 1230 |
| 367 | Ga0316588_1052625 | 3300033528 | Bacteria | 988 |
| 368 | Ga0316587_1053063 | 3300033529 | Bacteria | 745 |
| 369 | Ga0316596_1003576 | 3300033541 | Bacteria | 3422 |
| 370 | Ga0316596_1039416 | 3300033541 | Bacteria | 1239 |
| 371 | Ga0316596_1052025 | 3300033541 | Bacteria | 1085 |
| 372 | Ga0316596_1149458 | 3300033541 | Unclassified | 641 |
| 373 | Ga0316596_1155787 | 3300033541 | Bacteria | 628 |
| 374 | Ga0373926_0030472 | 3300035083 | Bacteria | 1900 |
| 375 | Ga0373955_0032310 | 3300035172 | Bacteria | 2746 |
| 376 | Ga0373961_0046137 | 3300035241 | Bacteria | 1276 |
| 377 | Ga0316574_0000421 | 3300035398 | Bacteria | 16816 |
| 378 | Ga0316574_0001360 | 3300035398 | Bacteria | 11514 |
| 379 | Ga0316574_0006599 | 3300035398 | Bacteria | 6285 |
| 380 | Ga0316574_0009475 | 3300035398 | Bacteria | 5457 |
| 381 | Ga0316574_0019775 | 3300035398 | Bacteria | 3978 |
| 382 | Ga0316574_0020832 | 3300035398 | Bacteria | 3885 |
| 383 | Ga0316574_0035364 | 3300035398 | Bacteria | 3052 |
| 384 | Ga0316574_0065558 | 3300035398 | Bacteria | 2286 |
| 385 | Ga0316574_0091297 | 3300035398 | Bacteria | 1942 |
| 386 | Ga0316574_0101862 | 3300035398 | Bacteria | 1838 |
| 387 | Ga0316574_0180963 | 3300035398 | Bacteria | 1356 |
| 388 | Ga0316574_0199949 | 3300035398 | Bacteria | 1284 |
| 389 | Ga0316574_0485208 | 3300035398 | Bacteria | 772 |
| 390 | Ga0316574_0621254 | 3300035398 | Bacteria | 666 |
| 391 | Ga0373931_0396110 | 3300035691 | Bacteria | 873 |
| 392 | Ga0373927_0000010 | 3300035695 | Bacteria | 183458 |
| 393 | Ga0373927_0206284 | 3300035695 | Bacteria | 1291 |
| 394 | Ga0373933_0032118 | 3300035724 | Bacteria | 3050 |
| 395 | Ga0373937_0018232 | 3300036401 | Bacteria | 6264 |
| 396 | Ga0373937_0033260 | 3300036401 | Bacteria | 4682 |
| 397 | Ga0373937_0137044 | 3300036401 | Bacteria | 2289 |
| 398 | Ga0373937_0281635 | 3300036401 | Bacteria | 1570 |
| 399 | Ga0373937_1523114 | 3300036401 | Bacteria | 616 |
| 400 | Ga0316582_0002483 | 3300036647 | Bacteria | 8682 |
| 401 | Ga0316582_0013924 | 3300036647 | Bacteria | 4547 |
| 402 | Ga0316582_0020709 | 3300036647 | Bacteria | 3872 |
| 403 | Ga0316582_0038093 | 3300036647 | Bacteria | 2986 |
| 404 | Ga0316582_0039759 | 3300036647 | Bacteria | 2930 |
| 405 | Ga0316582_0066851 | 3300036647 | Bacteria | 2318 |
| 406 | Ga0316582_0067366 | 3300036647 | Bacteria | 2309 |
| 407 | Ga0316582_0112197 | 3300036647 | Bacteria | 1816 |
| 408 | Ga0316582_0129449 | 3300036647 | Bacteria | 1694 |
| 409 | Ga0316582_0220749 | 3300036647 | Bacteria | 1296 |
| 410 | Ga0316582_0396960 | 3300036647 | Bacteria | 950 |
| 411 | Ga0316582_0429823 | 3300036647 | Bacteria | 910 |
| 412 | Ga0316582_0799790 | 3300036647 | Unclassified | 646 |
| 413 | Ga0316584_0004581 | 3300036712 | Bacteria | 9162 |
| 414 | Ga0316584_0009145 | 3300036712 | Bacteria | 6862 |
| 415 | Ga0316584_0011037 | 3300036712 | Bacteria | 6331 |
| 416 | Ga0316584_0015880 | 3300036712 | Bacteria | 5393 |
| 417 | Ga0316584_0016629 | 3300036712 | Bacteria | 5276 |
| 418 | Ga0316584_0018538 | 3300036712 | Bacteria | 5022 |
| 419 | Ga0316584_0022323 | 3300036712 | Unclassified | 4614 |
| 420 | Ga0316584_0024910 | 3300036712 | Bacteria | 4384 |
| 421 | Ga0316584_0033854 | 3300036712 | Bacteria | 3785 |
| 422 | Ga0316584_0054156 | 3300036712 | Bacteria | 3002 |
| 423 | Ga0316584_0070531 | 3300036712 | Bacteria | 2619 |
| 424 | Ga0316584_0087967 | 3300036712 | Bacteria | 2326 |
| 425 | Ga0316584_0132967 | 3300036712 | Bacteria | 1857 |
| 426 | Ga0316584_0149188 | 3300036712 | Bacteria | 1741 |
| 427 | Ga0316584_0224506 | 3300036712 | Unclassified | 1379 |
| 428 | Ga0316584_0263823 | 3300036712 | Bacteria | 1255 |
| 429 | Ga0316584_0335186 | 3300036712 | Bacteria | 1088 |
| 430 | Ga0316581_0013894 | 3300037588 | Bacteria | 2288 |
| 431 | Ga0316581_0082354 | 3300037588 | Bacteria | 990 |
| 432 | Ga0436364_0095069 | 3300037853 | Bacteria | 1294 |
| 433 | Ga0436364_0472331 | 3300037853 | Bacteria | 1447 |
| 434 | Ga0436364_0782091 | 3300037853 | Bacteria | 2731 |
| 435 | Ga0436364_1384597 | 3300037853 | Bacteria | 1264 |
| 436 | Ga0436364_1458736 | 3300037853 | Bacteria | 1391 |
| 437 | Ga0436364_1521721 | 3300037853 | Bacteria | 19288 |
| 438 | Ga0400484_09769 | 3300038725 | Bacteria | 8280 |
| 439 | Ga0400484_35465 | 3300038725 | Bacteria | 21483 |
| 440 | Ga0400490_06983 | 3300038726 | Unclassified | 1070 |
| 441 | Ga0400490_11650 | 3300038726 | Bacteria | 5940 |
| 442 | Ga0400490_16309 | 3300038726 | Bacteria | 3979 |
| 443 | Ga0400490_35540 | 3300038726 | Bacteria | 51775 |
| 444 | Ga0400485_08473 | 3300038735 | Unclassified | 1109 |
| 445 | Ga0400485_09701 | 3300038735 | Bacteria | 12422 |
| 446 | Ga0400485_13509 | 3300038735 | Bacteria | 18578 |
| 447 | Ga0400488_25302 | 3300038741 | Bacteria | 4899 |
| 448 | Ga0400488_53784 | 3300038741 | Bacteria | 8477 |
| 449 | Ga0400488_53787 | 3300038741 | Bacteria | 1955 |
| 450 | Ga0400486_16046 | 3300038742 | Bacteria | 6828 |
| 451 | Ga0400486_26096 | 3300038742 | Bacteria | 60268 |
| 452 | Ga0400486_30859 | 3300038742 | Bacteria | 26609 |
| 453 | Ga0400483_005648 | 3300039062 | Bacteria | 15651 |
| 454 | Ga0400483_029989 | 3300039062 | Bacteria | 58053 |
| 455 | Ga0400483_242281 | 3300039062 | Bacteria | 55044 |
| 456 | Ga0400483_252490 | 3300039062 | Bacteria | 1352 |
| 457 | Ga0400483_269206 | 3300039062 | Bacteria | 85448 |
| 458 | Ga0400489_35275 | 3300039093 | Bacteria | 72456 |
| 459 | Ga0400489_55657 | 3300039093 | Bacteria | 17425 |
| 460 | Ga0400489_68375 | 3300039093 | Bacteria | 25878 |
| 461 | Ga0400489_76049 | 3300039093 | Bacteria | 1372 |
| 462 | Ga0400487_46349 | 3300039110 | Bacteria | 6014 |
| 463 | Ga0436365_0551274 | 3300039437 | Bacteria | 4839 |
| 464 | Ga0436365_0985493 | 3300039437 | Bacteria | 6323 |
| 465 | Ga0436365_1224743 | 3300039437 | Bacteria | 5397 |
| 466 | Ga0436365_1406444 | 3300039437 | Bacteria | 25793 |
| 467 | Ga0436363_0997300 | 3300039450 | Bacteria | 7459 |
| 468 | Ga0436362_0154526 | 3300039453 | Bacteria | 2082 |
| 469 | Ga0436362_0621652 | 3300039453 | Bacteria | 1126 |
| 470 | Ga0436362_1108905 | 3300039453 | Bacteria | 3210 |
| 471 | Ga0439461_0016797 | 3300041410 | Bacteria | 1417 |
| 472 | Ga0439431_0185873 | 3300041997 | Bacteria | 601 |
| 473 | Ga0439443_000428 | 3300042003 | Bacteria | 3645 |
| 474 | Ga0450920_002953 | 3300042122 | Bacteria | 2926 |
| 475 | Ga0450896_007368 | 3300042133 | Bacteria | 1518 |
| 476 | Ga0450899_037656 | 3300042135 | Bacteria | 600 |
| 477 | Ga0450906_014059 | 3300042145 | Bacteria | 1469 |
| 478 | Ga0450910_024919 | 3300042147 | Bacteria | 919 |
| 479 | Ga0439446_0014380 | 3300042156 | Bacteria | 2184 |
| 480 | Ga0450908_009560 | 3300042184 | Bacteria | 1800 |
| 481 | Ga0439434_0031556 | 3300042435 | Bacteria | 1611 |
| 482 | Ga0439434_0127105 | 3300042435 | Bacteria | 834 |
| 483 | Ga0439435_0025063 | 3300042436 | Bacteria | 1578 |
| 484 | Ga0439464_0065427 | 3300042439 | Bacteria | 1069 |
| 485 | Ga0450916_015540 | 3300042530 | Bacteria | 1001 |
| 486 | Ga0450918_006465 | 3300042531 | Bacteria | 2090 |
| 487 | Ga0450893_0013123 | 3300042532 | Bacteria | 1380 |
| 488 | Ga0450893_0095757 | 3300042532 | Bacteria | 600 |
| 489 | Ga0451577_0000195 | 3300042876 | Bacteria | 127456 |
| 490 | Ga0451577_0295487 | 3300042876 | Bacteria | 1468 |
| 491 | Ga0466969_0125122 | 3300044656 | Bacteria | 1194 |
| 492 | Ga0453683_0003297 | 3300044673 | Bacteria | 11966 |
| 493 | Ga0453683_0008865 | 3300044673 | Bacteria | 6733 |
| 494 | Ga0466965_0073005 | 3300044683 | Bacteria | 1727 |
| 495 | Ga0466965_0113651 | 3300044683 | Bacteria | 1393 |
| 496 | Ga0466961_0353683 | 3300044693 | Bacteria | 894 |
| 497 | Ga0466963_0001470 | 3300044694 | Bacteria | 12720 |
| 498 | Ga0466963_0025272 | 3300044694 | Bacteria | 3786 |
| 499 | Ga0466963_0165967 | 3300044694 | Bacteria | 1538 |
| 500 | Ga0466963_0208457 | 3300044694 | Bacteria | 1367 |
| 501 | Ga0466963_0425998 | 3300044694 | Bacteria | 936 |
| 502 | Ga0466963_0495143 | 3300044694 | Bacteria | 863 |
| 503 | Ga0453684_0000017 | 3300044712 | Bacteria | 925696 |
| 504 | Ga0453684_0000036 | 3300044712 | Bacteria | 711481 |
| 505 | Ga0453684_0000635 | 3300044712 | Bacteria | 127456 |
| 506 | Ga0453684_0123258 | 3300044712 | Bacteria | 3125 |
| 507 | Ga0453684_0267466 | 3300044712 | Bacteria | 1955 |
| 508 | Ga0453684_0319046 | 3300044712 | Bacteria | 1760 |
| 509 | Ga0453684_0445675 | 3300044712 | Unclassified | 1442 |
| 510 | Ga0466971_0050995 | 3300044719 | Bacteria | 1862 |
| 511 | Ga0466968_0051375 | 3300044735 | Bacteria | 1761 |
| 512 | Ga0466968_0080260 | 3300044735 | Bacteria | 1432 |
| 513 | Ga0466968_0134507 | 3300044735 | Bacteria | 1127 |
| 514 | Ga0466968_0189850 | 3300044735 | Bacteria | 958 |
| 515 | Ga0466968_0268326 | 3300044735 | Bacteria | 814 |
| 516 | Ga0466970_0016470 | 3300044765 | Bacteria | 3813 |
| 517 | Ga0466970_0033911 | 3300044765 | Bacteria | 2700 |
| 518 | Ga0466957_0039036 | 3300044842 | Bacteria | 2863 |
| 519 | Ga0466959_0138376 | 3300045049 | Bacteria | 1722 |
| 520 | Ga0466959_0162928 | 3300045049 | Bacteria | 1567 |
| 521 | Ga0451576_0248548 | 3300045051 | Bacteria | 1859 |
| 522 | Ga0451576_1029938 | 3300045051 | Bacteria | 862 |
| 523 | Ga0466958_0002260 | 3300045836 | Bacteria | 9596 |
| 524 | Ga0466958_0011885 | 3300045836 | Bacteria | 4915 |
| 525 | Ga0466958_0028047 | 3300045836 | Bacteria | 3335 |
| 526 | Ga0466958_0040257 | 3300045836 | Bacteria | 2809 |
| 527 | Ga0466967_0007683 | 3300045976 | Bacteria | 7810 |
| 528 | Ga0466967_0190306 | 3300045976 | Bacteria | 1939 |
| 529 | Ga0466967_0846585 | 3300045976 | Bacteria | 909 |
| 530 | Ga0466967_1057445 | 3300045976 | Bacteria | 808 |
| 531 | Ga0466967_1518777 | 3300045976 | Bacteria | 667 |
| 532 | Ga0495603_0008315 | 3300046455 | Bacteria | 6273 |
| 533 | Ga0495603_0089474 | 3300046455 | Bacteria | 1801 |
| 534 | Ga0495590_0044441 | 3300046457 | Bacteria | 1549 |
| 535 | Ga0495638_0032047 | 3300046460 | Bacteria | 3372 |
| 536 | Ga0495651_0366657 | 3300046462 | Bacteria | 948 |
| 537 | Ga0495582_0565145 | 3300046473 | Bacteria | 658 |
| 538 | Ga0495607_0275241 | 3300046501 | Bacteria | 801 |
| 539 | Ga0495630_0249078 | 3300046517 | Bacteria | 1357 |
| 540 | Ga0495630_0462120 | 3300046517 | Bacteria | 973 |
| 541 | Ga0495652_0441204 | 3300046529 | Bacteria | 913 |
| 542 | Ga0495654_0086515 | 3300046530 | Bacteria | 1460 |
| 543 | Ga0495586_0011357 | 3300046535 | Bacteria | 4736 |
| 544 | Ga0495621_0000098 | 3300046539 | Bacteria | 17925 |
| 545 | Ga0495597_0199030 | 3300046542 | Unclassified | 803 |
| 546 | Ga0495667_0276210 | 3300046559 | Bacteria | 1067 |
| 547 | Ga0495656_0080458 | 3300046615 | Bacteria | 1469 |
| 548 | Ga0495656_0418056 | 3300046615 | Bacteria | 703 |
| 549 | Ga0495634_0138229 | 3300046642 | Bacteria | 1549 |
| 550 | Ga0495611_0085346 | 3300046648 | Bacteria | 1456 |
| 551 | Ga0495635_0576678 | 3300046663 | Bacteria | 736 |
| 552 | Ga0495657_0360552 | 3300046675 | Bacteria | 859 |
| 553 | Ga0495647_0018427 | 3300046681 | Bacteria | 2485 |
| 554 | Ga0495647_0158842 | 3300046681 | Bacteria | 973 |
| 555 | Ga0495658_0027956 | 3300046683 | Bacteria | 3040 |
| 556 | Ga0495670_0204618 | 3300046691 | Bacteria | 1046 |
| 557 | Ga0495671_0004008 | 3300046692 | Bacteria | 8900 |
| 558 | Ga0495673_0119506 | 3300047469 | Bacteria | 1045 |
| 559 | Ga0495681_0139306 | 3300047470 | Bacteria | 1026 |
| 560 | Ga0496104_0001449 | 3300048907 | Bacteria | 20492 |
| 561 | Ga0496105_0001567 | 3300048908 | Bacteria | 16198 |
| 562 | Ga0496108_0028591 | 3300048911 | Bacteria | 4613 |
| 563 | Ga0496108_0103094 | 3300048911 | Bacteria | 2434 |
| 564 | Ga0496109_0012615 | 3300048912 | Bacteria | 7297 |
| 565 | Ga0496109_0032320 | 3300048912 | Bacteria | 4704 |
| 566 | Ga0496111_0002880 | 3300048914 | Bacteria | 10508 |
| 567 | Ga0496112_0001440 | 3300048915 | Bacteria | 18264 |
| 568 | Ga0496113_0034515 | 3300048916 | Bacteria | 3691 |
| 569 | Ga0496113_0276979 | 3300048916 | Bacteria | 1341 |
| 570 | Ga0496114_0000244 | 3300048917 | Bacteria | 39586 |
| 571 | Ga0496115_0040651 | 3300048918 | Bacteria | 3698 |
| 572 | Ga0496115_0864378 | 3300048918 | Bacteria | 700 |
| 573 | Ga0496116_0011339 | 3300048919 | Bacteria | 7392 |
| 574 | Ga0496117_0072927 | 3300048920 | Bacteria | 2292 |
| 575 | Ga0496117_0163096 | 3300048920 | Bacteria | 1303 |
| 576 | Ga0496126_0071417 | 3300048929 | Unclassified | 3090 |
| 577 | Ga0501031_0039301 | 3300049568 | Bacteria | 3087 |
| 578 | Ga0501032_0252420 | 3300049569 | Bacteria | 1145 |
| 579 | Ga0501034_0267271 | 3300049571 | Bacteria | 1652 |
| 580 | Ga0501034_0289008 | 3300049571 | Bacteria | 1578 |
| 581 | Ga0501036_0007849 | 3300049572 | Bacteria | 8731 |
| 582 | Ga0501036_0151126 | 3300049572 | Bacteria | 1959 |
| 583 | Ga0501036_0680824 | 3300049572 | Bacteria | 850 |
| 584 | Ga0501037_0197202 | 3300049573 | Bacteria | 1424 |
| 585 | Ga0501037_0317145 | 3300049573 | Bacteria | 1080 |
| 586 | Ga0501037_0559223 | 3300049573 | Bacteria | 771 |
| 587 | Ga0501038_0019453 | 3300049574 | Bacteria | 6120 |
| 588 | Ga0501038_0028666 | 3300049574 | Bacteria | 4945 |
| 589 | Ga0501039_0003853 | 3300049575 | Bacteria | 11261 |
| 590 | Ga0501039_0028077 | 3300049575 | Bacteria | 4329 |
| 591 | Ga0501039_0207631 | 3300049575 | Bacteria | 1540 |
| 592 | Ga0501039_0363304 | 3300049575 | Bacteria | 1137 |
| 593 | Ga0501040_0000023 | 3300049576 | Bacteria | 69444 |
| 594 | Ga0501040_0001206 | 3300049576 | Bacteria | 16460 |
| 595 | Ga0501040_0015429 | 3300049576 | Bacteria | 5051 |
| 596 | Ga0501040_0076176 | 3300049576 | Bacteria | 2319 |
| 597 | Ga0501040_0184312 | 3300049576 | Bacteria | 1480 |
| 598 | Ga0501040_0245839 | 3300049576 | Bacteria | 1276 |
| 599 | Ga0501040_0385437 | 3300049576 | Bacteria | 1006 |
| 600 | Ga0501041_0001968 | 3300049577 | Bacteria | 11551 |
| 601 | Ga0501041_0007930 | 3300049577 | Bacteria | 6243 |
| 602 | Ga0501041_0031523 | 3300049577 | Bacteria | 3203 |
| 603 | Ga0501041_0250870 | 3300049577 | Bacteria | 1113 |
| 604 | Ga0501042_0000263 | 3300049578 | Bacteria | 25646 |
| 605 | Ga0501042_0000931 | 3300049578 | Bacteria | 16497 |
| 606 | Ga0501042_0761393 | 3300049578 | Bacteria | 704 |
| 607 | Ga0501042_0782791 | 3300049578 | Bacteria | 694 |
| 608 | Ga0501043_0061394 | 3300049579 | Bacteria | 2952 |
| 609 | Ga0501046_0011112 | 3300049580 | Bacteria | 7710 |
| 610 | Ga0501046_0128320 | 3300049580 | Bacteria | 1924 |
| 611 | Ga0501046_0238421 | 3300049580 | Bacteria | 1342 |
| 612 | Ga0501046_0394763 | 3300049580 | Bacteria | 1000 |
| 613 | Ga0501048_0011120 | 3300049582 | Bacteria | 6710 |
| 614 | Ga0501048_0437559 | 3300049582 | Bacteria | 936 |
| 615 | Ga0501048_0602687 | 3300049582 | Bacteria | 788 |
| 616 | Ga0501068_0000860 | 3300049584 | Bacteria | 15814 |
| 617 | Ga0501068_0064121 | 3300049584 | Bacteria | 2236 |
| 618 | Ga0501068_0164144 | 3300049584 | Bacteria | 1400 |
| 619 | Ga0501069_0099195 | 3300049585 | Bacteria | 1653 |
| 620 | Ga0501070_0340121 | 3300049586 | Bacteria | 1219 |
| 621 | Ga0501071_0006996 | 3300049587 | Bacteria | 7366 |
| 622 | Ga0501071_0014535 | 3300049587 | Bacteria | 5385 |
| 623 | Ga0501071_0149593 | 3300049587 | Bacteria | 1741 |
| 624 | Ga0501071_0862456 | 3300049587 | Bacteria | 698 |
| 625 | Ga0501072_0001665 | 3300049588 | Bacteria | 16559 |
| 626 | Ga0501072_0024666 | 3300049588 | Bacteria | 4681 |
| 627 | Ga0501072_0062383 | 3300049588 | Bacteria | 2940 |
| 628 | Ga0501072_0248757 | 3300049588 | Bacteria | 1416 |
| 629 | Ga0501072_0267261 | 3300049588 | Bacteria | 1361 |
| 630 | Ga0501073_0105511 | 3300049589 | Bacteria | 1955 |
| 631 | Ga0501073_0123504 | 3300049589 | Bacteria | 1794 |
| 632 | Ga0501073_0312341 | 3300049589 | Bacteria | 1084 |
| 633 | Ga0501073_0490057 | 3300049589 | Bacteria | 850 |
| 634 | Ga0501074_0124231 | 3300049590 | Bacteria | 1845 |
| 635 | Ga0501074_0523337 | 3300049590 | Bacteria | 840 |
| 636 | Ga0501075_0000858 | 3300049591 | Bacteria | 19148 |
| 637 | Ga0501075_0010706 | 3300049591 | Bacteria | 6455 |
| 638 | Ga0501075_0078280 | 3300049591 | Bacteria | 2502 |
| 639 | Ga0501075_0154177 | 3300049591 | Bacteria | 1751 |
| 640 | Ga0501075_0378407 | 3300049591 | Bacteria | 1079 |
| 641 | Ga0501076_0002159 | 3300049592 | Bacteria | 13483 |
| 642 | Ga0501076_0008141 | 3300049592 | Bacteria | 7669 |
| 643 | Ga0501076_0031032 | 3300049592 | Bacteria | 4165 |
| 644 | Ga0501076_0036539 | 3300049592 | Bacteria | 3849 |
| 645 | Ga0501077_0004578 | 3300049593 | Bacteria | 8401 |
| 646 | Ga0501077_0030779 | 3300049593 | Bacteria | 3416 |
| 647 | Ga0501077_0061930 | 3300049593 | Bacteria | 2374 |
| 648 | Ga0501077_0317224 | 3300049593 | Bacteria | 994 |
| 649 | Ga0501077_0424764 | 3300049593 | Bacteria | 850 |
| 650 | Ga0501219_008464 | 3300049703 | Bacteria | 753 |
| 651 | Ga0501079_0002189 | 3300049741 | Bacteria | 14087 |
| 652 | Ga0501079_0008655 | 3300049741 | Bacteria | 7719 |
| 653 | Ga0501079_0011210 | 3300049741 | Bacteria | 6838 |
| 654 | Ga0501079_0218820 | 3300049741 | Bacteria | 1488 |
| 655 | Ga0501079_0415736 | 3300049741 | Bacteria | 1055 |
| 656 | Ga0501080_0009101 | 3300049742 | Bacteria | 9039 |
| 657 | Ga0501080_0022228 | 3300049742 | Bacteria | 5875 |
| 658 | Ga0501080_0030746 | 3300049742 | Bacteria | 5003 |
| 659 | Ga0501080_0129864 | 3300049742 | Bacteria | 2332 |
| 660 | Ga0501080_1105514 | 3300049742 | Bacteria | 684 |
| 661 | Ga0501081_0000359 | 3300049743 | Bacteria | 24723 |
| 662 | Ga0501081_0055340 | 3300049743 | Bacteria | 2741 |
| 663 | Ga0501081_0352592 | 3300049743 | Bacteria | 1085 |
| 664 | Ga0501083_0071631 | 3300049744 | Bacteria | 2304 |
| 665 | Ga0501083_0140138 | 3300049744 | Bacteria | 1584 |
| 666 | Ga0501083_0144745 | 3300049744 | Bacteria | 1556 |
| 667 | Ga0501083_0342322 | 3300049744 | Bacteria | 972 |
| 668 | Ga0501035_0078323 | 3300049822 | Bacteria | 2920 |
| 669 | Ga0501035_0197866 | 3300049822 | Bacteria | 1725 |
| 670 | Ga0501044_0955394 | 3300049823 | Bacteria | 730 |
| 671 | Ga0501045_0025348 | 3300049824 | Bacteria | 4262 |
| 672 | Ga0501045_0037227 | 3300049824 | Bacteria | 3536 |
| 673 | Ga0501045_0096695 | 3300049824 | Bacteria | 2185 |
| 674 | Ga0501045_0116947 | 3300049824 | Bacteria | 1979 |
| 675 | Ga0501045_0185080 | 3300049824 | Bacteria | 1552 |
| 676 | Ga0501045_0674051 | 3300049824 | Bacteria | 764 |
| 677 | nmdc:mga0yw44_619439_c1 | 3300050492 | Bacteria | 735 |
| 678 | nmdc:mga05p37_29644_c1 | 3300050507 | Bacteria | 6677 |
| 679 | nmdc:mga05p37_949333_c1 | 3300050507 | Bacteria | 920 |
| 680 | nmdc:mga09592_360_c1 | 3300050508 | Bacteria | 33201 |
| 681 | nmdc:mga09592_37787_c1 | 3300050508 | Bacteria | 4051 |
| 682 | nmdc:mga09592_503260_c1 | 3300050508 | Bacteria | 1043 |
| 683 | nmdc:mga0qj67_19098_c1 | 3300050509 | Bacteria | 5234 |
| 684 | nmdc:mga0qj67_28506_c1 | 3300050509 | Bacteria | 4334 |
| 685 | nmdc:mga0qj67_40936_c1 | 3300050509 | Bacteria | 3643 |
| 686 | nmdc:mga0qj67_6164_c1 | 3300050509 | Bacteria | 8792 |
| 687 | nmdc:mga06r32_138256_c1 | 3300050510 | Bacteria | 2411 |
| 688 | nmdc:mga06r32_22221_c1 | 3300050510 | Bacteria | 5862 |
| 689 | nmdc:mga06r32_2483_c1 | 3300050510 | Bacteria | 16504 |
| 690 | nmdc:mga06r32_9372_c1 | 3300050510 | Bacteria | 8828 |
| 691 | nmdc:mga08y16_103071_c1 | 3300050511 | Bacteria | 2971 |
| 692 | nmdc:mga08y16_21686_c1 | 3300050511 | Bacteria | 6781 |
| 693 | nmdc:mga08y16_519422_c1 | 3300050511 | Bacteria | 1208 |
| 694 | nmdc:mga08y16_584337_c1 | 3300050511 | Bacteria | 1127 |
| 695 | nmdc:mga08y16_63940_c1 | 3300050511 | Bacteria | 3843 |
| 696 | nmdc:mga0rr50_284275_c1 | 3300050513 | Bacteria | 1381 |
| 697 | nmdc:mga0a205_18127_c1 | 3300050515 | Bacteria | 6614 |
| 698 | Ga0495601_0514807 | 3300053077 | Bacteria | 771 |
| 699 | Ga0500583_0157063 | 3300053092 | Bacteria | 1133 |
| 700 | Ga0500641_0053391 | 3300053096 | Bacteria | 1668 |
| 701 | Ga0500556_0000766 | 3300053104 | Bacteria | 19058 |
| 702 | Ga0500652_164417 | 3300053131 | Bacteria | 916 |
| 703 | Ga0501084_0007709 | 3300054114 | Bacteria | 8869 |
| 704 | Ga0501084_0007827 | 3300054114 | Bacteria | 8793 |
| 705 | Ga0501084_0105628 | 3300054114 | Bacteria | 2365 |
| 706 | Ga0501084_0114844 | 3300054114 | Bacteria | 2263 |
| 707 | Ga0501084_0671119 | 3300054114 | Bacteria | 875 |
| 708 | Ga0501082_0000368 | 3300060353 | Bacteria | 39768 |
| 709 | Ga0501082_0005816 | 3300060353 | Bacteria | 10707 |
| 710 | Ga0501082_0018624 | 3300060353 | Bacteria | 5984 |
| 711 | Ga0501082_0112658 | 3300060353 | Bacteria | 2355 |
| 712 | Ga0501082_0258227 | 3300060353 | Bacteria | 1516 |
| 713 | Ga0501082_0309457 | 3300060353 | Bacteria | 1376 |
| 714 | Ga0466962_0021345 | 3300061719 | Bacteria | 3110 |
| 715 | Ga0466962_0217762 | 3300061719 | Bacteria | 935 |
| 716 | Ga0530510_0000025 | 3300061734 | Bacteria | 67946 |
| 717 | Ga0530510_0029874 | 3300061734 | Bacteria | 3913 |
| 718 | Ga0530510_0031934 | 3300061734 | Bacteria | 3786 |
| 719 | Ga0530510_0179300 | 3300061734 | Bacteria | 1571 |
| 720 | Ga0530510_0718303 | 3300061734 | Bacteria | 762 |
| 721 | Ga0530510_0914008 | 3300061734 | Bacteria | 671 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042876 | Ga0451577_0295487 | Ga0451577_0295487_22_516 | 163 |
| 2 | 3300049571 | Ga0501034_0267271 | Ga0501034_0267271_34_609 | 169 |
| 3 | 3300046615 | Ga0495656_0418056 | Ga0495656_0418056_117_686 | 170 |
| 4 | 3300035172 | Ga0373955_0032310 | Ga0373955_0032310_1257_1865 | 171 |
| 5 | 3300036401 | Ga0373937_0018232 | Ga0373937_0018232_949_1557 | 171 |
| 6 | 3300044673 | Ga0453683_0008865 | Ga0453683_0008865_5670_6308 | 172 |
| 7 | 3300044712 | Ga0453684_0319046 | Ga0453684_0319046_835_1473 | 172 |
| 8 | 3300045051 | Ga0451576_0248548 | Ga0451576_0248548_1167_1805 | 172 |
| 9 | 3300005435 | Ga0070714_100002469 | Ga0070714_10000246911 | 174 |
| 10 | 3300025929 | Ga0207664_10000775 | Ga0207664_1000077511 | 174 |
| 11 | 3300035398 | Ga0316574_0621254 | Ga0316574_0621254_36_563 | 174 |
| 12 | 3300048919 | Ga0496116_0011339 | Ga0496116_0011339_4251_4832 | 174 |
| 13 | 3300048920 | Ga0496117_0072927 | Ga0496117_0072927_1657_2238 | 174 |
| 14 | 3300048929 | Ga0496126_0071417 | Ga0496126_0071417_2461_3042 | 174 |
| 15 | 3300035083 | Ga0373926_0030472 | Ga0373926_0030472_733_1368 | 176 |
| 16 | 3300035724 | Ga0373933_0032118 | Ga0373933_0032118_504_1070 | 176 |
| 17 | 3300005436 | Ga0070713_100050204 | Ga0070713_1000502043 | 179 |
| 18 | 3300005439 | Ga0070711_100074211 | Ga0070711_1000742111 | 179 |
| 19 | 3300025906 | Ga0207699_10045218 | Ga0207699_100452181 | 179 |
| 20 | 3300025916 | Ga0207663_10037520 | Ga0207663_100375203 | 179 |
| 21 | 3300025928 | Ga0207700_10014832 | Ga0207700_100148324 | 179 |
| 22 | 3300028573 | Ga0265334_10000008 | Ga0265334_1000000828 | 179 |
| 23 | 3300028573 | Ga0265334_10008371 | Ga0265334_100083712 | 179 |
| 24 | 3300028800 | Ga0265338_10030934 | Ga0265338_100309345 | 179 |
| 25 | 3300031241 | Ga0265325_10110575 | Ga0265325_101105752 | 179 |
| 26 | 3300031595 | Ga0265313_10000807 | Ga0265313_100008073 | 179 |
| 27 | 3300031595 | Ga0265313_10016684 | Ga0265313_100166843 | 179 |
| 28 | 3300046517 | Ga0495630_0249078 | Ga0495630_0249078_149_715 | 179 |
| 29 | 3300006175 | Ga0070712_100062834 | Ga0070712_1000628343 | 180 |
| 30 | 3300025915 | Ga0207693_10096623 | Ga0207693_100966232 | 180 |
| 31 | 3300035695 | Ga0373927_0000010 | Ga0373927_0000010_98116_98682 | 180 |
| 32 | iso_pu_bacteria | 2740891818 | 2740993888 | 182 |
| 33 | 3300005436 | Ga0070713_101014263 | Ga0070713_1010142631 | 185 |
| 34 | 3300005614 | Ga0068856_100812794 | Ga0068856_1008127942 | 185 |
| 35 | 3300021358 | Ga0213873_10077997 | Ga0213873_100779971 | 185 |
| 36 | 3300021384 | Ga0213876_10004444 | Ga0213876_100044442 | 185 |
| 37 | 3300021384 | Ga0213876_10083935 | Ga0213876_100839351 | 185 |
| 38 | 3300021388 | Ga0213875_10020553 | Ga0213875_100205535 | 185 |
| 39 | 3300025929 | Ga0207664_10213879 | Ga0207664_102138792 | 185 |
| 40 | 3300026078 | Ga0207702_10764864 | Ga0207702_107648642 | 185 |
| 41 | 3300031665 | Ga0316575_10062069 | Ga0316575_100620692 | 185 |
| 42 | 3300032168 | Ga0316593_10151988 | Ga0316593_101519881 | 185 |
| 43 | 3300037853 | Ga0436364_0095069 | Ga0436364_0095069_580_1140 | 185 |
| 44 | 3300037853 | Ga0436364_0472331 | Ga0436364_0472331_760_1323 | 185 |
| 45 | 3300037853 | Ga0436364_0782091 | Ga0436364_0782091_961_1671 | 185 |
| 46 | 3300037853 | Ga0436364_1384597 | Ga0436364_1384597_560_1120 | 185 |
| 47 | 3300037853 | Ga0436364_1458736 | Ga0436364_1458736_107_667 | 185 |
| 48 | 3300037853 | Ga0436364_1521721 | Ga0436364_1521721_14706_15266 | 185 |
| 49 | 3300039437 | Ga0436365_0551274 | Ga0436365_0551274_1415_1975 | 185 |
| 50 | 3300039437 | Ga0436365_0985493 | Ga0436365_0985493_4951_5514 | 185 |
| 51 | 3300039437 | Ga0436365_1406444 | Ga0436365_1406444_6731_7291 | 185 |
| 52 | 3300039453 | Ga0436362_0154526 | Ga0436362_0154526_1170_1733 | 185 |
| 53 | 3300039453 | Ga0436362_0621652 | Ga0436362_0621652_366_926 | 185 |
| 54 | 3300042876 | Ga0451577_0000195 | Ga0451577_0000195_110929_111489 | 185 |
| 55 | 3300044656 | Ga0466969_0125122 | Ga0466969_0125122_315_878 | 185 |
| 56 | 3300044683 | Ga0466965_0073005 | Ga0466965_0073005_581_1186 | 185 |
| 57 | 3300044683 | Ga0466965_0113651 | Ga0466965_0113651_225_800 | 185 |
| 58 | 3300044693 | Ga0466961_0353683 | Ga0466961_0353683_100_660 | 185 |
| 59 | 3300044694 | Ga0466963_0001470 | Ga0466963_0001470_8988_9593 | 185 |
| 60 | 3300044694 | Ga0466963_0025272 | Ga0466963_0025272_89_652 | 185 |
| 61 | 3300044694 | Ga0466963_0165967 | Ga0466963_0165967_395_955 | 185 |
| 62 | 3300044694 | Ga0466963_0208457 | Ga0466963_0208457_68_628 | 185 |
| 63 | 3300044694 | Ga0466963_0425998 | Ga0466963_0425998_99_659 | 185 |
| 64 | 3300044694 | Ga0466963_0495143 | Ga0466963_0495143_113_673 | 185 |
| 65 | 3300044712 | Ga0453684_0000017 | Ga0453684_0000017_456451_457017 | 185 |
| 66 | 3300044712 | Ga0453684_0000635 | Ga0453684_0000635_15968_16528 | 185 |
| 67 | 3300044712 | Ga0453684_0267466 | Ga0453684_0267466_626_1192 | 185 |
| 68 | 3300044719 | Ga0466971_0050995 | Ga0466971_0050995_318_923 | 185 |
| 69 | 3300044735 | Ga0466968_0051375 | Ga0466968_0051375_575_1138 | 185 |
| 70 | 3300044735 | Ga0466968_0080260 | Ga0466968_0080260_741_1304 | 185 |
| 71 | 3300044735 | Ga0466968_0134507 | Ga0466968_0134507_28_591 | 185 |
| 72 | 3300044735 | Ga0466968_0189850 | Ga0466968_0189850_247_810 | 185 |
| 73 | 3300044735 | Ga0466968_0268326 | Ga0466968_0268326_145_708 | 185 |
| 74 | 3300044765 | Ga0466970_0016470 | Ga0466970_0016470_38_601 | 185 |
| 75 | 3300044765 | Ga0466970_0033911 | Ga0466970_0033911_1098_1703 | 185 |
| 76 | 3300044842 | Ga0466957_0039036 | Ga0466957_0039036_1867_2472 | 185 |
| 77 | 3300045049 | Ga0466959_0138376 | Ga0466959_0138376_1149_1712 | 185 |
| 78 | 3300045049 | Ga0466959_0162928 | Ga0466959_0162928_648_1208 | 185 |
| 79 | 3300045836 | Ga0466958_0002260 | Ga0466958_0002260_8929_9492 | 185 |
| 80 | 3300045836 | Ga0466958_0011885 | Ga0466958_0011885_2698_3303 | 185 |
| 81 | 3300045836 | Ga0466958_0028047 | Ga0466958_0028047_1820_2380 | 185 |
| 82 | 3300045836 | Ga0466958_0040257 | Ga0466958_0040257_1438_1998 | 185 |
| 83 | 3300045976 | Ga0466967_0007683 | Ga0466967_0007683_6115_6720 | 185 |
| 84 | 3300045976 | Ga0466967_0190306 | Ga0466967_0190306_387_950 | 185 |
| 85 | 3300045976 | Ga0466967_0846585 | Ga0466967_0846585_254_814 | 185 |
| 86 | 3300045976 | Ga0466967_1057445 | Ga0466967_1057445_151_711 | 185 |
| 87 | 3300045976 | Ga0466967_1518777 | Ga0466967_1518777_85_648 | 185 |
| 88 | 3300046462 | Ga0495651_0366657 | Ga0495651_0366657_289_849 | 185 |
| 89 | 3300046529 | Ga0495652_0441204 | Ga0495652_0441204_249_809 | 185 |
| 90 | 3300046559 | Ga0495667_0276210 | Ga0495667_0276210_321_881 | 185 |
| 91 | 3300046663 | Ga0495635_0576678 | Ga0495635_0576678_16_576 | 185 |
| 92 | 3300046675 | Ga0495657_0360552 | Ga0495657_0360552_113_673 | 185 |
| 93 | 3300048918 | Ga0496115_0864378 | Ga0496115_0864378_85_645 | 185 |
| 94 | 3300049580 | Ga0501046_0394763 | Ga0501046_0394763_278_835 | 185 |
| 95 | 3300049591 | Ga0501075_0154177 | Ga0501075_0154177_1025_1582 | 185 |
| 96 | 3300049743 | Ga0501081_0352592 | Ga0501081_0352592_167_724 | 185 |
| 97 | 3300061719 | Ga0466962_0021345 | Ga0466962_0021345_841_1446 | 185 |
| 98 | 3300061719 | Ga0466962_0217762 | Ga0466962_0217762_65_625 | 185 |
| 99 | 3300005290 | Ga0065712_10043345 | Ga0065712_100433452 | 186 |
| 100 | 3300005293 | Ga0065715_10708533 | Ga0065715_107085331 | 186 |
| 101 | 3300005295 | Ga0065707_10081830 | Ga0065707_1008183019 | 186 |
| 102 | 3300005328 | Ga0070676_10424221 | Ga0070676_104242212 | 186 |
| 103 | 3300005331 | Ga0070670_100244689 | Ga0070670_1002446892 | 186 |
| 104 | 3300005331 | Ga0070670_100304224 | Ga0070670_1003042242 | 186 |
| 105 | 3300005333 | Ga0070677_10163256 | Ga0070677_101632562 | 186 |
| 106 | 3300005334 | Ga0068869_100287374 | Ga0068869_1002873742 | 186 |
| 107 | 3300005334 | Ga0068869_100950098 | Ga0068869_1009500981 | 186 |
| 108 | 3300005335 | Ga0070666_10003946 | Ga0070666_100039462 | 186 |
| 109 | 3300005336 | Ga0070680_100039008 | Ga0070680_1000390083 | 186 |
| 110 | 3300005337 | Ga0070682_100513204 | Ga0070682_1005132041 | 186 |
| 111 | 3300005338 | Ga0068868_100010077 | Ga0068868_1000100772 | 186 |
| 112 | 3300005340 | Ga0070689_101026157 | Ga0070689_1010261571 | 186 |
| 113 | 3300005344 | Ga0070661_100402956 | Ga0070661_1004029561 | 186 |
| 114 | 3300005344 | Ga0070661_100407410 | Ga0070661_1004074101 | 186 |
| 115 | 3300005345 | Ga0070692_10114467 | Ga0070692_101144672 | 186 |
| 116 | 3300005345 | Ga0070692_10408415 | Ga0070692_104084152 | 186 |
| 117 | 3300005347 | Ga0070668_100016735 | Ga0070668_1000167353 | 186 |
| 118 | 3300005353 | Ga0070669_100006860 | Ga0070669_1000068603 | 186 |
| 119 | 3300005354 | Ga0070675_100014787 | Ga0070675_1000147871 | 186 |
| 120 | 3300005354 | Ga0070675_100107813 | Ga0070675_1001078132 | 186 |
| 121 | 3300005355 | Ga0070671_100001122 | Ga0070671_1000011224 | 186 |
| 122 | 3300005355 | Ga0070671_100149840 | Ga0070671_1001498402 | 186 |
| 123 | 3300005355 | Ga0070671_101058306 | Ga0070671_1010583061 | 186 |
| 124 | 3300005356 | Ga0070674_100008237 | Ga0070674_1000082372 | 186 |
| 125 | 3300005356 | Ga0070674_101006415 | Ga0070674_1010064151 | 186 |
| 126 | 3300005364 | Ga0070673_100162927 | Ga0070673_1001629273 | 186 |
| 127 | 3300005364 | Ga0070673_100259696 | Ga0070673_1002596962 | 186 |
| 128 | 3300005367 | Ga0070667_100000057 | Ga0070667_10000005749 | 186 |
| 129 | 3300005367 | Ga0070667_100003459 | Ga0070667_10000345911 | 186 |
| 130 | 3300005438 | Ga0070701_10000431 | Ga0070701_100004317 | 186 |
| 131 | 3300005440 | Ga0070705_100434479 | Ga0070705_1004344791 | 186 |
| 132 | 3300005444 | Ga0070694_100105738 | Ga0070694_1001057382 | 186 |
| 133 | 3300005444 | Ga0070694_100225662 | Ga0070694_1002256622 | 186 |
| 134 | 3300005457 | Ga0070662_100001466 | Ga0070662_1000014666 | 186 |
| 135 | 3300005459 | Ga0068867_100024206 | Ga0068867_1000242063 | 186 |
| 136 | 3300005535 | Ga0070684_100340880 | Ga0070684_1003408802 | 186 |
| 137 | 3300005543 | Ga0070672_100002589 | Ga0070672_1000025899 | 186 |
| 138 | 3300005543 | Ga0070672_100498998 | Ga0070672_1004989982 | 186 |
| 139 | 3300005543 | Ga0070672_100651918 | Ga0070672_1006519182 | 186 |
| 140 | 3300005544 | Ga0070686_100006322 | Ga0070686_1000063227 | 186 |
| 141 | 3300005545 | Ga0070695_100676633 | Ga0070695_1006766332 | 186 |
| 142 | 3300005548 | Ga0070665_100019642 | Ga0070665_1000196426 | 186 |
| 143 | 3300005548 | Ga0070665_100087190 | Ga0070665_1000871903 | 186 |
| 144 | 3300005549 | Ga0070704_100006386 | Ga0070704_1000063866 | 186 |
| 145 | 3300005549 | Ga0070704_100037467 | Ga0070704_1000374673 | 186 |
| 146 | 3300005564 | Ga0070664_100005398 | Ga0070664_1000053981 | 186 |
| 147 | 3300005615 | Ga0070702_100068038 | Ga0070702_1000680383 | 186 |
| 148 | 3300005616 | Ga0068852_100145339 | Ga0068852_1001453393 | 186 |
| 149 | 3300005617 | Ga0068859_100031182 | Ga0068859_1000311823 | 186 |
| 150 | 3300005617 | Ga0068859_100056395 | Ga0068859_1000563954 | 186 |
| 151 | 3300005617 | Ga0068859_100255010 | Ga0068859_1002550102 | 186 |
| 152 | 3300005617 | Ga0068859_101028974 | Ga0068859_1010289742 | 186 |
| 153 | 3300005618 | Ga0068864_100003919 | Ga0068864_1000039194 | 186 |
| 154 | 3300005618 | Ga0068864_100076795 | Ga0068864_1000767952 | 186 |
| 155 | 3300005719 | Ga0068861_100054591 | Ga0068861_1000545912 | 186 |
| 156 | 3300005719 | Ga0068861_100792627 | Ga0068861_1007926272 | 186 |
| 157 | 3300005840 | Ga0068870_10025601 | Ga0068870_100256012 | 186 |
| 158 | 3300005840 | Ga0068870_10079413 | Ga0068870_100794132 | 186 |
| 159 | 3300005841 | Ga0068863_100001117 | Ga0068863_10000111722 | 186 |
| 160 | 3300005842 | Ga0068858_100024492 | Ga0068858_1000244925 | 186 |
| 161 | 3300005842 | Ga0068858_100040342 | Ga0068858_1000403422 | 186 |
| 162 | 3300005843 | Ga0068860_100036640 | Ga0068860_1000366402 | 186 |
| 163 | 3300005843 | Ga0068860_100243968 | Ga0068860_1002439682 | 186 |
| 164 | 3300005844 | Ga0068862_100019309 | Ga0068862_1000193095 | 186 |
| 165 | 3300005844 | Ga0068862_100218545 | Ga0068862_1002185451 | 186 |
| 166 | 3300006194 | Ga0075427_10019405 | Ga0075427_100194052 | 186 |
| 167 | 3300006237 | Ga0097621_100023783 | Ga0097621_1000237834 | 186 |
| 168 | 3300006237 | Ga0097621_100133484 | Ga0097621_1001334842 | 186 |
| 169 | 3300006358 | Ga0068871_100018593 | Ga0068871_1000185936 | 186 |
| 170 | 3300006358 | Ga0068871_100095366 | Ga0068871_1000953662 | 186 |
| 171 | 3300006358 | Ga0068871_100522531 | Ga0068871_1005225312 | 186 |
| 172 | 3300006844 | Ga0075428_100006380 | Ga0075428_1000063809 | 186 |
| 173 | 3300006844 | Ga0075428_100007135 | Ga0075428_1000071356 | 186 |
| 174 | 3300006844 | Ga0075428_100025918 | Ga0075428_1000259184 | 186 |
| 175 | 3300006844 | Ga0075428_100061093 | Ga0075428_1000610934 | 186 |
| 176 | 3300006844 | Ga0075428_100126578 | Ga0075428_1001265784 | 186 |
| 177 | 3300006846 | Ga0075430_100003451 | Ga0075430_1000034515 | 186 |
| 178 | 3300006846 | Ga0075430_100062492 | Ga0075430_1000624923 | 186 |
| 179 | 3300006846 | Ga0075430_100219009 | Ga0075430_1002190092 | 186 |
| 180 | 3300006846 | Ga0075430_100229917 | Ga0075430_1002299172 | 186 |
| 181 | 3300006846 | Ga0075430_100248649 | Ga0075430_1002486492 | 186 |
| 182 | 3300006847 | Ga0075431_100015225 | Ga0075431_1000152254 | 186 |
| 183 | 3300006847 | Ga0075431_100015713 | Ga0075431_1000157135 | 186 |
| 184 | 3300006847 | Ga0075431_100016725 | Ga0075431_1000167252 | 186 |
| 185 | 3300006852 | Ga0075433_10012077 | Ga0075433_100120774 | 186 |
| 186 | 3300006880 | Ga0075429_100022299 | Ga0075429_1000222993 | 186 |
| 187 | 3300006880 | Ga0075429_100063954 | Ga0075429_1000639542 | 186 |
| 188 | 3300006880 | Ga0075429_100073706 | Ga0075429_1000737062 | 186 |
| 189 | 3300006881 | Ga0068865_100020120 | Ga0068865_1000201202 | 186 |
| 190 | 3300006881 | Ga0068865_100329234 | Ga0068865_1003292342 | 186 |
| 191 | 3300006931 | Ga0097620_100031181 | Ga0097620_1000311814 | 186 |
| 192 | 3300006931 | Ga0097620_100056396 | Ga0097620_1000563964 | 186 |
| 193 | 3300006931 | Ga0097620_100255002 | Ga0097620_1002550022 | 186 |
| 194 | 3300006931 | Ga0097620_101028990 | Ga0097620_1010289902 | 186 |
| 195 | 3300007076 | Ga0075435_100273939 | Ga0075435_1002739392 | 186 |
| 196 | 3300007788 | Ga0099795_10000016 | Ga0099795_1000001650 | 186 |
| 197 | 3300009092 | Ga0105250_10189431 | Ga0105250_101894311 | 186 |
| 198 | 3300009093 | Ga0105240_10000101 | Ga0105240_1000010115 | 186 |
| 199 | 3300009093 | Ga0105240_10281241 | Ga0105240_102812412 | 186 |
| 200 | 3300009093 | Ga0105240_10344033 | Ga0105240_103440331 | 186 |
| 201 | 3300009094 | Ga0111539_10006436 | Ga0111539_1000643611 | 186 |
| 202 | 3300009094 | Ga0111539_10006586 | Ga0111539_100065864 | 186 |
| 203 | 3300009094 | Ga0111539_10044904 | Ga0111539_100449043 | 186 |
| 204 | 3300009094 | Ga0111539_10070320 | Ga0111539_100703206 | 186 |
| 205 | 3300009094 | Ga0111539_10190009 | Ga0111539_101900092 | 186 |
| 206 | 3300009098 | Ga0105245_10002513 | Ga0105245_100025134 | 186 |
| 207 | 3300009098 | Ga0105245_10091944 | Ga0105245_100919442 | 186 |
| 208 | 3300009147 | Ga0114129_10000484 | Ga0114129_1000048433 | 186 |
| 209 | 3300009147 | Ga0114129_10135002 | Ga0114129_101350023 | 186 |
| 210 | 3300009147 | Ga0114129_10318070 | Ga0114129_103180702 | 186 |
| 211 | 3300009147 | Ga0114129_10784810 | Ga0114129_107848102 | 186 |
| 212 | 3300009148 | Ga0105243_10626727 | Ga0105243_106267272 | 186 |
| 213 | 3300009174 | Ga0105241_10194687 | Ga0105241_101946871 | 186 |
| 214 | 3300009176 | Ga0105242_10033199 | Ga0105242_100331993 | 186 |
| 215 | 3300009176 | Ga0105242_10217876 | Ga0105242_102178762 | 186 |
| 216 | 3300009177 | Ga0105248_10046833 | Ga0105248_100468333 | 186 |
| 217 | 3300009177 | Ga0105248_10124153 | Ga0105248_101241531 | 186 |
| 218 | 3300009177 | Ga0105248_11175915 | Ga0105248_111759151 | 186 |
| 219 | 3300009545 | Ga0105237_10245672 | Ga0105237_102456721 | 186 |
| 220 | 3300009551 | Ga0105238_10026253 | Ga0105238_100262534 | 186 |
| 221 | 3300009551 | Ga0105238_11652782 | Ga0105238_116527821 | 186 |
| 222 | 3300009553 | Ga0105249_12107841 | Ga0105249_121078411 | 186 |
| 223 | 3300009984 | Ga0105029_102958 | Ga0105029_1029582 | 186 |
| 224 | 3300009987 | Ga0105030_100295 | Ga0105030_1002952 | 186 |
| 225 | 3300010159 | Ga0099796_10112701 | Ga0099796_101127012 | 186 |
| 226 | 3300010375 | Ga0105239_10024104 | Ga0105239_100241044 | 186 |
| 227 | 3300010375 | Ga0105239_10924686 | Ga0105239_109246862 | 186 |
| 228 | 3300011119 | Ga0105246_10004016 | Ga0105246_100040166 | 186 |
| 229 | 3300011119 | Ga0105246_10284653 | Ga0105246_102846532 | 186 |
| 230 | 3300013102 | Ga0157371_10357552 | Ga0157371_103575522 | 186 |
| 231 | 3300013296 | Ga0157374_10000998 | Ga0157374_1000099812 | 186 |
| 232 | 3300013296 | Ga0157374_10012516 | Ga0157374_100125166 | 186 |
| 233 | 3300013297 | Ga0157378_10085479 | Ga0157378_100854792 | 186 |
| 234 | 3300013306 | Ga0163162_10005163 | Ga0163162_100051637 | 186 |
| 235 | 3300013306 | Ga0163162_10129404 | Ga0163162_101294042 | 186 |
| 236 | 3300013308 | Ga0157375_10027005 | Ga0157375_100270053 | 186 |
| 237 | 3300013308 | Ga0157375_10083926 | Ga0157375_100839262 | 186 |
| 238 | 3300014325 | Ga0163163_10001153 | Ga0163163_100011535 | 186 |
| 239 | 3300014325 | Ga0163163_10005365 | Ga0163163_100053659 | 186 |
| 240 | 3300014325 | Ga0163163_10008089 | Ga0163163_100080895 | 186 |
| 241 | 3300014325 | Ga0163163_10029771 | Ga0163163_100297713 | 186 |
| 242 | 3300014325 | Ga0163163_10700698 | Ga0163163_107006982 | 186 |
| 243 | 3300014326 | Ga0157380_10000204 | Ga0157380_1000020411 | 186 |
| 244 | 3300014326 | Ga0157380_10010405 | Ga0157380_100104054 | 186 |
| 245 | 3300014326 | Ga0157380_10038954 | Ga0157380_100389542 | 186 |
| 246 | 3300014326 | Ga0157380_10062125 | Ga0157380_100621254 | 186 |
| 247 | 3300014326 | Ga0157380_10232736 | Ga0157380_102327362 | 186 |
| 248 | 3300014326 | Ga0157380_10785351 | Ga0157380_107853511 | 186 |
| 249 | 3300014326 | Ga0157380_10954651 | Ga0157380_109546512 | 186 |
| 250 | 3300014745 | Ga0157377_10014955 | Ga0157377_100149553 | 186 |
| 251 | 3300014745 | Ga0157377_10446375 | Ga0157377_104463752 | 186 |
| 252 | 3300014968 | Ga0157379_10004734 | Ga0157379_100047345 | 186 |
| 253 | 3300014968 | Ga0157379_10019822 | Ga0157379_100198224 | 186 |
| 254 | 3300014969 | Ga0157376_10005590 | Ga0157376_100055908 | 186 |
| 255 | 3300014969 | Ga0157376_10019028 | Ga0157376_100190282 | 186 |
| 256 | 3300021384 | Ga0213876_10019875 | Ga0213876_100198752 | 186 |
| 257 | 3300025711 | Ga0207696_1091905 | Ga0207696_10919051 | 186 |
| 258 | 3300025893 | Ga0207682_10080166 | Ga0207682_100801662 | 186 |
| 259 | 3300025899 | Ga0207642_10007513 | Ga0207642_100075132 | 186 |
| 260 | 3300025901 | Ga0207688_10165595 | Ga0207688_101655952 | 186 |
| 261 | 3300025903 | Ga0207680_10003496 | Ga0207680_100034964 | 186 |
| 262 | 3300025903 | Ga0207680_10085972 | Ga0207680_100859724 | 186 |
| 263 | 3300025903 | Ga0207680_10145208 | Ga0207680_101452082 | 186 |
| 264 | 3300025903 | Ga0207680_10934754 | Ga0207680_109347541 | 186 |
| 265 | 3300025907 | Ga0207645_10000405 | Ga0207645_1000040518 | 186 |
| 266 | 3300025907 | Ga0207645_10391099 | Ga0207645_103910992 | 186 |
| 267 | 3300025908 | Ga0207643_10008333 | Ga0207643_100083332 | 186 |
| 268 | 3300025911 | Ga0207654_10552732 | Ga0207654_105527321 | 186 |
| 269 | 3300025913 | Ga0207695_10078683 | Ga0207695_100786832 | 186 |
| 270 | 3300025913 | Ga0207695_10559093 | Ga0207695_105590931 | 186 |
| 271 | 3300025914 | Ga0207671_10184152 | Ga0207671_101841523 | 186 |
| 272 | 3300025918 | Ga0207662_10717722 | Ga0207662_107177221 | 186 |
| 273 | 3300025920 | Ga0207649_10342428 | Ga0207649_103424282 | 186 |
| 274 | 3300025925 | Ga0207650_10023090 | Ga0207650_100230905 | 186 |
| 275 | 3300025926 | Ga0207659_10019401 | Ga0207659_100194011 | 186 |
| 276 | 3300025927 | Ga0207687_10019628 | Ga0207687_100196283 | 186 |
| 277 | 3300025927 | Ga0207687_10123810 | Ga0207687_101238102 | 186 |
| 278 | 3300025931 | Ga0207644_10038556 | Ga0207644_100385562 | 186 |
| 279 | 3300025932 | Ga0207690_10249486 | Ga0207690_102494863 | 186 |
| 280 | 3300025933 | Ga0207706_10001790 | Ga0207706_100017907 | 186 |
| 281 | 3300025934 | Ga0207686_10097646 | Ga0207686_100976462 | 186 |
| 282 | 3300025936 | Ga0207670_10335453 | Ga0207670_103354532 | 186 |
| 283 | 3300025938 | Ga0207704_10253500 | Ga0207704_102535002 | 186 |
| 284 | 3300025940 | Ga0207691_10001027 | Ga0207691_1000102715 | 186 |
| 285 | 3300025940 | Ga0207691_10067881 | Ga0207691_100678812 | 186 |
| 286 | 3300025941 | Ga0207711_10002654 | Ga0207711_100026543 | 186 |
| 287 | 3300025942 | Ga0207689_10171369 | Ga0207689_101713692 | 186 |
| 288 | 3300025944 | Ga0207661_10363375 | Ga0207661_103633752 | 186 |
| 289 | 3300025960 | Ga0207651_10038107 | Ga0207651_100381072 | 186 |
| 290 | 3300025960 | Ga0207651_10141667 | Ga0207651_101416673 | 186 |
| 291 | 3300025972 | Ga0207668_10173980 | Ga0207668_101739802 | 186 |
| 292 | 3300025986 | Ga0207658_10000186 | Ga0207658_1000018657 | 186 |
| 293 | 3300025986 | Ga0207658_10009925 | Ga0207658_100099255 | 186 |
| 294 | 3300026023 | Ga0207677_10011639 | Ga0207677_100116392 | 186 |
| 295 | 3300026023 | Ga0207677_10174557 | Ga0207677_101745571 | 186 |
| 296 | 3300026035 | Ga0207703_10001486 | Ga0207703_1000148610 | 186 |
| 297 | 3300026035 | Ga0207703_10001744 | Ga0207703_1000174417 | 186 |
| 298 | 3300026075 | Ga0207708_10026816 | Ga0207708_100268166 | 186 |
| 299 | 3300026075 | Ga0207708_10134655 | Ga0207708_101346551 | 186 |
| 300 | 3300026088 | Ga0207641_10088617 | Ga0207641_100886172 | 186 |
| 301 | 3300026088 | Ga0207641_10222603 | Ga0207641_102226032 | 186 |
| 302 | 3300026089 | Ga0207648_10001055 | Ga0207648_1000105524 | 186 |
| 303 | 3300026089 | Ga0207648_10073680 | Ga0207648_100736803 | 186 |
| 304 | 3300026095 | Ga0207676_10001802 | Ga0207676_1000180213 | 186 |
| 305 | 3300026095 | Ga0207676_10037050 | Ga0207676_100370502 | 186 |
| 306 | 3300026116 | Ga0207674_11183490 | Ga0207674_111834901 | 186 |
| 307 | 3300026118 | Ga0207675_100002054 | Ga0207675_10000205410 | 186 |
| 308 | 3300026118 | Ga0207675_100020391 | Ga0207675_1000203911 | 186 |
| 309 | 3300026118 | Ga0207675_101326344 | Ga0207675_1013263441 | 186 |
| 310 | 3300026121 | Ga0207683_10183379 | Ga0207683_101833792 | 186 |
| 311 | 3300026142 | Ga0207698_10044748 | Ga0207698_100447482 | 186 |
| 312 | 3300027512 | Ga0209179_1000114 | Ga0209179_10001149 | 186 |
| 313 | 3300027617 | Ga0210002_1002615 | Ga0210002_10026153 | 186 |
| 314 | 3300027617 | Ga0210002_1013203 | Ga0210002_10132032 | 186 |
| 315 | 3300027665 | Ga0209983_1005483 | Ga0209983_10054831 | 186 |
| 316 | 3300027682 | Ga0209971_1000201 | Ga0209971_100020110 | 186 |
| 317 | 3300027695 | Ga0209966_1021264 | Ga0209966_10212642 | 186 |
| 318 | 3300027717 | Ga0209998_10000396 | Ga0209998_100003966 | 186 |
| 319 | 3300027876 | Ga0209974_10002740 | Ga0209974_100027404 | 186 |
| 320 | 3300027876 | Ga0209974_10053400 | Ga0209974_100534002 | 186 |
| 321 | 3300027907 | Ga0207428_10014539 | Ga0207428_100145392 | 186 |
| 322 | 3300027907 | Ga0207428_10082979 | Ga0207428_100829792 | 186 |
| 323 | 3300028379 | Ga0268266_10032473 | Ga0268266_100324732 | 186 |
| 324 | 3300028379 | Ga0268266_10046536 | Ga0268266_100465363 | 186 |
| 325 | 3300028380 | Ga0268265_11021922 | Ga0268265_110219221 | 186 |
| 326 | 3300028381 | Ga0268264_10012855 | Ga0268264_100128554 | 186 |
| 327 | 3300028381 | Ga0268264_10647495 | Ga0268264_106474952 | 186 |
| 328 | 3300028800 | Ga0265338_10073443 | Ga0265338_100734431 | 186 |
| 329 | 3300028800 | Ga0265338_10367745 | Ga0265338_103677451 | 186 |
| 330 | 3300031247 | Ga0265340_10011441 | Ga0265340_100114413 | 186 |
| 331 | 3300031247 | Ga0265340_10059055 | Ga0265340_100590552 | 186 |
| 332 | 3300031251 | Ga0265327_10000005 | Ga0265327_1000000598 | 186 |
| 333 | 3300031251 | Ga0265327_10000098 | Ga0265327_100000989 | 186 |
| 334 | 3300031456 | Ga0307513_10075796 | Ga0307513_100757963 | 186 |
| 335 | 3300031507 | Ga0307509_10001421 | Ga0307509_1000142135 | 186 |
| 336 | 3300031548 | Ga0307408_100056372 | Ga0307408_1000563724 | 186 |
| 337 | 3300031548 | Ga0307408_100243512 | Ga0307408_1002435122 | 186 |
| 338 | 3300031548 | Ga0307408_101044834 | Ga0307408_1010448341 | 186 |
| 339 | 3300031665 | Ga0316575_10000434 | Ga0316575_100004345 | 186 |
| 340 | 3300031665 | Ga0316575_10006068 | Ga0316575_100060685 | 186 |
| 341 | 3300031665 | Ga0316575_10006908 | Ga0316575_100069083 | 186 |
| 342 | 3300031665 | Ga0316575_10011102 | Ga0316575_100111024 | 186 |
| 343 | 3300031665 | Ga0316575_10014122 | Ga0316575_100141222 | 186 |
| 344 | 3300031665 | Ga0316575_10039087 | Ga0316575_100390872 | 186 |
| 345 | 3300031665 | Ga0316575_10108905 | Ga0316575_101089052 | 186 |
| 346 | 3300031665 | Ga0316575_10123216 | Ga0316575_101232162 | 186 |
| 347 | 3300031665 | Ga0316575_10124053 | Ga0316575_101240532 | 186 |
| 348 | 3300031665 | Ga0316575_10203574 | Ga0316575_102035741 | 186 |
| 349 | 3300031691 | Ga0316579_10017663 | Ga0316579_100176633 | 186 |
| 350 | 3300031691 | Ga0316579_10051329 | Ga0316579_100513292 | 186 |
| 351 | 3300031691 | Ga0316579_10102701 | Ga0316579_101027012 | 186 |
| 352 | 3300031691 | Ga0316579_10118325 | Ga0316579_101183252 | 186 |
| 353 | 3300031691 | Ga0316579_10132037 | Ga0316579_101320372 | 186 |
| 354 | 3300031691 | Ga0316579_10190841 | Ga0316579_101908411 | 186 |
| 355 | 3300031727 | Ga0316576_10004519 | Ga0316576_100045194 | 186 |
| 356 | 3300031727 | Ga0316576_10009417 | Ga0316576_100094175 | 186 |
| 357 | 3300031727 | Ga0316576_10012742 | Ga0316576_100127424 | 186 |
| 358 | 3300031727 | Ga0316576_10014106 | Ga0316576_100141063 | 186 |
| 359 | 3300031727 | Ga0316576_10023890 | Ga0316576_100238903 | 186 |
| 360 | 3300031727 | Ga0316576_10045352 | Ga0316576_100453525 | 186 |
| 361 | 3300031727 | Ga0316576_10050305 | Ga0316576_100503053 | 186 |
| 362 | 3300031727 | Ga0316576_10063498 | Ga0316576_100634983 | 186 |
| 363 | 3300031727 | Ga0316576_10071043 | Ga0316576_100710433 | 186 |
| 364 | 3300031727 | Ga0316576_10074666 | Ga0316576_100746662 | 186 |
| 365 | 3300031727 | Ga0316576_10074865 | Ga0316576_100748652 | 186 |
| 366 | 3300031727 | Ga0316576_10113345 | Ga0316576_101133452 | 186 |
| 367 | 3300031727 | Ga0316576_10147296 | Ga0316576_101472961 | 186 |
| 368 | 3300031727 | Ga0316576_10176524 | Ga0316576_101765242 | 186 |
| 369 | 3300031727 | Ga0316576_10227417 | Ga0316576_102274172 | 186 |
| 370 | 3300031727 | Ga0316576_10257052 | Ga0316576_102570522 | 186 |
| 371 | 3300031727 | Ga0316576_10302135 | Ga0316576_103021352 | 186 |
| 372 | 3300031727 | Ga0316576_10307835 | Ga0316576_103078351 | 186 |
| 373 | 3300031727 | Ga0316576_10560186 | Ga0316576_105601862 | 186 |
| 374 | 3300031727 | Ga0316576_10874747 | Ga0316576_108747471 | 186 |
| 375 | 3300031728 | Ga0316578_10000045 | Ga0316578_100000452 | 186 |
| 376 | 3300031728 | Ga0316578_10014837 | Ga0316578_100148374 | 186 |
| 377 | 3300031728 | Ga0316578_10021669 | Ga0316578_100216695 | 186 |
| 378 | 3300031728 | Ga0316578_10029909 | Ga0316578_100299092 | 186 |
| 379 | 3300031728 | Ga0316578_10091959 | Ga0316578_100919593 | 186 |
| 380 | 3300031728 | Ga0316578_10213479 | Ga0316578_102134792 | 186 |
| 381 | 3300031731 | Ga0307405_10016582 | Ga0307405_100165822 | 186 |
| 382 | 3300031733 | Ga0316577_10005479 | Ga0316577_100054792 | 186 |
| 383 | 3300031733 | Ga0316577_10011805 | Ga0316577_100118053 | 186 |
| 384 | 3300031733 | Ga0316577_10015548 | Ga0316577_100155482 | 186 |
| 385 | 3300031733 | Ga0316577_10018147 | Ga0316577_100181473 | 186 |
| 386 | 3300031733 | Ga0316577_10021930 | Ga0316577_100219301 | 186 |
| 387 | 3300031733 | Ga0316577_10053984 | Ga0316577_100539842 | 186 |
| 388 | 3300031733 | Ga0316577_10098927 | Ga0316577_100989272 | 186 |
| 389 | 3300031733 | Ga0316577_10102366 | Ga0316577_101023661 | 186 |
| 390 | 3300031733 | Ga0316577_10157442 | Ga0316577_101574421 | 186 |
| 391 | 3300031733 | Ga0316577_10158405 | Ga0316577_101584052 | 186 |
| 392 | 3300031824 | Ga0307413_10087136 | Ga0307413_100871363 | 186 |
| 393 | 3300031852 | Ga0307410_10117924 | Ga0307410_101179242 | 186 |
| 394 | 3300031852 | Ga0307410_10534514 | Ga0307410_105345141 | 186 |
| 395 | 3300031901 | Ga0307406_10280103 | Ga0307406_102801031 | 186 |
| 396 | 3300031911 | Ga0307412_10063121 | Ga0307412_100631213 | 186 |
| 397 | 3300031911 | Ga0307412_10461548 | Ga0307412_104615482 | 186 |
| 398 | 3300031995 | Ga0307409_100005677 | Ga0307409_1000056774 | 186 |
| 399 | 3300031995 | Ga0307409_100284382 | Ga0307409_1002843822 | 186 |
| 400 | 3300032002 | Ga0307416_100137802 | Ga0307416_1001378023 | 186 |
| 401 | 3300032002 | Ga0307416_101174864 | Ga0307416_1011748642 | 186 |
| 402 | 3300032126 | Ga0307415_100001848 | Ga0307415_1000018482 | 186 |
| 403 | 3300032133 | Ga0316583_10008392 | Ga0316583_100083922 | 186 |
| 404 | 3300032133 | Ga0316583_10031567 | Ga0316583_100315671 | 186 |
| 405 | 3300032133 | Ga0316583_10031610 | Ga0316583_100316102 | 186 |
| 406 | 3300032133 | Ga0316583_10037455 | Ga0316583_100374552 | 186 |
| 407 | 3300032133 | Ga0316583_10039661 | Ga0316583_100396612 | 186 |
| 408 | 3300032133 | Ga0316583_10073060 | Ga0316583_100730602 | 186 |
| 409 | 3300032137 | Ga0316585_10004539 | Ga0316585_100045393 | 186 |
| 410 | 3300032137 | Ga0316585_10008553 | Ga0316585_100085532 | 186 |
| 411 | 3300032137 | Ga0316585_10022801 | Ga0316585_100228012 | 186 |
| 412 | 3300032137 | Ga0316585_10060090 | Ga0316585_100600902 | 186 |
| 413 | 3300032137 | Ga0316585_10070034 | Ga0316585_100700341 | 186 |
| 414 | 3300032137 | Ga0316585_10075987 | Ga0316585_100759872 | 186 |
| 415 | 3300032137 | Ga0316585_10093628 | Ga0316585_100936282 | 186 |
| 416 | 3300032139 | Ga0316580_10000990 | Ga0316580_100009902 | 186 |
| 417 | 3300032139 | Ga0316580_10002043 | Ga0316580_100020432 | 186 |
| 418 | 3300032139 | Ga0316580_10005631 | Ga0316580_100056313 | 186 |
| 419 | 3300032139 | Ga0316580_10014022 | Ga0316580_100140222 | 186 |
| 420 | 3300032139 | Ga0316580_10014141 | Ga0316580_100141412 | 186 |
| 421 | 3300032139 | Ga0316580_10032209 | Ga0316580_100322092 | 186 |
| 422 | 3300032139 | Ga0316580_10117113 | Ga0316580_101171131 | 186 |
| 423 | 3300032168 | Ga0316593_10038658 | Ga0316593_100386582 | 186 |
| 424 | 3300032168 | Ga0316593_10041535 | Ga0316593_100415352 | 186 |
| 425 | 3300032168 | Ga0316593_10133842 | Ga0316593_101338422 | 186 |
| 426 | 3300032168 | Ga0316593_10151807 | Ga0316593_101518072 | 186 |
| 427 | 3300033524 | Ga0316592_1002612 | Ga0316592_10026123 | 186 |
| 428 | 3300033524 | Ga0316592_1005685 | Ga0316592_10056852 | 186 |
| 429 | 3300033524 | Ga0316592_1008935 | Ga0316592_10089352 | 186 |
| 430 | 3300033524 | Ga0316592_1022851 | Ga0316592_10228512 | 186 |
| 431 | 3300033524 | Ga0316592_1030401 | Ga0316592_10304012 | 186 |
| 432 | 3300033524 | Ga0316592_1044878 | Ga0316592_10448782 | 186 |
| 433 | 3300033527 | Ga0316586_1002622 | Ga0316586_10026222 | 186 |
| 434 | 3300033527 | Ga0316586_1008710 | Ga0316586_10087102 | 186 |
| 435 | 3300033527 | Ga0316586_1043149 | Ga0316586_10431491 | 186 |
| 436 | 3300033528 | Ga0316588_1014477 | Ga0316588_10144772 | 186 |
| 437 | 3300033528 | Ga0316588_1023579 | Ga0316588_10235792 | 186 |
| 438 | 3300033528 | Ga0316588_1032334 | Ga0316588_10323342 | 186 |
| 439 | 3300033528 | Ga0316588_1052625 | Ga0316588_10526251 | 186 |
| 440 | 3300033529 | Ga0316587_1053063 | Ga0316587_10530631 | 186 |
| 441 | 3300033541 | Ga0316596_1003576 | Ga0316596_10035763 | 186 |
| 442 | 3300033541 | Ga0316596_1039416 | Ga0316596_10394161 | 186 |
| 443 | 3300033541 | Ga0316596_1052025 | Ga0316596_10520251 | 186 |
| 444 | 3300033541 | Ga0316596_1149458 | Ga0316596_11494581 | 186 |
| 445 | 3300033541 | Ga0316596_1155787 | Ga0316596_11557871 | 186 |
| 446 | 3300035241 | Ga0373961_0046137 | Ga0373961_0046137_376_981 | 186 |
| 447 | 3300035398 | Ga0316574_0000421 | Ga0316574_0000421_10262_10831 | 186 |
| 448 | 3300035398 | Ga0316574_0001360 | Ga0316574_0001360_10814_11377 | 186 |
| 449 | 3300035398 | Ga0316574_0006599 | Ga0316574_0006599_503_1072 | 186 |
| 450 | 3300035398 | Ga0316574_0009475 | Ga0316574_0009475_4482_5054 | 186 |
| 451 | 3300035398 | Ga0316574_0019775 | Ga0316574_0019775_321_890 | 186 |
| 452 | 3300035398 | Ga0316574_0020832 | Ga0316574_0020832_112_678 | 186 |
| 453 | 3300035398 | Ga0316574_0035364 | Ga0316574_0035364_696_1259 | 186 |
| 454 | 3300035398 | Ga0316574_0065558 | Ga0316574_0065558_330_902 | 186 |
| 455 | 3300035398 | Ga0316574_0091297 | Ga0316574_0091297_670_1239 | 186 |
| 456 | 3300035398 | Ga0316574_0101862 | Ga0316574_0101862_638_1204 | 186 |
| 457 | 3300035398 | Ga0316574_0180963 | Ga0316574_0180963_695_1258 | 186 |
| 458 | 3300035398 | Ga0316574_0199949 | Ga0316574_0199949_541_1107 | 186 |
| 459 | 3300035398 | Ga0316574_0485208 | Ga0316574_0485208_42_614 | 186 |
| 460 | 3300035691 | Ga0373931_0396110 | Ga0373931_0396110_191_760 | 186 |
| 461 | 3300035695 | Ga0373927_0206284 | Ga0373927_0206284_11_580 | 186 |
| 462 | 3300036401 | Ga0373937_0033260 | Ga0373937_0033260_215_784 | 186 |
| 463 | 3300036401 | Ga0373937_0137044 | Ga0373937_0137044_1178_1747 | 186 |
| 464 | 3300036401 | Ga0373937_0281635 | Ga0373937_0281635_314_880 | 186 |
| 465 | 3300036401 | Ga0373937_1523114 | Ga0373937_1523114_17_583 | 186 |
| 466 | 3300036647 | Ga0316582_0002483 | Ga0316582_0002483_7569_8132 | 186 |
| 467 | 3300036647 | Ga0316582_0013924 | Ga0316582_0013924_236_808 | 186 |
| 468 | 3300036647 | Ga0316582_0020709 | Ga0316582_0020709_2675_3238 | 186 |
| 469 | 3300036647 | Ga0316582_0038093 | Ga0316582_0038093_2392_2955 | 186 |
| 470 | 3300036647 | Ga0316582_0039759 | Ga0316582_0039759_1221_1784 | 186 |
| 471 | 3300036647 | Ga0316582_0066851 | Ga0316582_0066851_27_590 | 186 |
| 472 | 3300036647 | Ga0316582_0067366 | Ga0316582_0067366_1649_2221 | 186 |
| 473 | 3300036647 | Ga0316582_0112197 | Ga0316582_0112197_1026_1595 | 186 |
| 474 | 3300036647 | Ga0316582_0129449 | Ga0316582_0129449_1052_1615 | 186 |
| 475 | 3300036647 | Ga0316582_0220749 | Ga0316582_0220749_176_736 | 186 |
| 476 | 3300036647 | Ga0316582_0396960 | Ga0316582_0396960_86_649 | 186 |
| 477 | 3300036647 | Ga0316582_0429823 | Ga0316582_0429823_301_861 | 186 |
| 478 | 3300036647 | Ga0316582_0799790 | Ga0316582_0799790_66_629 | 186 |
| 479 | 3300036712 | Ga0316584_0004581 | Ga0316584_0004581_6468_7028 | 186 |
| 480 | 3300036712 | Ga0316584_0009145 | Ga0316584_0009145_5866_6438 | 186 |
| 481 | 3300036712 | Ga0316584_0011037 | Ga0316584_0011037_2269_2841 | 186 |
| 482 | 3300036712 | Ga0316584_0015880 | Ga0316584_0015880_2920_3528 | 186 |
| 483 | 3300036712 | Ga0316584_0016629 | Ga0316584_0016629_928_1500 | 186 |
| 484 | 3300036712 | Ga0316584_0018538 | Ga0316584_0018538_1727_2290 | 186 |
| 485 | 3300036712 | Ga0316584_0022323 | Ga0316584_0022323_3471_4031 | 186 |
| 486 | 3300036712 | Ga0316584_0024910 | Ga0316584_0024910_3618_4181 | 186 |
| 487 | 3300036712 | Ga0316584_0033854 | Ga0316584_0033854_3046_3615 | 186 |
| 488 | 3300036712 | Ga0316584_0054156 | Ga0316584_0054156_1494_2057 | 186 |
| 489 | 3300036712 | Ga0316584_0070531 | Ga0316584_0070531_2026_2598 | 186 |
| 490 | 3300036712 | Ga0316584_0087967 | Ga0316584_0087967_1256_1825 | 186 |
| 491 | 3300036712 | Ga0316584_0132967 | Ga0316584_0132967_416_988 | 186 |
| 492 | 3300036712 | Ga0316584_0149188 | Ga0316584_0149188_688_1251 | 186 |
| 493 | 3300036712 | Ga0316584_0224506 | Ga0316584_0224506_758_1321 | 186 |
| 494 | 3300036712 | Ga0316584_0263823 | Ga0316584_0263823_548_1114 | 186 |
| 495 | 3300036712 | Ga0316584_0335186 | Ga0316584_0335186_78_641 | 186 |
| 496 | 3300037588 | Ga0316581_0013894 | Ga0316581_0013894_126_698 | 186 |
| 497 | 3300037588 | Ga0316581_0082354 | Ga0316581_0082354_212_775 | 186 |
| 498 | 3300038725 | Ga0400484_09769 | Ga0400484_09769_5922_6485 | 186 |
| 499 | 3300038725 | Ga0400484_35465 | Ga0400484_35465_13281_13844 | 186 |
| 500 | 3300038726 | Ga0400490_06983 | Ga0400490_06983_180_743 | 186 |
| 501 | 3300038726 | Ga0400490_11650 | Ga0400490_11650_1539_2102 | 186 |
| 502 | 3300038726 | Ga0400490_16309 | Ga0400490_16309_897_1460 | 186 |
| 503 | 3300038726 | Ga0400490_35540 | Ga0400490_35540_27933_28496 | 186 |
| 504 | 3300038735 | Ga0400485_08473 | Ga0400485_08473_171_734 | 186 |
| 505 | 3300038735 | Ga0400485_09701 | Ga0400485_09701_275_838 | 186 |
| 506 | 3300038735 | Ga0400485_13509 | Ga0400485_13509_14477_15040 | 186 |
| 507 | 3300038741 | Ga0400488_25302 | Ga0400488_25302_3658_4221 | 186 |
| 508 | 3300038741 | Ga0400488_53784 | Ga0400488_53784_6340_6903 | 186 |
| 509 | 3300038741 | Ga0400488_53787 | Ga0400488_53787_34_597 | 186 |
| 510 | 3300038742 | Ga0400486_16046 | Ga0400486_16046_847_1449 | 186 |
| 511 | 3300038742 | Ga0400486_26096 | Ga0400486_26096_47414_47977 | 186 |
| 512 | 3300038742 | Ga0400486_30859 | Ga0400486_30859_3533_4096 | 186 |
| 513 | 3300039062 | Ga0400483_005648 | Ga0400483_005648_13652_14215 | 186 |
| 514 | 3300039062 | Ga0400483_029989 | Ga0400483_029989_40691_41263 | 186 |
| 515 | 3300039062 | Ga0400483_242281 | Ga0400483_242281_51592_52164 | 186 |
| 516 | 3300039062 | Ga0400483_252490 | Ga0400483_252490_507_1070 | 186 |
| 517 | 3300039062 | Ga0400483_269206 | Ga0400483_269206_64316_64879 | 186 |
| 518 | 3300039093 | Ga0400489_35275 | Ga0400489_35275_16173_16736 | 186 |
| 519 | 3300039093 | Ga0400489_55657 | Ga0400489_55657_12573_13136 | 186 |
| 520 | 3300039093 | Ga0400489_68375 | Ga0400489_68375_6199_6810 | 186 |
| 521 | 3300039093 | Ga0400489_76049 | Ga0400489_76049_413_976 | 186 |
| 522 | 3300039110 | Ga0400487_46349 | Ga0400487_46349_1112_1675 | 186 |
| 523 | 3300039437 | Ga0436365_1224743 | Ga0436365_1224743_3095_3664 | 186 |
| 524 | 3300039450 | Ga0436363_0997300 | Ga0436363_0997300_2849_3481 | 186 |
| 525 | 3300039453 | Ga0436362_1108905 | Ga0436362_1108905_2386_3009 | 186 |
| 526 | 3300041410 | Ga0439461_0016797 | Ga0439461_0016797_830_1396 | 186 |
| 527 | 3300041997 | Ga0439431_0185873 | Ga0439431_0185873_17_583 | 186 |
| 528 | 3300042003 | Ga0439443_000428 | Ga0439443_000428_2268_2894 | 186 |
| 529 | 3300042122 | Ga0450920_002953 | Ga0450920_002953_176_742 | 186 |
| 530 | 3300042133 | Ga0450896_007368 | Ga0450896_007368_687_1253 | 186 |
| 531 | 3300042135 | Ga0450899_037656 | Ga0450899_037656_21_587 | 186 |
| 532 | 3300042145 | Ga0450906_014059 | Ga0450906_014059_733_1299 | 186 |
| 533 | 3300042147 | Ga0450910_024919 | Ga0450910_024919_36_662 | 186 |
| 534 | 3300042156 | Ga0439446_0014380 | Ga0439446_0014380_76_642 | 186 |
| 535 | 3300042184 | Ga0450908_009560 | Ga0450908_009560_959_1585 | 186 |
| 536 | 3300042435 | Ga0439434_0031556 | Ga0439434_0031556_1011_1577 | 186 |
| 537 | 3300042435 | Ga0439434_0127105 | Ga0439434_0127105_172_738 | 186 |
| 538 | 3300042436 | Ga0439435_0025063 | Ga0439435_0025063_72_698 | 186 |
| 539 | 3300042439 | Ga0439464_0065427 | Ga0439464_0065427_444_1013 | 186 |
| 540 | 3300042530 | Ga0450916_015540 | Ga0450916_015540_154_720 | 186 |
| 541 | 3300042531 | Ga0450918_006465 | Ga0450918_006465_815_1381 | 186 |
| 542 | 3300042532 | Ga0450893_0013123 | Ga0450893_0013123_338_907 | 186 |
| 543 | 3300042532 | Ga0450893_0095757 | Ga0450893_0095757_16_585 | 186 |
| 544 | 3300044673 | Ga0453683_0003297 | Ga0453683_0003297_6465_7028 | 186 |
| 545 | 3300044712 | Ga0453684_0000036 | Ga0453684_0000036_416123_416689 | 186 |
| 546 | 3300044712 | Ga0453684_0123258 | Ga0453684_0123258_1145_1708 | 186 |
| 547 | 3300044712 | Ga0453684_0445675 | Ga0453684_0445675_106_675 | 186 |
| 548 | 3300045051 | Ga0451576_1029938 | Ga0451576_1029938_67_672 | 186 |
| 549 | 3300046455 | Ga0495603_0008315 | Ga0495603_0008315_4195_4764 | 186 |
| 550 | 3300046455 | Ga0495603_0089474 | Ga0495603_0089474_72_638 | 186 |
| 551 | 3300046457 | Ga0495590_0044441 | Ga0495590_0044441_248_817 | 186 |
| 552 | 3300046460 | Ga0495638_0032047 | Ga0495638_0032047_288_857 | 186 |
| 553 | 3300046473 | Ga0495582_0565145 | Ga0495582_0565145_28_594 | 186 |
| 554 | 3300046501 | Ga0495607_0275241 | Ga0495607_0275241_79_645 | 186 |
| 555 | 3300046517 | Ga0495630_0462120 | Ga0495630_0462120_353_922 | 186 |
| 556 | 3300046530 | Ga0495654_0086515 | Ga0495654_0086515_527_1093 | 186 |
| 557 | 3300046535 | Ga0495586_0011357 | Ga0495586_0011357_262_834 | 186 |
| 558 | 3300046539 | Ga0495621_0000098 | Ga0495621_0000098_10700_11266 | 186 |
| 559 | 3300046542 | Ga0495597_0199030 | Ga0495597_0199030_82_654 | 186 |
| 560 | 3300046615 | Ga0495656_0080458 | Ga0495656_0080458_388_954 | 186 |
| 561 | 3300046642 | Ga0495634_0138229 | Ga0495634_0138229_765_1334 | 186 |
| 562 | 3300046648 | Ga0495611_0085346 | Ga0495611_0085346_664_1236 | 186 |
| 563 | 3300046681 | Ga0495647_0018427 | Ga0495647_0018427_1855_2421 | 186 |
| 564 | 3300046681 | Ga0495647_0158842 | Ga0495647_0158842_202_771 | 186 |
| 565 | 3300046683 | Ga0495658_0027956 | Ga0495658_0027956_1353_1919 | 186 |
| 566 | 3300046691 | Ga0495670_0204618 | Ga0495670_0204618_279_845 | 186 |
| 567 | 3300046692 | Ga0495671_0004008 | Ga0495671_0004008_2451_3020 | 186 |
| 568 | 3300047469 | Ga0495673_0119506 | Ga0495673_0119506_272_841 | 186 |
| 569 | 3300047470 | Ga0495681_0139306 | Ga0495681_0139306_312_878 | 186 |
| 570 | 3300048907 | Ga0496104_0001449 | Ga0496104_0001449_2303_2872 | 186 |
| 571 | 3300048908 | Ga0496105_0001567 | Ga0496105_0001567_3390_3959 | 186 |
| 572 | 3300048911 | Ga0496108_0028591 | Ga0496108_0028591_1663_2232 | 186 |
| 573 | 3300048911 | Ga0496108_0103094 | Ga0496108_0103094_691_1260 | 186 |
| 574 | 3300048912 | Ga0496109_0012615 | Ga0496109_0012615_4636_5205 | 186 |
| 575 | 3300048912 | Ga0496109_0032320 | Ga0496109_0032320_3869_4474 | 186 |
| 576 | 3300048914 | Ga0496111_0002880 | Ga0496111_0002880_144_713 | 186 |
| 577 | 3300048915 | Ga0496112_0001440 | Ga0496112_0001440_7128_7733 | 186 |
| 578 | 3300048916 | Ga0496113_0034515 | Ga0496113_0034515_405_974 | 186 |
| 579 | 3300048916 | Ga0496113_0276979 | Ga0496113_0276979_138_707 | 186 |
| 580 | 3300048917 | Ga0496114_0000244 | Ga0496114_0000244_2169_2735 | 186 |
| 581 | 3300048918 | Ga0496115_0040651 | Ga0496115_0040651_606_1214 | 186 |
| 582 | 3300048920 | Ga0496117_0163096 | Ga0496117_0163096_381_1019 | 186 |
| 583 | 3300049568 | Ga0501031_0039301 | Ga0501031_0039301_1971_2540 | 186 |
| 584 | 3300049569 | Ga0501032_0252420 | Ga0501032_0252420_88_654 | 186 |
| 585 | 3300049571 | Ga0501034_0289008 | Ga0501034_0289008_557_1132 | 186 |
| 586 | 3300049572 | Ga0501036_0007849 | Ga0501036_0007849_6893_7462 | 186 |
| 587 | 3300049572 | Ga0501036_0151126 | Ga0501036_0151126_341_907 | 186 |
| 588 | 3300049572 | Ga0501036_0680824 | Ga0501036_0680824_248_817 | 186 |
| 589 | 3300049573 | Ga0501037_0197202 | Ga0501037_0197202_163_732 | 186 |
| 590 | 3300049573 | Ga0501037_0317145 | Ga0501037_0317145_168_737 | 186 |
| 591 | 3300049573 | Ga0501037_0559223 | Ga0501037_0559223_101_667 | 186 |
| 592 | 3300049574 | Ga0501038_0019453 | Ga0501038_0019453_4267_4911 | 186 |
| 593 | 3300049574 | Ga0501038_0028666 | Ga0501038_0028666_1871_2440 | 186 |
| 594 | 3300049575 | Ga0501039_0003853 | Ga0501039_0003853_6783_7352 | 186 |
| 595 | 3300049575 | Ga0501039_0028077 | Ga0501039_0028077_2247_2816 | 186 |
| 596 | 3300049575 | Ga0501039_0207631 | Ga0501039_0207631_408_974 | 186 |
| 597 | 3300049575 | Ga0501039_0363304 | Ga0501039_0363304_335_904 | 186 |
| 598 | 3300049576 | Ga0501040_0000023 | Ga0501040_0000023_40155_40724 | 186 |
| 599 | 3300049576 | Ga0501040_0001206 | Ga0501040_0001206_5495_6064 | 186 |
| 600 | 3300049576 | Ga0501040_0015429 | Ga0501040_0015429_4294_4863 | 186 |
| 601 | 3300049576 | Ga0501040_0076176 | Ga0501040_0076176_356_925 | 186 |
| 602 | 3300049576 | Ga0501040_0184312 | Ga0501040_0184312_120_689 | 186 |
| 603 | 3300049576 | Ga0501040_0245839 | Ga0501040_0245839_471_1037 | 186 |
| 604 | 3300049576 | Ga0501040_0385437 | Ga0501040_0385437_281_850 | 186 |
| 605 | 3300049577 | Ga0501041_0001968 | Ga0501041_0001968_8301_8870 | 186 |
| 606 | 3300049577 | Ga0501041_0007930 | Ga0501041_0007930_3801_4445 | 186 |
| 607 | 3300049577 | Ga0501041_0031523 | Ga0501041_0031523_2446_3015 | 186 |
| 608 | 3300049577 | Ga0501041_0250870 | Ga0501041_0250870_449_1015 | 186 |
| 609 | 3300049578 | Ga0501042_0000263 | Ga0501042_0000263_9346_9915 | 186 |
| 610 | 3300049578 | Ga0501042_0000931 | Ga0501042_0000931_8677_9246 | 186 |
| 611 | 3300049578 | Ga0501042_0761393 | Ga0501042_0761393_111_680 | 186 |
| 612 | 3300049578 | Ga0501042_0782791 | Ga0501042_0782791_87_656 | 186 |
| 613 | 3300049579 | Ga0501043_0061394 | Ga0501043_0061394_1790_2359 | 186 |
| 614 | 3300049580 | Ga0501046_0011112 | Ga0501046_0011112_1623_2192 | 186 |
| 615 | 3300049580 | Ga0501046_0128320 | Ga0501046_0128320_790_1359 | 186 |
| 616 | 3300049580 | Ga0501046_0238421 | Ga0501046_0238421_344_913 | 186 |
| 617 | 3300049582 | Ga0501048_0011120 | Ga0501048_0011120_2415_2984 | 186 |
| 618 | 3300049582 | Ga0501048_0437559 | Ga0501048_0437559_244_813 | 186 |
| 619 | 3300049582 | Ga0501048_0602687 | Ga0501048_0602687_137_703 | 186 |
| 620 | 3300049584 | Ga0501068_0000860 | Ga0501068_0000860_12965_13534 | 186 |
| 621 | 3300049584 | Ga0501068_0064121 | Ga0501068_0064121_751_1320 | 186 |
| 622 | 3300049584 | Ga0501068_0164144 | Ga0501068_0164144_47_616 | 186 |
| 623 | 3300049585 | Ga0501069_0099195 | Ga0501069_0099195_1022_1591 | 186 |
| 624 | 3300049586 | Ga0501070_0340121 | Ga0501070_0340121_610_1176 | 186 |
| 625 | 3300049587 | Ga0501071_0006996 | Ga0501071_0006996_1401_1970 | 186 |
| 626 | 3300049587 | Ga0501071_0014535 | Ga0501071_0014535_3881_4447 | 186 |
| 627 | 3300049587 | Ga0501071_0149593 | Ga0501071_0149593_868_1437 | 186 |
| 628 | 3300049587 | Ga0501071_0862456 | Ga0501071_0862456_31_597 | 186 |
| 629 | 3300049588 | Ga0501072_0001665 | Ga0501072_0001665_14779_15348 | 186 |
| 630 | 3300049588 | Ga0501072_0024666 | Ga0501072_0024666_3392_4036 | 186 |
| 631 | 3300049588 | Ga0501072_0062383 | Ga0501072_0062383_1379_1948 | 186 |
| 632 | 3300049588 | Ga0501072_0248757 | Ga0501072_0248757_181_747 | 186 |
| 633 | 3300049588 | Ga0501072_0267261 | Ga0501072_0267261_307_873 | 186 |
| 634 | 3300049589 | Ga0501073_0105511 | Ga0501073_0105511_264_833 | 186 |
| 635 | 3300049589 | Ga0501073_0123504 | Ga0501073_0123504_45_611 | 186 |
| 636 | 3300049589 | Ga0501073_0312341 | Ga0501073_0312341_323_889 | 186 |
| 637 | 3300049589 | Ga0501073_0490057 | Ga0501073_0490057_110_754 | 186 |
| 638 | 3300049590 | Ga0501074_0124231 | Ga0501074_0124231_586_1155 | 186 |
| 639 | 3300049590 | Ga0501074_0523337 | Ga0501074_0523337_47_613 | 186 |
| 640 | 3300049591 | Ga0501075_0000858 | Ga0501075_0000858_14200_14769 | 186 |
| 641 | 3300049591 | Ga0501075_0010706 | Ga0501075_0010706_2208_2777 | 186 |
| 642 | 3300049591 | Ga0501075_0078280 | Ga0501075_0078280_1366_2010 | 186 |
| 643 | 3300049591 | Ga0501075_0378407 | Ga0501075_0378407_323_889 | 186 |
| 644 | 3300049592 | Ga0501076_0002159 | Ga0501076_0002159_3977_4546 | 186 |
| 645 | 3300049592 | Ga0501076_0008141 | Ga0501076_0008141_1916_2485 | 186 |
| 646 | 3300049592 | Ga0501076_0031032 | Ga0501076_0031032_3319_3888 | 186 |
| 647 | 3300049592 | Ga0501076_0036539 | Ga0501076_0036539_1645_2214 | 186 |
| 648 | 3300049593 | Ga0501077_0004578 | Ga0501077_0004578_3436_4005 | 186 |
| 649 | 3300049593 | Ga0501077_0030779 | Ga0501077_0030779_485_1054 | 186 |
| 650 | 3300049593 | Ga0501077_0061930 | Ga0501077_0061930_1782_2348 | 186 |
| 651 | 3300049593 | Ga0501077_0317224 | Ga0501077_0317224_127_696 | 186 |
| 652 | 3300049593 | Ga0501077_0424764 | Ga0501077_0424764_159_725 | 186 |
| 653 | 3300049703 | Ga0501219_008464 | Ga0501219_008464_65_634 | 186 |
| 654 | 3300049741 | Ga0501079_0002189 | Ga0501079_0002189_9956_10525 | 186 |
| 655 | 3300049741 | Ga0501079_0008655 | Ga0501079_0008655_5841_6410 | 186 |
| 656 | 3300049741 | Ga0501079_0011210 | Ga0501079_0011210_4013_4582 | 186 |
| 657 | 3300049741 | Ga0501079_0218820 | Ga0501079_0218820_382_951 | 186 |
| 658 | 3300049741 | Ga0501079_0415736 | Ga0501079_0415736_475_1044 | 186 |
| 659 | 3300049742 | Ga0501080_0009101 | Ga0501080_0009101_8226_8795 | 186 |
| 660 | 3300049742 | Ga0501080_0022228 | Ga0501080_0022228_5243_5809 | 186 |
| 661 | 3300049742 | Ga0501080_0030746 | Ga0501080_0030746_4388_4957 | 186 |
| 662 | 3300049742 | Ga0501080_0129864 | Ga0501080_0129864_1456_2025 | 186 |
| 663 | 3300049742 | Ga0501080_1105514 | Ga0501080_1105514_84_653 | 186 |
| 664 | 3300049743 | Ga0501081_0000359 | Ga0501081_0000359_16929_17498 | 186 |
| 665 | 3300049743 | Ga0501081_0055340 | Ga0501081_0055340_1102_1671 | 186 |
| 666 | 3300049744 | Ga0501083_0071631 | Ga0501083_0071631_930_1499 | 186 |
| 667 | 3300049744 | Ga0501083_0140138 | Ga0501083_0140138_791_1483 | 186 |
| 668 | 3300049744 | Ga0501083_0144745 | Ga0501083_0144745_181_747 | 186 |
| 669 | 3300049744 | Ga0501083_0342322 | Ga0501083_0342322_33_602 | 186 |
| 670 | 3300049822 | Ga0501035_0078323 | Ga0501035_0078323_40_609 | 186 |
| 671 | 3300049822 | Ga0501035_0197866 | Ga0501035_0197866_271_840 | 186 |
| 672 | 3300049823 | Ga0501044_0955394 | Ga0501044_0955394_92_661 | 186 |
| 673 | 3300049824 | Ga0501045_0025348 | Ga0501045_0025348_2047_2616 | 186 |
| 674 | 3300049824 | Ga0501045_0037227 | Ga0501045_0037227_792_1361 | 186 |
| 675 | 3300049824 | Ga0501045_0096695 | Ga0501045_0096695_550_1119 | 186 |
| 676 | 3300049824 | Ga0501045_0116947 | Ga0501045_0116947_45_614 | 186 |
| 677 | 3300049824 | Ga0501045_0185080 | Ga0501045_0185080_193_762 | 186 |
| 678 | 3300049824 | Ga0501045_0674051 | Ga0501045_0674051_156_722 | 186 |
| 679 | 3300050492 | nmdc:mga0yw44_619439_c1 | nmdc:mga0yw44_619439_c1_120_725 | 186 |
| 680 | 3300050507 | nmdc:mga05p37_29644_c1 | nmdc:mga05p37_29644_c1_1566_2135 | 186 |
| 681 | 3300050507 | nmdc:mga05p37_949333_c1 | nmdc:mga05p37_949333_c1_205_774 | 186 |
| 682 | 3300050508 | nmdc:mga09592_360_c1 | nmdc:mga09592_360_c1_375_944 | 186 |
| 683 | 3300050508 | nmdc:mga09592_37787_c1 | nmdc:mga09592_37787_c1_2222_2791 | 186 |
| 684 | 3300050508 | nmdc:mga09592_503260_c1 | nmdc:mga09592_503260_c1_187_756 | 186 |
| 685 | 3300050509 | nmdc:mga0qj67_19098_c1 | nmdc:mga0qj67_19098_c1_131_700 | 186 |
| 686 | 3300050509 | nmdc:mga0qj67_28506_c1 | nmdc:mga0qj67_28506_c1_1601_2170 | 186 |
| 687 | 3300050509 | nmdc:mga0qj67_40936_c1 | nmdc:mga0qj67_40936_c1_1211_1780 | 186 |
| 688 | 3300050509 | nmdc:mga0qj67_6164_c1 | nmdc:mga0qj67_6164_c1_1347_1916 | 186 |
| 689 | 3300050510 | nmdc:mga06r32_138256_c1 | nmdc:mga06r32_138256_c1_1309_1878 | 186 |
| 690 | 3300050510 | nmdc:mga06r32_22221_c1 | nmdc:mga06r32_22221_c1_4385_4954 | 186 |
| 691 | 3300050510 | nmdc:mga06r32_2483_c1 | nmdc:mga06r32_2483_c1_3281_3850 | 186 |
| 692 | 3300050510 | nmdc:mga06r32_9372_c1 | nmdc:mga06r32_9372_c1_7297_7866 | 186 |
| 693 | 3300050511 | nmdc:mga08y16_103071_c1 | nmdc:mga08y16_103071_c1_383_952 | 186 |
| 694 | 3300050511 | nmdc:mga08y16_21686_c1 | nmdc:mga08y16_21686_c1_2248_2814 | 186 |
| 695 | 3300050511 | nmdc:mga08y16_519422_c1 | nmdc:mga08y16_519422_c1_118_687 | 186 |
| 696 | 3300050511 | nmdc:mga08y16_584337_c1 | nmdc:mga08y16_584337_c1_245_814 | 186 |
| 697 | 3300050511 | nmdc:mga08y16_63940_c1 | nmdc:mga08y16_63940_c1_1986_2555 | 186 |
| 698 | 3300050513 | nmdc:mga0rr50_284275_c1 | nmdc:mga0rr50_284275_c1_227_796 | 186 |
| 699 | 3300050515 | nmdc:mga0a205_18127_c1 | nmdc:mga0a205_18127_c1_1075_1683 | 186 |
| 700 | 3300053077 | Ga0495601_0514807 | Ga0495601_0514807_124_693 | 186 |
| 701 | 3300053092 | Ga0500583_0157063 | Ga0500583_0157063_257_826 | 186 |
| 702 | 3300053096 | Ga0500641_0053391 | Ga0500641_0053391_71_640 | 186 |
| 703 | 3300053104 | Ga0500556_0000766 | Ga0500556_0000766_393_965 | 186 |
| 704 | 3300053131 | Ga0500652_164417 | Ga0500652_164417_124_693 | 186 |
| 705 | 3300054114 | Ga0501084_0007709 | Ga0501084_0007709_7498_8067 | 186 |
| 706 | 3300054114 | Ga0501084_0007827 | Ga0501084_0007827_1052_1696 | 186 |
| 707 | 3300054114 | Ga0501084_0105628 | Ga0501084_0105628_1782_2348 | 186 |
| 708 | 3300054114 | Ga0501084_0114844 | Ga0501084_0114844_421_990 | 186 |
| 709 | 3300054114 | Ga0501084_0671119 | Ga0501084_0671119_55_624 | 186 |
| 710 | 3300060353 | Ga0501082_0000368 | Ga0501082_0000368_34850_35419 | 186 |
| 711 | 3300060353 | Ga0501082_0005816 | Ga0501082_0005816_8868_9437 | 186 |
| 712 | 3300060353 | Ga0501082_0018624 | Ga0501082_0018624_1451_2020 | 186 |
| 713 | 3300060353 | Ga0501082_0112658 | Ga0501082_0112658_774_1340 | 186 |
| 714 | 3300060353 | Ga0501082_0258227 | Ga0501082_0258227_14_580 | 186 |
| 715 | 3300060353 | Ga0501082_0309457 | Ga0501082_0309457_605_1171 | 186 |
| 716 | 3300061734 | Ga0530510_0000025 | Ga0530510_0000025_22374_22943 | 186 |
| 717 | 3300061734 | Ga0530510_0029874 | Ga0530510_0029874_2191_2760 | 186 |
| 718 | 3300061734 | Ga0530510_0031934 | Ga0530510_0031934_2966_3535 | 186 |
| 719 | 3300061734 | Ga0530510_0179300 | Ga0530510_0179300_654_1220 | 186 |
| 720 | 3300061734 | Ga0530510_0718303 | Ga0530510_0718303_17_586 | 186 |
| 721 | 3300061734 | Ga0530510_0914008 | Ga0530510_0914008_76_645 | 186 |
| 722 | 3300003316 | rootH1_10164463 | rootH1_101644632 | 187 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3a5z-assembly2.cif.gz_F | crystal structure of escherichia coli genx in complex with elongation factor p | 0.9416 | 1 | 59 |
| 3a5z-assembly2.cif.gz_F | crystal structure of escherichia coli genx in complex with elongation factor p | 0.9268 | 1 | 59 |
| 4v6a-assembly2.cif.gz_CV | structure of ef-p bound to the 70s ribosome. | 0.9106 | 1 | 186 |
| 1ueb-assembly1.cif.gz_A | crystal structure of translation elongation factor p from thermus thermophilus hb8 | 0.9096 | 1 | 186 |
| 4v6a-assembly2.cif.gz_CV | structure of ef-p bound to the 70s ribosome. | 0.9058 | 1 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5j3bA03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9704 | 130 | 186 | 2.40.50.140 |
| 3a5zF01 | Mainly Beta;Roll;SH3 type barrels.; | 0.9647 | 12 | 56 | 2.30.30.30 |
| 5j3bB01 | Mainly Beta;Roll;SH3 type barrels.; | 0.9587 | 1 | 62 | 2.30.30.30 |
| af_Q2QYK4_39_108_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.9587 | 2 | 62 | 2.30.30.30 |
| 1ybyB03 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.951 | 130 | 186 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3TGV3-F1-model_v4 | deleted | 0.9678 | 80 | 187 |
|
| AF-A0A4Q3TGV3-F1-model_v4 | deleted | 0.959 | 80 | 187 |
|
| AF-A0A3D4ISU4-F1-model_v4 | Elongation factor P | 0.9541 | 68 | 187 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A7X8W8K1-F1-model_v4 | Elongation factor P | 0.9541 | 83 | 187 |
GO:0003746
GO:0005737 GO:0043043 |
| AF-A0A7Y6PPL6-F1-model_v4 | Elongation factor P | 0.951 | 63 | 187 |
GO:0003746
GO:0005737 GO:0043043 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar