F477477
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 723 | 295 | 723 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300005445|Ga0070708_100065381|Ga0070708_1000653813 |
| Length | 115 |
| Sequence | MADMSEETTTQDKEGGAPTAEQVTEALKVVVDPELGINIVDLGLVYDVAVEDEVVKITYTLTTMGCPVGPLIEQQMQQVLTTLPGISNVESEMVFTPPWSPERMSEEARLAMGMF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 8 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 98 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 103 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 107 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 108 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 163 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 167 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 171 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 180 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 181 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 187 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 188 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 189 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 190 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 191 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 192 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 193 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 194 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 198 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 199 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 200 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 206 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 247 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 248 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 249 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 250 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 251 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 274 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 279 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.13 |
| Metatranscriptomes | 3.87 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.48 |
| Rhizosphere | 87.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.24 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_11212884 | 3300005327 | Bacteria | 656 |
| 2 | Ga0070683_100226322 | 3300005329 | Bacteria | 1777 |
| 3 | Ga0070690_100069365 | 3300005330 | Bacteria | 2288 |
| 4 | Ga0070690_100166404 | 3300005330 | Bacteria | 1514 |
| 5 | Ga0068869_100130555 | 3300005334 | Bacteria | 1931 |
| 6 | Ga0070680_100038117 | 3300005336 | Bacteria | 3886 |
| 7 | Ga0070680_101738745 | 3300005336 | Bacteria | 540 |
| 8 | Ga0070680_101901709 | 3300005336 | Bacteria | 516 |
| 9 | Ga0070682_100012408 | 3300005337 | Bacteria | 4887 |
| 10 | Ga0068868_100061984 | 3300005338 | Bacteria | 2963 |
| 11 | Ga0068868_100476343 | 3300005338 | Bacteria | 1090 |
| 12 | Ga0070660_100007596 | 3300005339 | Bacteria | 7557 |
| 13 | Ga0070660_100021467 | 3300005339 | Bacteria | 4763 |
| 14 | Ga0070660_100135957 | 3300005339 | Bacteria | 1969 |
| 15 | Ga0070660_100351431 | 3300005339 | Bacteria | 1214 |
| 16 | Ga0070689_100075774 | 3300005340 | Bacteria | 2634 |
| 17 | Ga0070661_100060787 | 3300005344 | Bacteria | 2772 |
| 18 | Ga0070661_100112887 | 3300005344 | Bacteria | 2030 |
| 19 | Ga0070692_10009738 | 3300005345 | Bacteria | 4347 |
| 20 | Ga0070671_100879510 | 3300005355 | Bacteria | 782 |
| 21 | Ga0070674_100182410 | 3300005356 | Bacteria | 1609 |
| 22 | Ga0070674_100272683 | 3300005356 | Bacteria | 1338 |
| 23 | Ga0070673_101009370 | 3300005364 | Bacteria | 775 |
| 24 | Ga0070688_100051117 | 3300005365 | Bacteria | 2578 |
| 25 | Ga0070659_100035598 | 3300005366 | Bacteria | 3877 |
| 26 | Ga0070659_100158972 | 3300005366 | Bacteria | 1847 |
| 27 | Ga0070659_100345434 | 3300005366 | Bacteria | 1247 |
| 28 | Ga0070667_100055300 | 3300005367 | Bacteria | 3352 |
| 29 | Ga0070667_100514446 | 3300005367 | Bacteria | 1098 |
| 30 | Ga0070667_101237269 | 3300005367 | Bacteria | 699 |
| 31 | Ga0070714_100265556 | 3300005435 | Bacteria | 1590 |
| 32 | Ga0070714_100546286 | 3300005435 | Unclassified | 1109 |
| 33 | Ga0070713_100200477 | 3300005436 | Bacteria | 1802 |
| 34 | Ga0070701_10174934 | 3300005438 | Bacteria | 1253 |
| 35 | Ga0070711_100042752 | 3300005439 | Bacteria | 3065 |
| 36 | Ga0070711_101576723 | 3300005439 | Unclassified | 574 |
| 37 | Ga0070705_100095823 | 3300005440 | Bacteria | 1861 |
| 38 | Ga0070705_100121261 | 3300005440 | Bacteria | 1689 |
| 39 | Ga0070705_100863960 | 3300005440 | Bacteria | 725 |
| 40 | Ga0070700_100249364 | 3300005441 | Bacteria | 1273 |
| 41 | Ga0070694_100055019 | 3300005444 | Bacteria | 2698 |
| 42 | Ga0070708_100042687 | 3300005445 | Bacteria | 3983 |
| 43 | Ga0070708_100065381 | 3300005445 | Bacteria | 3261 |
| 44 | Ga0070708_100094407 | 3300005445 | Bacteria | 2729 |
| 45 | Ga0070708_101033397 | 3300005445 | Bacteria | 770 |
| 46 | Ga0070663_100640697 | 3300005455 | Bacteria | 898 |
| 47 | Ga0070663_100733596 | 3300005455 | Unclassified | 842 |
| 48 | Ga0070678_100008202 | 3300005456 | Bacteria | 6245 |
| 49 | Ga0070678_101938165 | 3300005456 | Bacteria | 557 |
| 50 | Ga0070681_10001955 | 3300005458 | Bacteria | 18619 |
| 51 | Ga0070681_10510298 | 3300005458 | Bacteria | 1116 |
| 52 | Ga0068867_100080687 | 3300005459 | Bacteria | 2451 |
| 53 | Ga0070685_10335328 | 3300005466 | Bacteria | 1029 |
| 54 | Ga0070685_10380813 | 3300005466 | Bacteria | 972 |
| 55 | Ga0070706_100004684 | 3300005467 | Bacteria | 13117 |
| 56 | Ga0070706_100211206 | 3300005467 | Bacteria | 1812 |
| 57 | Ga0070706_100686813 | 3300005467 | Bacteria | 950 |
| 58 | Ga0070706_100732961 | 3300005467 | Bacteria | 916 |
| 59 | Ga0070707_100004513 | 3300005468 | Bacteria | 13032 |
| 60 | Ga0070707_100273104 | 3300005468 | Bacteria | 1643 |
| 61 | Ga0070707_100457585 | 3300005468 | Bacteria | 1237 |
| 62 | Ga0070707_100672696 | 3300005468 | Unclassified | 998 |
| 63 | Ga0070698_100056452 | 3300005471 | Bacteria | 3979 |
| 64 | Ga0070698_100753766 | 3300005471 | Unclassified | 917 |
| 65 | Ga0070699_100181915 | 3300005518 | Bacteria | 1865 |
| 66 | Ga0070699_100471394 | 3300005518 | Bacteria | 1139 |
| 67 | Ga0070679_100057784 | 3300005530 | Bacteria | 3867 |
| 68 | Ga0070679_100135234 | 3300005530 | Bacteria | 2446 |
| 69 | Ga0070679_100171278 | 3300005530 | Bacteria | 2144 |
| 70 | Ga0070679_100322341 | 3300005530 | Bacteria | 1494 |
| 71 | Ga0070684_100030942 | 3300005535 | Bacteria | 4552 |
| 72 | Ga0070684_100061807 | 3300005535 | Bacteria | 3279 |
| 73 | Ga0070684_100101616 | 3300005535 | Bacteria | 2569 |
| 74 | Ga0070684_100132648 | 3300005535 | Bacteria | 2248 |
| 75 | Ga0070684_100902244 | 3300005535 | Bacteria | 828 |
| 76 | Ga0070697_100438854 | 3300005536 | Bacteria | 1136 |
| 77 | Ga0070697_100672856 | 3300005536 | Bacteria | 912 |
| 78 | Ga0068853_100052906 | 3300005539 | Bacteria | 3497 |
| 79 | Ga0068853_102170324 | 3300005539 | Bacteria | 538 |
| 80 | Ga0070686_100053965 | 3300005544 | Bacteria | 2569 |
| 81 | Ga0070695_100529849 | 3300005545 | Bacteria | 915 |
| 82 | Ga0070696_100041484 | 3300005546 | Bacteria | 3180 |
| 83 | Ga0070696_100096200 | 3300005546 | Bacteria | 2116 |
| 84 | Ga0070696_101897979 | 3300005546 | Bacteria | 516 |
| 85 | Ga0070693_100005617 | 3300005547 | Bacteria | 6047 |
| 86 | Ga0070693_100206652 | 3300005547 | Bacteria | 1279 |
| 87 | Ga0070665_100314565 | 3300005548 | Bacteria | 1570 |
| 88 | Ga0070665_100804462 | 3300005548 | Bacteria | 953 |
| 89 | Ga0070704_100488166 | 3300005549 | Bacteria | 1067 |
| 90 | Ga0070704_100553092 | 3300005549 | Bacteria | 1006 |
| 91 | Ga0068855_100023960 | 3300005563 | Bacteria | 7308 |
| 92 | Ga0068855_100555096 | 3300005563 | Bacteria | 1243 |
| 93 | Ga0068855_100637854 | 3300005563 | Bacteria | 1145 |
| 94 | Ga0070664_100179626 | 3300005564 | Bacteria | 1880 |
| 95 | Ga0070664_100441521 | 3300005564 | Bacteria | 1194 |
| 96 | Ga0068857_100011172 | 3300005577 | Bacteria | 7809 |
| 97 | Ga0068857_100327735 | 3300005577 | Bacteria | 1415 |
| 98 | Ga0068857_100364879 | 3300005577 | Bacteria | 1339 |
| 99 | Ga0068854_100200137 | 3300005578 | Bacteria | 1570 |
| 100 | Ga0068854_100825568 | 3300005578 | Bacteria | 810 |
| 101 | Ga0068854_100995211 | 3300005578 | Unclassified | 742 |
| 102 | Ga0068854_101037664 | 3300005578 | Bacteria | 728 |
| 103 | Ga0068856_100091442 | 3300005614 | Bacteria | 3027 |
| 104 | Ga0068856_100216927 | 3300005614 | Bacteria | 1928 |
| 105 | Ga0068856_101554709 | 3300005614 | Unclassified | 675 |
| 106 | Ga0068856_102206004 | 3300005614 | Unclassified | 560 |
| 107 | Ga0070702_100033934 | 3300005615 | Bacteria | 2810 |
| 108 | Ga0070702_100060507 | 3300005615 | Bacteria | 2202 |
| 109 | Ga0068852_100085601 | 3300005616 | Bacteria | 2808 |
| 110 | Ga0068852_100186384 | 3300005616 | Bacteria | 1954 |
| 111 | Ga0068852_100232811 | 3300005616 | Bacteria | 1757 |
| 112 | Ga0068859_101418953 | 3300005617 | Bacteria | 766 |
| 113 | Ga0068864_101298219 | 3300005618 | Bacteria | 728 |
| 114 | Ga0068866_10088089 | 3300005718 | Bacteria | 1684 |
| 115 | Ga0068866_10488061 | 3300005718 | Bacteria | 813 |
| 116 | Ga0068870_10801653 | 3300005840 | Bacteria | 658 |
| 117 | Ga0068858_100016243 | 3300005842 | Bacteria | 6993 |
| 118 | Ga0068858_100031994 | 3300005842 | Bacteria | 4887 |
| 119 | Ga0068858_102458821 | 3300005842 | Unclassified | 515 |
| 120 | Ga0068860_100020071 | 3300005843 | Bacteria | 6474 |
| 121 | Ga0070717_10285063 | 3300006028 | Unclassified | 1466 |
| 122 | Ga0070715_10014322 | 3300006163 | Bacteria | 2935 |
| 123 | Ga0070715_10256955 | 3300006163 | Bacteria | 916 |
| 124 | Ga0070716_100572563 | 3300006173 | Bacteria | 845 |
| 125 | Ga0070712_100037595 | 3300006175 | Bacteria | 3301 |
| 126 | Ga0097621_100010903 | 3300006237 | Bacteria | 6672 |
| 127 | Ga0097621_100130048 | 3300006237 | Bacteria | 2142 |
| 128 | Ga0097621_102205234 | 3300006237 | Unclassified | 527 |
| 129 | Ga0068871_100052258 | 3300006358 | Bacteria | 3309 |
| 130 | Ga0068871_100127541 | 3300006358 | Bacteria | 2155 |
| 131 | Ga0068871_101182205 | 3300006358 | Unclassified | 717 |
| 132 | Ga0075433_10077960 | 3300006852 | Bacteria | 2919 |
| 133 | Ga0075434_100052014 | 3300006871 | Bacteria | 4070 |
| 134 | Ga0068865_100014192 | 3300006881 | Bacteria | 5057 |
| 135 | Ga0068865_100234368 | 3300006881 | Bacteria | 1442 |
| 136 | Ga0075436_100171437 | 3300006914 | Bacteria | 1532 |
| 137 | Ga0075436_100861195 | 3300006914 | Bacteria | 677 |
| 138 | Ga0097620_101418885 | 3300006931 | Bacteria | 766 |
| 139 | Ga0075435_100194889 | 3300007076 | Bacteria | 1716 |
| 140 | Ga0105240_11517974 | 3300009093 | Bacteria | 702 |
| 141 | Ga0105240_11572672 | 3300009093 | Bacteria | 688 |
| 142 | Ga0105240_12229884 | 3300009093 | Bacteria | 568 |
| 143 | Ga0111539_10814118 | 3300009094 | Bacteria | 1087 |
| 144 | Ga0105245_10015320 | 3300009098 | Bacteria | 6682 |
| 145 | Ga0105245_10224157 | 3300009098 | Bacteria | 1815 |
| 146 | Ga0105245_10349933 | 3300009098 | Bacteria | 1464 |
| 147 | Ga0105245_10936573 | 3300009098 | Bacteria | 909 |
| 148 | Ga0105247_10052990 | 3300009101 | Bacteria | 2501 |
| 149 | Ga0105247_10304565 | 3300009101 | Bacteria | 1107 |
| 150 | Ga0105243_10047355 | 3300009148 | Bacteria | 3384 |
| 151 | Ga0105243_10267127 | 3300009148 | Bacteria | 1534 |
| 152 | Ga0105243_10658793 | 3300009148 | Bacteria | 1015 |
| 153 | Ga0105243_11227939 | 3300009148 | Bacteria | 764 |
| 154 | Ga0105241_10060149 | 3300009174 | Bacteria | 2922 |
| 155 | Ga0105241_10084415 | 3300009174 | Bacteria | 2493 |
| 156 | Ga0105241_10833959 | 3300009174 | Bacteria | 851 |
| 157 | Ga0105242_10132083 | 3300009176 | Bacteria | 2157 |
| 158 | Ga0105242_10139756 | 3300009176 | Bacteria | 2100 |
| 159 | Ga0105242_10531565 | 3300009176 | Unclassified | 1124 |
| 160 | Ga0105242_11804535 | 3300009176 | Unclassified | 650 |
| 161 | Ga0105248_10291615 | 3300009177 | Bacteria | 1837 |
| 162 | Ga0105248_10392689 | 3300009177 | Bacteria | 1562 |
| 163 | Ga0105237_10091107 | 3300009545 | Bacteria | 3038 |
| 164 | Ga0105237_10202129 | 3300009545 | Bacteria | 1987 |
| 165 | Ga0105237_10250546 | 3300009545 | Bacteria | 1773 |
| 166 | Ga0105237_11083411 | 3300009545 | Bacteria | 808 |
| 167 | Ga0105238_10031640 | 3300009551 | Bacteria | 5386 |
| 168 | Ga0105238_10043373 | 3300009551 | Bacteria | 4551 |
| 169 | Ga0105238_10082150 | 3300009551 | Bacteria | 3212 |
| 170 | Ga0105238_10822677 | 3300009551 | Bacteria | 945 |
| 171 | Ga0105249_10197315 | 3300009553 | Bacteria | 1968 |
| 172 | Ga0105249_11694934 | 3300009553 | Bacteria | 705 |
| 173 | Ga0105249_13550048 | 3300009553 | Bacteria | 502 |
| 174 | Ga0105239_10021168 | 3300010375 | Bacteria | 7172 |
| 175 | Ga0105239_10064989 | 3300010375 | Bacteria | 4006 |
| 176 | Ga0105239_13164434 | 3300010375 | Bacteria | 536 |
| 177 | Ga0105246_10095445 | 3300011119 | Bacteria | 2153 |
| 178 | Ga0105246_11270223 | 3300011119 | Unclassified | 681 |
| 179 | Ga0105246_12551739 | 3300011119 | Bacteria | 504 |
| 180 | Ga0157337_1026718 | 3300012483 | Bacteria | 567 |
| 181 | Ga0157373_10055667 | 3300013100 | Bacteria | 2809 |
| 182 | Ga0157371_10131658 | 3300013102 | Bacteria | 1780 |
| 183 | Ga0157370_10026787 | 3300013104 | Bacteria | 5687 |
| 184 | Ga0157370_10132385 | 3300013104 | Bacteria | 2325 |
| 185 | Ga0157370_10192255 | 3300013104 | Bacteria | 1894 |
| 186 | Ga0157370_10273348 | 3300013104 | Bacteria | 1561 |
| 187 | Ga0157369_10030091 | 3300013105 | Bacteria | 5991 |
| 188 | Ga0157369_10040930 | 3300013105 | Bacteria | 5057 |
| 189 | Ga0157369_10104213 | 3300013105 | Bacteria | 3021 |
| 190 | Ga0157369_10408792 | 3300013105 | Bacteria | 1408 |
| 191 | Ga0157374_10021270 | 3300013296 | Bacteria | 5769 |
| 192 | Ga0157374_10028775 | 3300013296 | Bacteria | 5023 |
| 193 | Ga0157374_10170871 | 3300013296 | Bacteria | 2120 |
| 194 | Ga0157374_11557326 | 3300013296 | Bacteria | 685 |
| 195 | Ga0157378_10028470 | 3300013297 | Bacteria | 4930 |
| 196 | Ga0157378_10069193 | 3300013297 | Bacteria | 3166 |
| 197 | Ga0157378_12674430 | 3300013297 | Unclassified | 551 |
| 198 | Ga0157372_10006332 | 3300013307 | Bacteria | 12594 |
| 199 | Ga0157372_10051234 | 3300013307 | Bacteria | 4594 |
| 200 | Ga0157372_10083881 | 3300013307 | Bacteria | 3610 |
| 201 | Ga0157372_10185482 | 3300013307 | Bacteria | 2409 |
| 202 | Ga0157372_12829193 | 3300013307 | Bacteria | 556 |
| 203 | Ga0157375_10541034 | 3300013308 | Bacteria | 1327 |
| 204 | Ga0157375_11423138 | 3300013308 | Bacteria | 817 |
| 205 | Ga0157375_11945663 | 3300013308 | Bacteria | 698 |
| 206 | Ga0163163_10488975 | 3300014325 | Bacteria | 1292 |
| 207 | Ga0163163_11318267 | 3300014325 | Bacteria | 784 |
| 208 | Ga0157380_10426993 | 3300014326 | Unclassified | 1266 |
| 209 | Ga0157380_12597902 | 3300014326 | Bacteria | 573 |
| 210 | Ga0157380_12794223 | 3300014326 | Bacteria | 555 |
| 211 | Ga0182008_10125663 | 3300014497 | Bacteria | 1277 |
| 212 | Ga0182008_10548333 | 3300014497 | Bacteria | 642 |
| 213 | Ga0157379_10133885 | 3300014968 | Bacteria | 2232 |
| 214 | Ga0157376_10229361 | 3300014969 | Bacteria | 1724 |
| 215 | Ga0157376_10322620 | 3300014969 | Bacteria | 1469 |
| 216 | Ga0157376_10597358 | 3300014969 | Unclassified | 1098 |
| 217 | Ga0157376_11149807 | 3300014969 | Bacteria | 803 |
| 218 | Ga0157376_12100000 | 3300014969 | Bacteria | 603 |
| 219 | Ga0182006_1122101 | 3300015261 | Bacteria | 904 |
| 220 | Ga0182007_10098967 | 3300015262 | Bacteria | 964 |
| 221 | Ga0163161_10201118 | 3300017792 | Bacteria | 1535 |
| 222 | Ga0163161_10505719 | 3300017792 | Bacteria | 985 |
| 223 | Ga0163161_11440430 | 3300017792 | Bacteria | 603 |
| 224 | Ga0197907_10913843 | 3300020069 | Bacteria | 1073 |
| 225 | Ga0197907_11110821 | 3300020069 | Bacteria | 529 |
| 226 | Ga0206356_10103907 | 3300020070 | Bacteria | 975 |
| 227 | Ga0206356_10503281 | 3300020070 | Bacteria | 565 |
| 228 | Ga0206356_10596004 | 3300020070 | Bacteria | 2000 |
| 229 | Ga0206356_11115077 | 3300020070 | Bacteria | 845 |
| 230 | Ga0206356_11478649 | 3300020070 | Bacteria | 509 |
| 231 | Ga0206355_1251211 | 3300020076 | Bacteria | 503 |
| 232 | Ga0206355_1287509 | 3300020076 | Bacteria | 991 |
| 233 | Ga0206350_10489792 | 3300020080 | Bacteria | 856 |
| 234 | Ga0206354_10295194 | 3300020081 | Bacteria | 930 |
| 235 | Ga0206354_10412236 | 3300020081 | Bacteria | 831 |
| 236 | Ga0206354_10669380 | 3300020081 | Bacteria | 2394 |
| 237 | Ga0206353_11387566 | 3300020082 | Bacteria | 4498 |
| 238 | Ga0206353_11491132 | 3300020082 | Bacteria | 1633 |
| 239 | Ga0206353_11727024 | 3300020082 | Bacteria | 886 |
| 240 | Ga0154015_1029663 | 3300020610 | Bacteria | 617 |
| 241 | Ga0154015_1459760 | 3300020610 | Bacteria | 530 |
| 242 | Ga0213874_10071190 | 3300021377 | Bacteria | 1110 |
| 243 | Ga0213876_10177042 | 3300021384 | Bacteria | 1135 |
| 244 | Ga0224712_10006171 | 3300022467 | Bacteria | 3393 |
| 245 | Ga0224712_10135788 | 3300022467 | Bacteria | 1078 |
| 246 | Ga0224712_10175531 | 3300022467 | Bacteria | 963 |
| 247 | Ga0207642_10519908 | 3300025899 | Bacteria | 731 |
| 248 | Ga0207710_10164818 | 3300025900 | Bacteria | 1081 |
| 249 | Ga0207710_10168932 | 3300025900 | Bacteria | 1069 |
| 250 | Ga0207688_10056833 | 3300025901 | Bacteria | 2199 |
| 251 | Ga0207680_10213416 | 3300025903 | Unclassified | 1320 |
| 252 | Ga0207647_10291542 | 3300025904 | Bacteria | 930 |
| 253 | Ga0207647_10531479 | 3300025904 | Bacteria | 654 |
| 254 | Ga0207685_10011554 | 3300025905 | Bacteria | 2659 |
| 255 | Ga0207685_10155657 | 3300025905 | Bacteria | 1039 |
| 256 | Ga0207643_10356051 | 3300025908 | Bacteria | 919 |
| 257 | Ga0207705_10051988 | 3300025909 | Bacteria | 2949 |
| 258 | Ga0207684_10004965 | 3300025910 | Bacteria | 12408 |
| 259 | Ga0207684_10264467 | 3300025910 | Bacteria | 1484 |
| 260 | Ga0207684_10955404 | 3300025910 | Bacteria | 718 |
| 261 | Ga0207654_10116834 | 3300025911 | Bacteria | 1669 |
| 262 | Ga0207654_10171698 | 3300025911 | Bacteria | 1408 |
| 263 | Ga0207654_10238293 | 3300025911 | Bacteria | 1215 |
| 264 | Ga0207654_10383394 | 3300025911 | Bacteria | 974 |
| 265 | Ga0207654_10662506 | 3300025911 | Bacteria | 748 |
| 266 | Ga0207707_10006792 | 3300025912 | Bacteria | 9984 |
| 267 | Ga0207707_10008124 | 3300025912 | Bacteria | 9112 |
| 268 | Ga0207695_10811588 | 3300025913 | Bacteria | 816 |
| 269 | Ga0207671_10282570 | 3300025914 | Bacteria | 1309 |
| 270 | Ga0207671_10414442 | 3300025914 | Bacteria | 1072 |
| 271 | Ga0207671_11368290 | 3300025914 | Bacteria | 550 |
| 272 | Ga0207693_10071680 | 3300025915 | Bacteria | 2712 |
| 273 | Ga0207663_10066038 | 3300025916 | Bacteria | 2314 |
| 274 | Ga0207663_10386863 | 3300025916 | Unclassified | 1067 |
| 275 | Ga0207660_10214069 | 3300025917 | Bacteria | 1510 |
| 276 | Ga0207660_10381928 | 3300025917 | Bacteria | 1132 |
| 277 | Ga0207657_10004765 | 3300025919 | Bacteria | 14310 |
| 278 | Ga0207657_10016023 | 3300025919 | Bacteria | 7235 |
| 279 | Ga0207657_10196543 | 3300025919 | Bacteria | 1625 |
| 280 | Ga0207649_10021258 | 3300025920 | Bacteria | 3732 |
| 281 | Ga0207649_10081017 | 3300025920 | Bacteria | 2101 |
| 282 | Ga0207649_10218566 | 3300025920 | Bacteria | 1356 |
| 283 | Ga0207652_10027233 | 3300025921 | Bacteria | 4762 |
| 284 | Ga0207652_10100346 | 3300025921 | Bacteria | 2555 |
| 285 | Ga0207652_10442742 | 3300025921 | Bacteria | 1171 |
| 286 | Ga0207652_11156007 | 3300025921 | Bacteria | 675 |
| 287 | Ga0207646_10042572 | 3300025922 | Bacteria | 4079 |
| 288 | Ga0207646_10182184 | 3300025922 | Bacteria | 1897 |
| 289 | Ga0207646_10347464 | 3300025922 | Bacteria | 1340 |
| 290 | Ga0207646_10519811 | 3300025922 | Unclassified | 1072 |
| 291 | Ga0207694_10022612 | 3300025924 | Bacteria | 4770 |
| 292 | Ga0207694_10255449 | 3300025924 | Bacteria | 1435 |
| 293 | Ga0207687_10033171 | 3300025927 | Bacteria | 3501 |
| 294 | Ga0207687_10087942 | 3300025927 | Bacteria | 2259 |
| 295 | Ga0207687_10238094 | 3300025927 | Bacteria | 1441 |
| 296 | Ga0207687_10456349 | 3300025927 | Bacteria | 1061 |
| 297 | Ga0207687_10620651 | 3300025927 | Unclassified | 913 |
| 298 | Ga0207664_10510534 | 3300025929 | Unclassified | 1077 |
| 299 | Ga0207644_10802325 | 3300025931 | Bacteria | 787 |
| 300 | Ga0207690_10098751 | 3300025932 | Bacteria | 2080 |
| 301 | Ga0207690_10113010 | 3300025932 | Bacteria | 1959 |
| 302 | Ga0207690_10375101 | 3300025932 | Bacteria | 1129 |
| 303 | Ga0207706_10266441 | 3300025933 | Bacteria | 1495 |
| 304 | Ga0207686_10027445 | 3300025934 | Bacteria | 3335 |
| 305 | Ga0207686_10047765 | 3300025934 | Bacteria | 2648 |
| 306 | Ga0207686_11763859 | 3300025934 | Unclassified | 512 |
| 307 | Ga0207709_10017610 | 3300025935 | Bacteria | 3989 |
| 308 | Ga0207709_10167895 | 3300025935 | Bacteria | 1537 |
| 309 | Ga0207709_10712520 | 3300025935 | Bacteria | 804 |
| 310 | Ga0207709_10991680 | 3300025935 | Bacteria | 686 |
| 311 | Ga0207669_10040730 | 3300025937 | Bacteria | 2698 |
| 312 | Ga0207704_10202833 | 3300025938 | Bacteria | 1453 |
| 313 | Ga0207704_10230971 | 3300025938 | Bacteria | 1376 |
| 314 | Ga0207704_10331760 | 3300025938 | Unclassified | 1177 |
| 315 | Ga0207665_10138286 | 3300025939 | Bacteria | 1734 |
| 316 | Ga0207711_10142535 | 3300025941 | Bacteria | 2157 |
| 317 | Ga0207661_10372072 | 3300025944 | Bacteria | 1292 |
| 318 | Ga0207661_10966109 | 3300025944 | Bacteria | 785 |
| 319 | Ga0207661_11537705 | 3300025944 | Bacteria | 609 |
| 320 | Ga0207661_11693779 | 3300025944 | Bacteria | 577 |
| 321 | Ga0207679_10234865 | 3300025945 | Bacteria | 1550 |
| 322 | Ga0207667_10205237 | 3300025949 | Bacteria | 2021 |
| 323 | Ga0207667_10310643 | 3300025949 | Bacteria | 1610 |
| 324 | Ga0207667_10344476 | 3300025949 | Bacteria | 1520 |
| 325 | Ga0207667_10962024 | 3300025949 | Unclassified | 843 |
| 326 | Ga0207651_10781922 | 3300025960 | Unclassified | 845 |
| 327 | Ga0207651_10988283 | 3300025960 | Bacteria | 752 |
| 328 | Ga0207712_10926934 | 3300025961 | Bacteria | 771 |
| 329 | Ga0207640_10038906 | 3300025981 | Bacteria | 3005 |
| 330 | Ga0207640_10705480 | 3300025981 | Bacteria | 865 |
| 331 | Ga0207640_11349502 | 3300025981 | Bacteria | 638 |
| 332 | Ga0207640_11636438 | 3300025981 | Bacteria | 580 |
| 333 | Ga0207658_10105364 | 3300025986 | Bacteria | 2218 |
| 334 | Ga0207658_11822664 | 3300025986 | Bacteria | 555 |
| 335 | Ga0207677_11279497 | 3300026023 | Bacteria | 673 |
| 336 | Ga0207703_10264621 | 3300026035 | Bacteria | 1555 |
| 337 | Ga0207703_10411685 | 3300026035 | Bacteria | 1256 |
| 338 | Ga0207639_10159484 | 3300026041 | Bacteria | 1899 |
| 339 | Ga0207639_11992275 | 3300026041 | Bacteria | 542 |
| 340 | Ga0207639_12289086 | 3300026041 | Bacteria | 502 |
| 341 | Ga0207678_10097724 | 3300026067 | Bacteria | 2509 |
| 342 | Ga0207678_10261429 | 3300026067 | Bacteria | 1483 |
| 343 | Ga0207678_10523298 | 3300026067 | Bacteria | 1035 |
| 344 | Ga0207708_10004026 | 3300026075 | Bacteria | 10811 |
| 345 | Ga0207708_10687931 | 3300026075 | Bacteria | 873 |
| 346 | Ga0207702_10107003 | 3300026078 | Bacteria | 2479 |
| 347 | Ga0207702_10279314 | 3300026078 | Bacteria | 1578 |
| 348 | Ga0207702_10373709 | 3300026078 | Bacteria | 1369 |
| 349 | Ga0207702_10763958 | 3300026078 | Bacteria | 954 |
| 350 | Ga0207648_10129610 | 3300026089 | Bacteria | 2220 |
| 351 | Ga0207648_11997922 | 3300026089 | Bacteria | 541 |
| 352 | Ga0207676_11131269 | 3300026095 | Bacteria | 775 |
| 353 | Ga0207674_10034277 | 3300026116 | Bacteria | 5310 |
| 354 | Ga0207674_10446681 | 3300026116 | Bacteria | 1250 |
| 355 | Ga0207683_10000876 | 3300026121 | Bacteria | 27583 |
| 356 | Ga0207698_10036602 | 3300026142 | Bacteria | 3604 |
| 357 | Ga0207698_10402650 | 3300026142 | Bacteria | 1308 |
| 358 | Ga0207698_10656217 | 3300026142 | Bacteria | 1040 |
| 359 | Ga0207698_11419273 | 3300026142 | Bacteria | 709 |
| 360 | Ga0207698_11754108 | 3300026142 | Bacteria | 636 |
| 361 | Ga0268266_10080384 | 3300028379 | Bacteria | 2840 |
| 362 | Ga0268266_10223952 | 3300028379 | Bacteria | 1730 |
| 363 | Ga0268264_10050649 | 3300028381 | Bacteria | 3458 |
| 364 | Ga0265319_1028375 | 3300028563 | Bacteria | 1974 |
| 365 | Ga0265319_1054231 | 3300028563 | Bacteria | 1315 |
| 366 | Ga0265334_10285742 | 3300028573 | Bacteria | 566 |
| 367 | Ga0265318_10173648 | 3300028577 | Bacteria | 789 |
| 368 | Ga0265338_10327795 | 3300028800 | Unclassified | 1107 |
| 369 | Ga0265338_10881946 | 3300028800 | Bacteria | 610 |
| 370 | Ga0265320_10009779 | 3300031240 | Bacteria | 5755 |
| 371 | Ga0265320_10016252 | 3300031240 | Bacteria | 4176 |
| 372 | Ga0265327_10057127 | 3300031251 | Bacteria | 2008 |
| 373 | Ga0307416_100415878 | 3300032002 | Unclassified | 1387 |
| 374 | Ga0373944_0024448 | 3300035089 | Bacteria | 1771 |
| 375 | Ga0373944_0126481 | 3300035089 | Bacteria | 885 |
| 376 | Ga0373936_0016183 | 3300035113 | Bacteria | 2867 |
| 377 | Ga0373945_0003861 | 3300035116 | Bacteria | 4734 |
| 378 | Ga0373943_0008082 | 3300035170 | Bacteria | 4718 |
| 379 | Ga0373943_0544967 | 3300035170 | Bacteria | 680 |
| 380 | Ga0373943_0799242 | 3300035170 | Bacteria | 561 |
| 381 | Ga0373946_0529395 | 3300035171 | Bacteria | 606 |
| 382 | Ga0373931_0381312 | 3300035691 | Unclassified | 889 |
| 383 | Ga0373935_0094404 | 3300035692 | Bacteria | 1963 |
| 384 | Ga0373935_1281963 | 3300035692 | Bacteria | 547 |
| 385 | Ga0373927_0223428 | 3300035695 | Bacteria | 1237 |
| 386 | Ga0373947_0000590 | 3300035725 | Bacteria | 21313 |
| 387 | Ga0373947_0326136 | 3300035725 | Bacteria | 1027 |
| 388 | Ga0373925_0025998 | 3300037068 | Bacteria | 4280 |
| 389 | Ga0373925_0446395 | 3300037068 | Bacteria | 1059 |
| 390 | Ga0373925_0498867 | 3300037068 | Bacteria | 999 |
| 391 | Ga0373925_1403180 | 3300037068 | Bacteria | 572 |
| 392 | Ga0395899_0055703 | 3300037312 | Bacteria | 2924 |
| 393 | Ga0395899_0180397 | 3300037312 | Bacteria | 1483 |
| 394 | Ga0395899_0299345 | 3300037312 | Bacteria | 1089 |
| 395 | Ga0395899_0368691 | 3300037312 | Bacteria | 957 |
| 396 | Ga0395899_0921280 | 3300037312 | Bacteria | 532 |
| 397 | Ga0395900_0015152 | 3300037418 | Bacteria | 7861 |
| 398 | Ga0395900_0406131 | 3300037418 | Bacteria | 1325 |
| 399 | Ga0395900_0468924 | 3300037418 | Bacteria | 1213 |
| 400 | Ga0395900_0474315 | 3300037418 | Bacteria | 1204 |
| 401 | Ga0395900_1823630 | 3300037418 | Bacteria | 519 |
| 402 | Ga0395898_0038285 | 3300037466 | Bacteria | 4754 |
| 403 | Ga0395898_0077907 | 3300037466 | Bacteria | 3199 |
| 404 | Ga0395898_0211411 | 3300037466 | Bacteria | 1850 |
| 405 | Ga0395898_0616880 | 3300037466 | Bacteria | 1027 |
| 406 | Ga0395898_1071953 | 3300037466 | Bacteria | 740 |
| 407 | Ga0395898_1854759 | 3300037466 | Bacteria | 523 |
| 408 | Ga0395905_0444462 | 3300037471 | Bacteria | 1194 |
| 409 | Ga0395905_0741391 | 3300037471 | Bacteria | 885 |
| 410 | Ga0395905_0845780 | 3300037471 | Bacteria | 818 |
| 411 | Ga0395905_1331165 | 3300037471 | Bacteria | 622 |
| 412 | Ga0395901_0079715 | 3300038443 | Bacteria | 3419 |
| 413 | Ga0395901_0126642 | 3300038443 | Bacteria | 2684 |
| 414 | Ga0395901_0128336 | 3300038443 | Bacteria | 2665 |
| 415 | Ga0395901_0735536 | 3300038443 | Bacteria | 981 |
| 416 | Ga0395901_0897983 | 3300038443 | Bacteria | 868 |
| 417 | Ga0436365_0489299 | 3300039437 | Bacteria | 840 |
| 418 | Ga0436365_0894153 | 3300039437 | Bacteria | 2567 |
| 419 | Ga0436365_1695513 | 3300039437 | Bacteria | 681 |
| 420 | Ga0436365_1738713 | 3300039437 | Bacteria | 2309 |
| 421 | Ga0436363_1518906 | 3300039450 | Bacteria | 586 |
| 422 | Ga0451839_0323294 | 3300041496 | Bacteria | 506 |
| 423 | Ga0451853_1552171 | 3300041512 | Bacteria | 707 |
| 424 | Ga0439448_0044150 | 3300042005 | Bacteria | 1449 |
| 425 | Ga0450920_006037 | 3300042122 | Bacteria | 2168 |
| 426 | Ga0450907_096719 | 3300042146 | Unclassified | 514 |
| 427 | Ga0439459_0155262 | 3300042438 | Bacteria | 601 |
| 428 | Ga0450918_032812 | 3300042531 | Unclassified | 919 |
| 429 | Ga0466972_0283130 | 3300044658 | Bacteria | 775 |
| 430 | Ga0466972_0290705 | 3300044658 | Bacteria | 764 |
| 431 | Ga0466965_0407738 | 3300044683 | Bacteria | 752 |
| 432 | Ga0466966_0002834 | 3300044684 | Bacteria | 11411 |
| 433 | Ga0466966_0108652 | 3300044684 | Bacteria | 1711 |
| 434 | Ga0466966_0280549 | 3300044684 | Bacteria | 1002 |
| 435 | Ga0466961_0011148 | 3300044693 | Bacteria | 5746 |
| 436 | Ga0466961_0040813 | 3300044693 | Bacteria | 2975 |
| 437 | Ga0466961_0142256 | 3300044693 | Bacteria | 1501 |
| 438 | Ga0466961_0904722 | 3300044693 | Bacteria | 525 |
| 439 | Ga0466963_0000037 | 3300044694 | Bacteria | 42541 |
| 440 | Ga0466963_0012580 | 3300044694 | Bacteria | 5184 |
| 441 | Ga0466963_0019970 | 3300044694 | Bacteria | 4210 |
| 442 | Ga0466963_0025907 | 3300044694 | Bacteria | 3745 |
| 443 | Ga0466963_0039167 | 3300044694 | Bacteria | 3103 |
| 444 | Ga0466963_0107955 | 3300044694 | Bacteria | 1909 |
| 445 | Ga0466963_0434860 | 3300044694 | Bacteria | 925 |
| 446 | Ga0466964_0016749 | 3300044706 | Bacteria | 2801 |
| 447 | Ga0466964_0025011 | 3300044706 | Bacteria | 2330 |
| 448 | Ga0466964_0148086 | 3300044706 | Bacteria | 1085 |
| 449 | Ga0466964_0175895 | 3300044706 | Bacteria | 1011 |
| 450 | Ga0466964_0186342 | 3300044706 | Bacteria | 987 |
| 451 | Ga0466964_0835282 | 3300044706 | Bacteria | 523 |
| 452 | Ga0466971_0150491 | 3300044719 | Bacteria | 1086 |
| 453 | Ga0466971_0356469 | 3300044719 | Bacteria | 708 |
| 454 | Ga0466971_0474972 | 3300044719 | Bacteria | 615 |
| 455 | Ga0466968_0015622 | 3300044735 | Bacteria | 3012 |
| 456 | Ga0466968_0653972 | 3300044735 | Bacteria | 534 |
| 457 | Ga0466970_0189969 | 3300044765 | Bacteria | 1141 |
| 458 | Ga0466970_0223888 | 3300044765 | Bacteria | 1050 |
| 459 | Ga0466957_0106615 | 3300044842 | Bacteria | 1773 |
| 460 | Ga0466957_0340807 | 3300044842 | Bacteria | 1015 |
| 461 | Ga0466957_0487690 | 3300044842 | Bacteria | 853 |
| 462 | Ga0466957_0562358 | 3300044842 | Bacteria | 795 |
| 463 | Ga0466960_0756336 | 3300044901 | Bacteria | 586 |
| 464 | Ga0466959_0009015 | 3300045049 | Bacteria | 7075 |
| 465 | Ga0466959_0101180 | 3300045049 | Bacteria | 2063 |
| 466 | Ga0466959_0199798 | 3300045049 | Bacteria | 1392 |
| 467 | Ga0466959_0286203 | 3300045049 | Bacteria | 1130 |
| 468 | Ga0466959_0722936 | 3300045049 | Bacteria | 667 |
| 469 | Ga0466958_0062153 | 3300045836 | Bacteria | 2276 |
| 470 | Ga0466958_0179435 | 3300045836 | Bacteria | 1343 |
| 471 | Ga0466958_0650196 | 3300045836 | Bacteria | 686 |
| 472 | Ga0466967_0005846 | 3300045976 | Bacteria | 8607 |
| 473 | Ga0466967_0006284 | 3300045976 | Bacteria | 8380 |
| 474 | Ga0466967_0018080 | 3300045976 | Bacteria | 5623 |
| 475 | Ga0466967_0048083 | 3300045976 | Bacteria | 3723 |
| 476 | Ga0466967_0075125 | 3300045976 | Bacteria | 3037 |
| 477 | Ga0466967_0088756 | 3300045976 | Bacteria | 2806 |
| 478 | Ga0466967_0112904 | 3300045976 | Bacteria | 2499 |
| 479 | Ga0466967_0114331 | 3300045976 | Bacteria | 2484 |
| 480 | Ga0466967_0114427 | 3300045976 | Bacteria | 2483 |
| 481 | Ga0466967_0178941 | 3300045976 | Bacteria | 1999 |
| 482 | Ga0466967_0215476 | 3300045976 | Bacteria | 1822 |
| 483 | Ga0466967_0387149 | 3300045976 | Bacteria | 1358 |
| 484 | Ga0466967_0490601 | 3300045976 | Bacteria | 1204 |
| 485 | Ga0466967_0529334 | 3300045976 | Bacteria | 1159 |
| 486 | Ga0466967_0558042 | 3300045976 | Archaea | 1128 |
| 487 | Ga0466967_0610262 | 3300045976 | Bacteria | 1077 |
| 488 | Ga0466967_0625919 | 3300045976 | Bacteria | 1063 |
| 489 | Ga0466967_0631097 | 3300045976 | Unclassified | 1059 |
| 490 | Ga0466967_0733273 | 3300045976 | Unclassified | 980 |
| 491 | Ga0466967_0790312 | 3300045976 | Bacteria | 942 |
| 492 | Ga0466967_0849445 | 3300045976 | Bacteria | 907 |
| 493 | Ga0466967_0947326 | 3300045976 | Bacteria | 857 |
| 494 | Ga0466967_0974087 | 3300045976 | Bacteria | 844 |
| 495 | Ga0466967_1128168 | 3300045976 | Bacteria | 781 |
| 496 | Ga0495603_0097150 | 3300046455 | Bacteria | 1721 |
| 497 | Ga0495603_0187160 | 3300046455 | Bacteria | 1197 |
| 498 | Ga0495603_0189117 | 3300046455 | Unclassified | 1190 |
| 499 | Ga0495641_0024564 | 3300046461 | Bacteria | 2973 |
| 500 | Ga0495641_0114789 | 3300046461 | Bacteria | 1201 |
| 501 | Ga0495641_0118566 | 3300046461 | Bacteria | 1180 |
| 502 | Ga0495653_0223428 | 3300046463 | Bacteria | 1265 |
| 503 | Ga0495580_0201644 | 3300046472 | Bacteria | 1370 |
| 504 | Ga0495582_0042237 | 3300046473 | Bacteria | 2512 |
| 505 | Ga0495582_0125183 | 3300046473 | Unclassified | 1450 |
| 506 | Ga0495582_0170654 | 3300046473 | Bacteria | 1238 |
| 507 | Ga0495582_0237450 | 3300046473 | Bacteria | 1044 |
| 508 | Ga0495639_0244442 | 3300046475 | Bacteria | 886 |
| 509 | Ga0495639_0421677 | 3300046475 | Unclassified | 676 |
| 510 | Ga0495584_0646709 | 3300046491 | Bacteria | 539 |
| 511 | Ga0495594_0153577 | 3300046499 | Bacteria | 1307 |
| 512 | Ga0495608_0216221 | 3300046511 | Bacteria | 1204 |
| 513 | Ga0495630_0143360 | 3300046517 | Bacteria | 1816 |
| 514 | Ga0495630_0160665 | 3300046517 | Bacteria | 1711 |
| 515 | Ga0495630_0202847 | 3300046517 | Bacteria | 1513 |
| 516 | Ga0495630_1081795 | 3300046517 | Bacteria | 608 |
| 517 | Ga0495640_0256980 | 3300046533 | Bacteria | 1092 |
| 518 | Ga0495586_0006168 | 3300046535 | Bacteria | 6409 |
| 519 | Ga0495586_0121463 | 3300046535 | Unclassified | 1460 |
| 520 | Ga0495587_0110294 | 3300046536 | Bacteria | 1581 |
| 521 | Ga0495587_0216860 | 3300046536 | Bacteria | 1080 |
| 522 | Ga0495667_0376677 | 3300046559 | Bacteria | 895 |
| 523 | Ga0495656_0673042 | 3300046615 | Bacteria | 556 |
| 524 | Ga0495634_0117263 | 3300046642 | Bacteria | 1707 |
| 525 | Ga0495634_0489784 | 3300046642 | Bacteria | 722 |
| 526 | Ga0495588_0066979 | 3300046674 | Bacteria | 1864 |
| 527 | Ga0495646_0507906 | 3300046680 | Unclassified | 618 |
| 528 | Ga0495647_0075764 | 3300046681 | Bacteria | 1355 |
| 529 | Ga0495658_0030986 | 3300046683 | Bacteria | 2909 |
| 530 | Ga0495658_0273735 | 3300046683 | Unclassified | 1065 |
| 531 | Ga0495670_0836024 | 3300046691 | Unclassified | 503 |
| 532 | Ga0495649_0423914 | 3300046694 | Bacteria | 666 |
| 533 | Ga0495581_0751410 | 3300047315 | Bacteria | 561 |
| 534 | Ga0495604_0774357 | 3300047317 | Bacteria | 606 |
| 535 | Ga0495674_0126270 | 3300047319 | Bacteria | 2158 |
| 536 | Ga0495674_0237914 | 3300047319 | Bacteria | 1501 |
| 537 | Ga0495674_0359859 | 3300047319 | Bacteria | 1180 |
| 538 | Ga0495676_0154000 | 3300047321 | Unclassified | 1633 |
| 539 | Ga0495676_0329227 | 3300047321 | Unclassified | 1025 |
| 540 | Ga0495676_0700229 | 3300047321 | Bacteria | 655 |
| 541 | Ga0495680_0864477 | 3300047322 | Bacteria | 587 |
| 542 | Ga0495593_0072214 | 3300047673 | Bacteria | 1792 |
| 543 | Ga0496100_0017728 | 3300048903 | Bacteria | 4210 |
| 544 | Ga0496100_0028950 | 3300048903 | Bacteria | 3421 |
| 545 | Ga0496100_0030673 | 3300048903 | Bacteria | 3336 |
| 546 | Ga0496100_0566871 | 3300048903 | Bacteria | 880 |
| 547 | Ga0496100_1020944 | 3300048903 | Bacteria | 651 |
| 548 | Ga0496101_0000692 | 3300048904 | Bacteria | 20340 |
| 549 | Ga0496101_0049101 | 3300048904 | Bacteria | 3034 |
| 550 | Ga0496101_0140299 | 3300048904 | Bacteria | 1841 |
| 551 | Ga0496101_0152153 | 3300048904 | Bacteria | 1770 |
| 552 | Ga0496101_0746118 | 3300048904 | Bacteria | 772 |
| 553 | Ga0496102_0005991 | 3300048905 | Bacteria | 10353 |
| 554 | Ga0496102_0053045 | 3300048905 | Bacteria | 3696 |
| 555 | Ga0496102_0335135 | 3300048905 | Bacteria | 1425 |
| 556 | Ga0496102_0960865 | 3300048905 | Bacteria | 775 |
| 557 | Ga0496103_0011503 | 3300048906 | Bacteria | 5244 |
| 558 | Ga0496103_0196712 | 3300048906 | Bacteria | 1296 |
| 559 | Ga0496103_0199074 | 3300048906 | Bacteria | 1288 |
| 560 | Ga0496103_0449315 | 3300048906 | Bacteria | 827 |
| 561 | Ga0496104_0002218 | 3300048907 | Bacteria | 16788 |
| 562 | Ga0496104_0011990 | 3300048907 | Bacteria | 7776 |
| 563 | Ga0496104_0038000 | 3300048907 | Bacteria | 4502 |
| 564 | Ga0496104_0303474 | 3300048907 | Bacteria | 1509 |
| 565 | Ga0496104_0447155 | 3300048907 | Unclassified | 1204 |
| 566 | Ga0496104_0813858 | 3300048907 | Bacteria | 840 |
| 567 | Ga0496105_0002671 | 3300048908 | Bacteria | 12983 |
| 568 | Ga0496105_0014914 | 3300048908 | Bacteria | 6186 |
| 569 | Ga0496105_0025956 | 3300048908 | Bacteria | 4774 |
| 570 | Ga0496106_0003662 | 3300048909 | Bacteria | 11458 |
| 571 | Ga0496106_0003900 | 3300048909 | Bacteria | 11133 |
| 572 | Ga0496106_0026843 | 3300048909 | Bacteria | 4288 |
| 573 | Ga0496106_0047654 | 3300048909 | Bacteria | 3226 |
| 574 | Ga0496106_0372413 | 3300048909 | Bacteria | 1148 |
| 575 | Ga0496107_0016367 | 3300048910 | Bacteria | 5204 |
| 576 | Ga0496107_0102525 | 3300048910 | Bacteria | 2098 |
| 577 | Ga0496107_0222140 | 3300048910 | Bacteria | 1405 |
| 578 | Ga0496107_0263535 | 3300048910 | Bacteria | 1282 |
| 579 | Ga0496107_0343101 | 3300048910 | Bacteria | 1111 |
| 580 | Ga0496107_0358709 | 3300048910 | Bacteria | 1085 |
| 581 | Ga0496107_0950971 | 3300048910 | Bacteria | 625 |
| 582 | Ga0496108_0006069 | 3300048911 | Bacteria | 9769 |
| 583 | Ga0496108_0057187 | 3300048911 | Bacteria | 3277 |
| 584 | Ga0496108_0180373 | 3300048911 | Bacteria | 1828 |
| 585 | Ga0496108_0275534 | 3300048911 | Bacteria | 1465 |
| 586 | Ga0496108_0451628 | 3300048911 | Bacteria | 1123 |
| 587 | Ga0496108_0640216 | 3300048911 | Bacteria | 925 |
| 588 | Ga0496108_1472549 | 3300048911 | Bacteria | 567 |
| 589 | Ga0496109_0002789 | 3300048912 | Bacteria | 14634 |
| 590 | Ga0496109_0022559 | 3300048912 | Bacteria | 5577 |
| 591 | Ga0496109_0024902 | 3300048912 | Bacteria | 5327 |
| 592 | Ga0496109_0165720 | 3300048912 | Bacteria | 2071 |
| 593 | Ga0496109_0264127 | 3300048912 | Bacteria | 1621 |
| 594 | Ga0496109_0997186 | 3300048912 | Bacteria | 775 |
| 595 | Ga0496110_0004178 | 3300048913 | Bacteria | 11153 |
| 596 | Ga0496110_0066822 | 3300048913 | Bacteria | 3180 |
| 597 | Ga0496111_0010710 | 3300048914 | Bacteria | 6167 |
| 598 | Ga0496111_0033409 | 3300048914 | Bacteria | 3669 |
| 599 | Ga0496111_0150008 | 3300048914 | Bacteria | 1729 |
| 600 | Ga0496111_0179718 | 3300048914 | Bacteria | 1573 |
| 601 | Ga0496111_0284008 | 3300048914 | Bacteria | 1228 |
| 602 | Ga0496111_0921586 | 3300048914 | Bacteria | 629 |
| 603 | Ga0496112_0198220 | 3300048915 | Bacteria | 1968 |
| 604 | Ga0496112_0298617 | 3300048915 | Bacteria | 1556 |
| 605 | Ga0496112_0329180 | 3300048915 | Bacteria | 1472 |
| 606 | Ga0496112_0446110 | 3300048915 | Bacteria | 1232 |
| 607 | Ga0496112_0584436 | 3300048915 | Bacteria | 1049 |
| 608 | Ga0496112_0818046 | 3300048915 | Bacteria | 856 |
| 609 | Ga0496112_1102233 | 3300048915 | Bacteria | 712 |
| 610 | Ga0496112_1638728 | 3300048915 | Bacteria | 556 |
| 611 | Ga0496112_1692982 | 3300048915 | Bacteria | 545 |
| 612 | Ga0496113_0026347 | 3300048916 | Bacteria | 4156 |
| 613 | Ga0496113_0071185 | 3300048916 | Bacteria | 2645 |
| 614 | Ga0496113_0324999 | 3300048916 | Bacteria | 1233 |
| 615 | Ga0496113_0359706 | 3300048916 | Bacteria | 1168 |
| 616 | Ga0496114_0002457 | 3300048917 | Bacteria | 14154 |
| 617 | Ga0496114_0008736 | 3300048917 | Bacteria | 8027 |
| 618 | Ga0496114_0229566 | 3300048917 | Bacteria | 1630 |
| 619 | Ga0496114_0258633 | 3300048917 | Bacteria | 1532 |
| 620 | Ga0496114_0282877 | 3300048917 | Bacteria | 1462 |
| 621 | Ga0496114_0618246 | 3300048917 | Unclassified | 954 |
| 622 | Ga0496114_0685957 | 3300048917 | Bacteria | 899 |
| 623 | Ga0496115_0005151 | 3300048918 | Bacteria | 9511 |
| 624 | Ga0496115_0108794 | 3300048918 | Bacteria | 2276 |
| 625 | Ga0496115_0224670 | 3300048918 | Bacteria | 1549 |
| 626 | Ga0501031_0344451 | 3300049568 | Bacteria | 965 |
| 627 | Ga0501032_0242821 | 3300049569 | Bacteria | 1170 |
| 628 | Ga0501033_1052515 | 3300049570 | Bacteria | 542 |
| 629 | Ga0501034_0321166 | 3300049571 | Bacteria | 1481 |
| 630 | Ga0501036_0356252 | 3300049572 | Bacteria | 1222 |
| 631 | Ga0501036_0547212 | 3300049572 | Bacteria | 962 |
| 632 | Ga0501036_1398409 | 3300049572 | Bacteria | 567 |
| 633 | Ga0501039_0941766 | 3300049575 | Bacteria | 672 |
| 634 | Ga0501039_1042575 | 3300049575 | Bacteria | 635 |
| 635 | Ga0501039_1249633 | 3300049575 | Bacteria | 574 |
| 636 | Ga0501040_0131703 | 3300049576 | Bacteria | 1759 |
| 637 | Ga0501041_0214980 | 3300049577 | Bacteria | 1206 |
| 638 | Ga0501041_0562229 | 3300049577 | Bacteria | 727 |
| 639 | Ga0501046_0848257 | 3300049580 | Bacteria | 639 |
| 640 | Ga0501047_0061170 | 3300049581 | Bacteria | 3634 |
| 641 | Ga0501047_0219398 | 3300049581 | Bacteria | 1758 |
| 642 | Ga0501047_0696142 | 3300049581 | Bacteria | 834 |
| 643 | Ga0501048_0242298 | 3300049582 | Bacteria | 1280 |
| 644 | Ga0501048_1066701 | 3300049582 | Bacteria | 581 |
| 645 | Ga0501048_1373482 | 3300049582 | Bacteria | 508 |
| 646 | Ga0501067_0000163 | 3300049583 | Bacteria | 37467 |
| 647 | Ga0501067_0080425 | 3300049583 | Unclassified | 1806 |
| 648 | Ga0501068_0082316 | 3300049584 | Bacteria | 1977 |
| 649 | Ga0501069_0003809 | 3300049585 | Bacteria | 7759 |
| 650 | Ga0501069_0129026 | 3300049585 | Unclassified | 1447 |
| 651 | Ga0501069_0325813 | 3300049585 | Bacteria | 903 |
| 652 | Ga0501069_0647349 | 3300049585 | Bacteria | 636 |
| 653 | Ga0501070_0003032 | 3300049586 | Bacteria | 14629 |
| 654 | Ga0501070_0067716 | 3300049586 | Bacteria | 2957 |
| 655 | Ga0501070_0310143 | 3300049586 | Bacteria | 1284 |
| 656 | Ga0501070_0323861 | 3300049586 | Bacteria | 1253 |
| 657 | Ga0501070_0396149 | 3300049586 | Bacteria | 1117 |
| 658 | Ga0501070_0883218 | 3300049586 | Unclassified | 698 |
| 659 | Ga0501071_0128485 | 3300049587 | Bacteria | 1882 |
| 660 | Ga0501071_0268424 | 3300049587 | Bacteria | 1290 |
| 661 | Ga0501072_0307219 | 3300049588 | Bacteria | 1261 |
| 662 | Ga0501072_0391156 | 3300049588 | Bacteria | 1103 |
| 663 | Ga0501073_0739985 | 3300049589 | Bacteria | 678 |
| 664 | Ga0501073_1126670 | 3300049589 | Bacteria | 539 |
| 665 | Ga0501074_0012591 | 3300049590 | Bacteria | 6149 |
| 666 | Ga0501074_0200257 | 3300049590 | Bacteria | 1423 |
| 667 | Ga0501075_0179876 | 3300049591 | Bacteria | 1614 |
| 668 | Ga0501075_0185043 | 3300049591 | Bacteria | 1589 |
| 669 | Ga0501075_0190546 | 3300049591 | Bacteria | 1564 |
| 670 | Ga0501075_0595823 | 3300049591 | Bacteria | 843 |
| 671 | Ga0501075_1475497 | 3300049591 | Unclassified | 515 |
| 672 | Ga0501076_0636894 | 3300049592 | Bacteria | 880 |
| 673 | Ga0501076_1797433 | 3300049592 | Bacteria | 502 |
| 674 | Ga0501077_0057161 | 3300049593 | Bacteria | 2477 |
| 675 | Ga0501077_0261169 | 3300049593 | Bacteria | 1101 |
| 676 | Ga0501077_0373892 | 3300049593 | Bacteria | 910 |
| 677 | Ga0501257_217013 | 3300049686 | Unclassified | 556 |
| 678 | Ga0501079_0178201 | 3300049741 | Bacteria | 1658 |
| 679 | Ga0501079_0386254 | 3300049741 | Bacteria | 1098 |
| 680 | Ga0501079_0918928 | 3300049741 | Bacteria | 689 |
| 681 | Ga0501079_1580998 | 3300049741 | Unclassified | 516 |
| 682 | Ga0501080_0186373 | 3300049742 | Bacteria | 1908 |
| 683 | Ga0501080_0248406 | 3300049742 | Bacteria | 1622 |
| 684 | Ga0501080_0261699 | 3300049742 | Unclassified | 1576 |
| 685 | Ga0501080_0497086 | 3300049742 | Bacteria | 1090 |
| 686 | Ga0501081_0147649 | 3300049743 | Bacteria | 1688 |
| 687 | Ga0501081_0332671 | 3300049743 | Unclassified | 1118 |
| 688 | Ga0501081_0903815 | 3300049743 | Bacteria | 666 |
| 689 | Ga0501081_1177611 | 3300049743 | Bacteria | 580 |
| 690 | Ga0501083_0217934 | 3300049744 | Bacteria | 1244 |
| 691 | Ga0501275_079780 | 3300049772 | Unclassified | 529 |
| 692 | Ga0501044_0588971 | 3300049823 | Unclassified | 1006 |
| 693 | nmdc:mga05p37_1933563_c1 | 3300050507 | Bacteria | 562 |
| 694 | nmdc:mga0n895_892_c1 | 3300050512 | Bacteria | 21498 |
| 695 | nmdc:mga0rr50_11460_c1 | 3300050513 | Bacteria | 5678 |
| 696 | nmdc:mga0rr50_1340870_c1 | 3300050513 | Bacteria | 606 |
| 697 | nmdc:mga0rr50_1766530_c1 | 3300050513 | Unclassified | 521 |
| 698 | nmdc:mga0rr50_442247_c1 | 3300050513 | Bacteria | 1101 |
| 699 | nmdc:mga08x19_292384_c1 | 3300050514 | Bacteria | 1130 |
| 700 | nmdc:mga08x19_633109_c1 | 3300050514 | Bacteria | 758 |
| 701 | nmdc:mga08x19_784147_c1 | 3300050514 | Bacteria | 677 |
| 702 | nmdc:mga0a205_249680_c1 | 3300050515 | Bacteria | 1654 |
| 703 | nmdc:mga0a205_28719_c1 | 3300050515 | Bacteria | 5319 |
| 704 | Ga0495612_0120485 | 3300053078 | Unclassified | 1128 |
| 705 | Ga0495612_0180125 | 3300053078 | Bacteria | 928 |
| 706 | Ga0495595_0403410 | 3300053084 | Bacteria | 693 |
| 707 | Ga0501084_0373600 | 3300054114 | Bacteria | 1205 |
| 708 | Ga0501084_0444499 | 3300054114 | Bacteria | 1096 |
| 709 | Ga0501084_0647747 | 3300054114 | Bacteria | 892 |
| 710 | Ga0587070_168066 | 3300059491 | Bacteria | 562 |
| 711 | Ga0587073_0203421 | 3300059492 | Bacteria | 595 |
| 712 | Ga0587083_0217381 | 3300059505 | Bacteria | 554 |
| 713 | Ga0587083_0244555 | 3300059505 | Bacteria | 532 |
| 714 | Ga0587115_082845 | 3300059626 | Bacteria | 571 |
| 715 | Ga0587115_115216 | 3300059626 | Bacteria | 512 |
| 716 | Ga0587075_003998 | 3300059644 | Bacteria | 1687 |
| 717 | Ga0501082_0116044 | 3300060353 | Bacteria | 2319 |
| 718 | Ga0501082_1798094 | 3300060353 | Bacteria | 534 |
| 719 | Ga0466962_0014187 | 3300061719 | Bacteria | 3838 |
| 720 | Ga0466962_0023570 | 3300061719 | Bacteria | 2958 |
| 721 | Ga0530510_0314571 | 3300061734 | Bacteria | 1173 |
| 722 | Ga0530510_0952596 | 3300061734 | Bacteria | 656 |
| 723 | Ga0530510_0970792 | 3300061734 | Bacteria | 650 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300012483 | Ga0157337_1026718 | Ga0157337_10267181 | 86 |
| 2 | 3300059505 | Ga0587083_0217381 | Ga0587083_0217381_226_516 | 96 |
| 3 | 3300005330 | Ga0070690_100069365 | Ga0070690_1000693653 | 98 |
| 4 | 3300005330 | Ga0070690_100166404 | Ga0070690_1001664042 | 98 |
| 5 | 3300005334 | Ga0068869_100130555 | Ga0068869_1001305553 | 98 |
| 6 | 3300005336 | Ga0070680_100038117 | Ga0070680_1000381174 | 98 |
| 7 | 3300005337 | Ga0070682_100012408 | Ga0070682_1000124084 | 98 |
| 8 | 3300005338 | Ga0068868_100061984 | Ga0068868_1000619842 | 98 |
| 9 | 3300005338 | Ga0068868_100476343 | Ga0068868_1004763431 | 98 |
| 10 | 3300005339 | Ga0070660_100351431 | Ga0070660_1003514312 | 98 |
| 11 | 3300005340 | Ga0070689_100075774 | Ga0070689_1000757742 | 98 |
| 12 | 3300005345 | Ga0070692_10009738 | Ga0070692_100097385 | 98 |
| 13 | 3300005355 | Ga0070671_100879510 | Ga0070671_1008795102 | 98 |
| 14 | 3300005356 | Ga0070674_100182410 | Ga0070674_1001824103 | 98 |
| 15 | 3300005356 | Ga0070674_100272683 | Ga0070674_1002726831 | 98 |
| 16 | 3300005364 | Ga0070673_101009370 | Ga0070673_1010093702 | 98 |
| 17 | 3300005365 | Ga0070688_100051117 | Ga0070688_1000511172 | 98 |
| 18 | 3300005366 | Ga0070659_100158972 | Ga0070659_1001589722 | 98 |
| 19 | 3300005367 | Ga0070667_100055300 | Ga0070667_1000553003 | 98 |
| 20 | 3300005367 | Ga0070667_100514446 | Ga0070667_1005144462 | 98 |
| 21 | 3300005436 | Ga0070713_100200477 | Ga0070713_1002004774 | 98 |
| 22 | 3300005438 | Ga0070701_10174934 | Ga0070701_101749343 | 98 |
| 23 | 3300005439 | Ga0070711_100042752 | Ga0070711_1000427522 | 98 |
| 24 | 3300005439 | Ga0070711_101576723 | Ga0070711_1015767231 | 98 |
| 25 | 3300005440 | Ga0070705_100095823 | Ga0070705_1000958231 | 98 |
| 26 | 3300005440 | Ga0070705_100121261 | Ga0070705_1001212615 | 98 |
| 27 | 3300005441 | Ga0070700_100249364 | Ga0070700_1002493642 | 98 |
| 28 | 3300005444 | Ga0070694_100055019 | Ga0070694_1000550192 | 98 |
| 29 | 3300005445 | Ga0070708_101033397 | Ga0070708_1010333971 | 98 |
| 30 | 3300005455 | Ga0070663_100640697 | Ga0070663_1006406972 | 98 |
| 31 | 3300005455 | Ga0070663_100733596 | Ga0070663_1007335962 | 98 |
| 32 | 3300005456 | Ga0070678_100008202 | Ga0070678_1000082027 | 98 |
| 33 | 3300005459 | Ga0068867_100080687 | Ga0068867_1000806875 | 98 |
| 34 | 3300005466 | Ga0070685_10335328 | Ga0070685_103353282 | 98 |
| 35 | 3300005466 | Ga0070685_10380813 | Ga0070685_103808132 | 98 |
| 36 | 3300005467 | Ga0070706_100686813 | Ga0070706_1006868132 | 98 |
| 37 | 3300005518 | Ga0070699_100181915 | Ga0070699_1001819152 | 98 |
| 38 | 3300005518 | Ga0070699_100471394 | Ga0070699_1004713942 | 98 |
| 39 | 3300005530 | Ga0070679_100057784 | Ga0070679_1000577843 | 98 |
| 40 | 3300005535 | Ga0070684_100061807 | Ga0070684_1000618075 | 98 |
| 41 | 3300005535 | Ga0070684_100902244 | Ga0070684_1009022442 | 98 |
| 42 | 3300005536 | Ga0070697_100672856 | Ga0070697_1006728561 | 98 |
| 43 | 3300005539 | Ga0068853_102170324 | Ga0068853_1021703242 | 98 |
| 44 | 3300005544 | Ga0070686_100053965 | Ga0070686_1000539655 | 98 |
| 45 | 3300005545 | Ga0070695_100529849 | Ga0070695_1005298493 | 98 |
| 46 | 3300005546 | Ga0070696_100041484 | Ga0070696_1000414844 | 98 |
| 47 | 3300005546 | Ga0070696_101897979 | Ga0070696_1018979791 | 98 |
| 48 | 3300005547 | Ga0070693_100005617 | Ga0070693_1000056171 | 98 |
| 49 | 3300005547 | Ga0070693_100206652 | Ga0070693_1002066522 | 98 |
| 50 | 3300005548 | Ga0070665_100314565 | Ga0070665_1003145652 | 98 |
| 51 | 3300005549 | Ga0070704_100488166 | Ga0070704_1004881662 | 98 |
| 52 | 3300005549 | Ga0070704_100553092 | Ga0070704_1005530922 | 98 |
| 53 | 3300005563 | Ga0068855_100555096 | Ga0068855_1005550963 | 98 |
| 54 | 3300005564 | Ga0070664_100179626 | Ga0070664_1001796263 | 98 |
| 55 | 3300005577 | Ga0068857_100327735 | Ga0068857_1003277352 | 98 |
| 56 | 3300005577 | Ga0068857_100364879 | Ga0068857_1003648793 | 98 |
| 57 | 3300005578 | Ga0068854_100200137 | Ga0068854_1002001372 | 98 |
| 58 | 3300005614 | Ga0068856_100091442 | Ga0068856_1000914424 | 98 |
| 59 | 3300005614 | Ga0068856_101554709 | Ga0068856_1015547092 | 98 |
| 60 | 3300005615 | Ga0070702_100033934 | Ga0070702_1000339345 | 98 |
| 61 | 3300005615 | Ga0070702_100060507 | Ga0070702_1000605072 | 98 |
| 62 | 3300005616 | Ga0068852_100186384 | Ga0068852_1001863843 | 98 |
| 63 | 3300005617 | Ga0068859_101418953 | Ga0068859_1014189532 | 98 |
| 64 | 3300005618 | Ga0068864_101298219 | Ga0068864_1012982192 | 98 |
| 65 | 3300005718 | Ga0068866_10088089 | Ga0068866_100880891 | 98 |
| 66 | 3300005718 | Ga0068866_10488061 | Ga0068866_104880613 | 98 |
| 67 | 3300005840 | Ga0068870_10801653 | Ga0068870_108016532 | 98 |
| 68 | 3300005842 | Ga0068858_100016243 | Ga0068858_1000162436 | 98 |
| 69 | 3300005842 | Ga0068858_100031994 | Ga0068858_1000319945 | 98 |
| 70 | 3300005842 | Ga0068858_102458821 | Ga0068858_1024588211 | 98 |
| 71 | 3300005843 | Ga0068860_100020071 | Ga0068860_1000200719 | 98 |
| 72 | 3300006163 | Ga0070715_10014322 | Ga0070715_100143225 | 98 |
| 73 | 3300006163 | Ga0070715_10256955 | Ga0070715_102569552 | 98 |
| 74 | 3300006173 | Ga0070716_100572563 | Ga0070716_1005725631 | 98 |
| 75 | 3300006237 | Ga0097621_100010903 | Ga0097621_1000109033 | 98 |
| 76 | 3300006237 | Ga0097621_100130048 | Ga0097621_1001300484 | 98 |
| 77 | 3300006358 | Ga0068871_100052258 | Ga0068871_1000522583 | 98 |
| 78 | 3300006358 | Ga0068871_100127541 | Ga0068871_1001275412 | 98 |
| 79 | 3300006358 | Ga0068871_101182205 | Ga0068871_1011822052 | 98 |
| 80 | 3300006852 | Ga0075433_10077960 | Ga0075433_100779602 | 98 |
| 81 | 3300006871 | Ga0075434_100052014 | Ga0075434_1000520145 | 98 |
| 82 | 3300006881 | Ga0068865_100014192 | Ga0068865_1000141925 | 98 |
| 83 | 3300006881 | Ga0068865_100234368 | Ga0068865_1002343683 | 98 |
| 84 | 3300006914 | Ga0075436_100171437 | Ga0075436_1001714372 | 98 |
| 85 | 3300006931 | Ga0097620_101418885 | Ga0097620_1014188852 | 98 |
| 86 | 3300007076 | Ga0075435_100194889 | Ga0075435_1001948893 | 98 |
| 87 | 3300009093 | Ga0105240_11572672 | Ga0105240_115726722 | 98 |
| 88 | 3300009094 | Ga0111539_10814118 | Ga0111539_108141181 | 98 |
| 89 | 3300009098 | Ga0105245_10015320 | Ga0105245_100153206 | 98 |
| 90 | 3300009098 | Ga0105245_10224157 | Ga0105245_102241572 | 98 |
| 91 | 3300009098 | Ga0105245_10936573 | Ga0105245_109365732 | 98 |
| 92 | 3300009101 | Ga0105247_10052990 | Ga0105247_100529902 | 98 |
| 93 | 3300009101 | Ga0105247_10304565 | Ga0105247_103045653 | 98 |
| 94 | 3300009148 | Ga0105243_10047355 | Ga0105243_100473554 | 98 |
| 95 | 3300009148 | Ga0105243_10267127 | Ga0105243_102671272 | 98 |
| 96 | 3300009148 | Ga0105243_10658793 | Ga0105243_106587932 | 98 |
| 97 | 3300009148 | Ga0105243_11227939 | Ga0105243_112279392 | 98 |
| 98 | 3300009174 | Ga0105241_10060149 | Ga0105241_100601493 | 98 |
| 99 | 3300009174 | Ga0105241_10084415 | Ga0105241_100844153 | 98 |
| 100 | 3300009176 | Ga0105242_10132083 | Ga0105242_101320834 | 98 |
| 101 | 3300009176 | Ga0105242_10139756 | Ga0105242_101397561 | 98 |
| 102 | 3300009176 | Ga0105242_10531565 | Ga0105242_105315652 | 98 |
| 103 | 3300009177 | Ga0105248_10291615 | Ga0105248_102916153 | 98 |
| 104 | 3300009177 | Ga0105248_10392689 | Ga0105248_103926893 | 98 |
| 105 | 3300009545 | Ga0105237_10250546 | Ga0105237_102505464 | 98 |
| 106 | 3300009545 | Ga0105237_11083411 | Ga0105237_110834112 | 98 |
| 107 | 3300009551 | Ga0105238_10031640 | Ga0105238_100316403 | 98 |
| 108 | 3300009553 | Ga0105249_10197315 | Ga0105249_101973154 | 98 |
| 109 | 3300009553 | Ga0105249_11694934 | Ga0105249_116949342 | 98 |
| 110 | 3300010375 | Ga0105239_10021168 | Ga0105239_100211683 | 98 |
| 111 | 3300010375 | Ga0105239_13164434 | Ga0105239_131644342 | 98 |
| 112 | 3300011119 | Ga0105246_10095445 | Ga0105246_100954454 | 98 |
| 113 | 3300011119 | Ga0105246_11270223 | Ga0105246_112702232 | 98 |
| 114 | 3300011119 | Ga0105246_12551739 | Ga0105246_125517392 | 98 |
| 115 | 3300013296 | Ga0157374_10021270 | Ga0157374_100212706 | 98 |
| 116 | 3300013297 | Ga0157378_10028470 | Ga0157378_100284708 | 98 |
| 117 | 3300013297 | Ga0157378_12674430 | Ga0157378_126744301 | 98 |
| 118 | 3300013307 | Ga0157372_10185482 | Ga0157372_101854823 | 98 |
| 119 | 3300013308 | Ga0157375_10541034 | Ga0157375_105410343 | 98 |
| 120 | 3300013308 | Ga0157375_11423138 | Ga0157375_114231381 | 98 |
| 121 | 3300013308 | Ga0157375_11945663 | Ga0157375_119456632 | 98 |
| 122 | 3300014325 | Ga0163163_11318267 | Ga0163163_113182672 | 98 |
| 123 | 3300014326 | Ga0157380_10426993 | Ga0157380_104269932 | 98 |
| 124 | 3300014326 | Ga0157380_12794223 | Ga0157380_127942231 | 98 |
| 125 | 3300014968 | Ga0157379_10133885 | Ga0157379_101338853 | 98 |
| 126 | 3300014969 | Ga0157376_10229361 | Ga0157376_102293612 | 98 |
| 127 | 3300014969 | Ga0157376_10597358 | Ga0157376_105973582 | 98 |
| 128 | 3300014969 | Ga0157376_11149807 | Ga0157376_111498072 | 98 |
| 129 | 3300014969 | Ga0157376_12100000 | Ga0157376_121000002 | 98 |
| 130 | 3300017792 | Ga0163161_10201118 | Ga0163161_102011182 | 98 |
| 131 | 3300017792 | Ga0163161_10505719 | Ga0163161_105057193 | 98 |
| 132 | 3300020069 | Ga0197907_11110821 | Ga0197907_111108211 | 98 |
| 133 | 3300020070 | Ga0206356_11478649 | Ga0206356_114786492 | 98 |
| 134 | 3300020076 | Ga0206355_1251211 | Ga0206355_12512112 | 98 |
| 135 | 3300020081 | Ga0206354_10412236 | Ga0206354_104122362 | 98 |
| 136 | 3300025899 | Ga0207642_10519908 | Ga0207642_105199081 | 98 |
| 137 | 3300025900 | Ga0207710_10164818 | Ga0207710_101648182 | 98 |
| 138 | 3300025900 | Ga0207710_10168932 | Ga0207710_101689322 | 98 |
| 139 | 3300025901 | Ga0207688_10056833 | Ga0207688_100568334 | 98 |
| 140 | 3300025903 | Ga0207680_10213416 | Ga0207680_102134163 | 98 |
| 141 | 3300025904 | Ga0207647_10291542 | Ga0207647_102915422 | 98 |
| 142 | 3300025905 | Ga0207685_10011554 | Ga0207685_100115545 | 98 |
| 143 | 3300025905 | Ga0207685_10155657 | Ga0207685_101556572 | 98 |
| 144 | 3300025908 | Ga0207643_10356051 | Ga0207643_103560512 | 98 |
| 145 | 3300025910 | Ga0207684_10955404 | Ga0207684_109554043 | 98 |
| 146 | 3300025911 | Ga0207654_10238293 | Ga0207654_102382932 | 98 |
| 147 | 3300025914 | Ga0207671_11368290 | Ga0207671_113682902 | 98 |
| 148 | 3300025916 | Ga0207663_10066038 | Ga0207663_100660383 | 98 |
| 149 | 3300025916 | Ga0207663_10386863 | Ga0207663_103868633 | 98 |
| 150 | 3300025921 | Ga0207652_11156007 | Ga0207652_111560072 | 98 |
| 151 | 3300025924 | Ga0207694_10255449 | Ga0207694_102554491 | 98 |
| 152 | 3300025927 | Ga0207687_10033171 | Ga0207687_100331712 | 98 |
| 153 | 3300025927 | Ga0207687_10238094 | Ga0207687_102380943 | 98 |
| 154 | 3300025927 | Ga0207687_10620651 | Ga0207687_106206511 | 98 |
| 155 | 3300025931 | Ga0207644_10802325 | Ga0207644_108023252 | 98 |
| 156 | 3300025932 | Ga0207690_10098751 | Ga0207690_100987512 | 98 |
| 157 | 3300025933 | Ga0207706_10266441 | Ga0207706_102664413 | 98 |
| 158 | 3300025934 | Ga0207686_10027445 | Ga0207686_100274453 | 98 |
| 159 | 3300025934 | Ga0207686_10047765 | Ga0207686_100477652 | 98 |
| 160 | 3300025934 | Ga0207686_11763859 | Ga0207686_117638592 | 98 |
| 161 | 3300025935 | Ga0207709_10017610 | Ga0207709_100176105 | 98 |
| 162 | 3300025935 | Ga0207709_10167895 | Ga0207709_101678953 | 98 |
| 163 | 3300025935 | Ga0207709_10712520 | Ga0207709_107125202 | 98 |
| 164 | 3300025935 | Ga0207709_10991680 | Ga0207709_109916802 | 98 |
| 165 | 3300025937 | Ga0207669_10040730 | Ga0207669_100407305 | 98 |
| 166 | 3300025938 | Ga0207704_10202833 | Ga0207704_102028331 | 98 |
| 167 | 3300025938 | Ga0207704_10230971 | Ga0207704_102309714 | 98 |
| 168 | 3300025938 | Ga0207704_10331760 | Ga0207704_103317603 | 98 |
| 169 | 3300025939 | Ga0207665_10138286 | Ga0207665_101382862 | 98 |
| 170 | 3300025941 | Ga0207711_10142535 | Ga0207711_101425352 | 98 |
| 171 | 3300025944 | Ga0207661_11693779 | Ga0207661_116937792 | 98 |
| 172 | 3300025945 | Ga0207679_10234865 | Ga0207679_102348653 | 98 |
| 173 | 3300025949 | Ga0207667_10962024 | Ga0207667_109620242 | 98 |
| 174 | 3300025960 | Ga0207651_10781922 | Ga0207651_107819222 | 98 |
| 175 | 3300025960 | Ga0207651_10988283 | Ga0207651_109882832 | 98 |
| 176 | 3300025961 | Ga0207712_10926934 | Ga0207712_109269342 | 98 |
| 177 | 3300025981 | Ga0207640_10038906 | Ga0207640_100389063 | 98 |
| 178 | 3300025981 | Ga0207640_11636438 | Ga0207640_116364381 | 98 |
| 179 | 3300025986 | Ga0207658_10105364 | Ga0207658_101053644 | 98 |
| 180 | 3300025986 | Ga0207658_11822664 | Ga0207658_118226641 | 98 |
| 181 | 3300026023 | Ga0207677_11279497 | Ga0207677_112794971 | 98 |
| 182 | 3300026035 | Ga0207703_10264621 | Ga0207703_102646212 | 98 |
| 183 | 3300026035 | Ga0207703_10411685 | Ga0207703_104116852 | 98 |
| 184 | 3300026041 | Ga0207639_12289086 | Ga0207639_122890861 | 98 |
| 185 | 3300026067 | Ga0207678_10097724 | Ga0207678_100977245 | 98 |
| 186 | 3300026067 | Ga0207678_10523298 | Ga0207678_105232982 | 98 |
| 187 | 3300026075 | Ga0207708_10004026 | Ga0207708_1000402610 | 98 |
| 188 | 3300026075 | Ga0207708_10687931 | Ga0207708_106879311 | 98 |
| 189 | 3300026078 | Ga0207702_10107003 | Ga0207702_101070034 | 98 |
| 190 | 3300026089 | Ga0207648_10129610 | Ga0207648_101296104 | 98 |
| 191 | 3300026095 | Ga0207676_11131269 | Ga0207676_111312692 | 98 |
| 192 | 3300026116 | Ga0207674_10446681 | Ga0207674_104466812 | 98 |
| 193 | 3300026121 | Ga0207683_10000876 | Ga0207683_1000087611 | 98 |
| 194 | 3300026142 | Ga0207698_11419273 | Ga0207698_114192731 | 98 |
| 195 | 3300026142 | Ga0207698_11754108 | Ga0207698_117541082 | 98 |
| 196 | 3300028381 | Ga0268264_10050649 | Ga0268264_100506495 | 98 |
| 197 | 3300028563 | Ga0265319_1028375 | Ga0265319_10283753 | 98 |
| 198 | 3300028563 | Ga0265319_1054231 | Ga0265319_10542312 | 98 |
| 199 | 3300028577 | Ga0265318_10173648 | Ga0265318_101736482 | 98 |
| 200 | 3300028800 | Ga0265338_10327795 | Ga0265338_103277953 | 98 |
| 201 | 3300031240 | Ga0265320_10009779 | Ga0265320_100097796 | 98 |
| 202 | 3300031240 | Ga0265320_10016252 | Ga0265320_100162525 | 98 |
| 203 | 3300031251 | Ga0265327_10057127 | Ga0265327_100571273 | 98 |
| 204 | 3300035089 | Ga0373944_0126481 | Ga0373944_0126481_378_674 | 98 |
| 205 | 3300035170 | Ga0373943_0544967 | Ga0373943_0544967_43_339 | 98 |
| 206 | 3300035170 | Ga0373943_0799242 | Ga0373943_0799242_109_414 | 98 |
| 207 | 3300035691 | Ga0373931_0381312 | Ga0373931_0381312_307_612 | 98 |
| 208 | 3300035695 | Ga0373927_0223428 | Ga0373927_0223428_803_1099 | 98 |
| 209 | 3300035725 | Ga0373947_0326136 | Ga0373947_0326136_667_963 | 98 |
| 210 | 3300037068 | Ga0373925_0446395 | Ga0373925_0446395_73_375 | 98 |
| 211 | 3300037068 | Ga0373925_0498867 | Ga0373925_0498867_404_700 | 98 |
| 212 | 3300037068 | Ga0373925_1403180 | Ga0373925_1403180_132_428 | 98 |
| 213 | 3300044735 | Ga0466968_0653972 | Ga0466968_0653972_108_404 | 98 |
| 214 | 3300045976 | Ga0466967_0790312 | Ga0466967_0790312_456_752 | 98 |
| 215 | 3300046455 | Ga0495603_0097150 | Ga0495603_0097150_368_664 | 98 |
| 216 | 3300046455 | Ga0495603_0187160 | Ga0495603_0187160_570_866 | 98 |
| 217 | 3300046455 | Ga0495603_0189117 | Ga0495603_0189117_799_1104 | 98 |
| 218 | 3300046461 | Ga0495641_0024564 | Ga0495641_0024564_1672_1977 | 98 |
| 219 | 3300046473 | Ga0495582_0042237 | Ga0495582_0042237_1657_1953 | 98 |
| 220 | 3300046473 | Ga0495582_0125183 | Ga0495582_0125183_1085_1390 | 98 |
| 221 | 3300046475 | Ga0495639_0421677 | Ga0495639_0421677_38_343 | 98 |
| 222 | 3300046491 | Ga0495584_0646709 | Ga0495584_0646709_121_417 | 98 |
| 223 | 3300046499 | Ga0495594_0153577 | Ga0495594_0153577_889_1185 | 98 |
| 224 | 3300046517 | Ga0495630_1081795 | Ga0495630_1081795_48_344 | 98 |
| 225 | 3300046674 | Ga0495588_0066979 | Ga0495588_0066979_1071_1367 | 98 |
| 226 | 3300046683 | Ga0495658_0030986 | Ga0495658_0030986_2041_2337 | 98 |
| 227 | 3300046683 | Ga0495658_0273735 | Ga0495658_0273735_679_984 | 98 |
| 228 | 3300046691 | Ga0495670_0836024 | Ga0495670_0836024_73_369 | 98 |
| 229 | 3300047315 | Ga0495581_0751410 | Ga0495581_0751410_198_494 | 98 |
| 230 | 3300047321 | Ga0495676_0154000 | Ga0495676_0154000_225_521 | 98 |
| 231 | 3300047321 | Ga0495676_0329227 | Ga0495676_0329227_683_988 | 98 |
| 232 | 3300048903 | Ga0496100_0017728 | Ga0496100_0017728_3828_4136 | 98 |
| 233 | 3300048903 | Ga0496100_0028950 | Ga0496100_0028950_1080_1376 | 98 |
| 234 | 3300048903 | Ga0496100_0566871 | Ga0496100_0566871_377_673 | 98 |
| 235 | 3300048903 | Ga0496100_1020944 | Ga0496100_1020944_325_621 | 98 |
| 236 | 3300048904 | Ga0496101_0000692 | Ga0496101_0000692_12995_13291 | 98 |
| 237 | 3300048904 | Ga0496101_0049101 | Ga0496101_0049101_1350_1658 | 98 |
| 238 | 3300048904 | Ga0496101_0152153 | Ga0496101_0152153_351_647 | 98 |
| 239 | 3300048904 | Ga0496101_0746118 | Ga0496101_0746118_204_500 | 98 |
| 240 | 3300048905 | Ga0496102_0053045 | Ga0496102_0053045_2158_2454 | 98 |
| 241 | 3300048905 | Ga0496102_0335135 | Ga0496102_0335135_842_1138 | 98 |
| 242 | 3300048905 | Ga0496102_0960865 | Ga0496102_0960865_380_676 | 98 |
| 243 | 3300048906 | Ga0496103_0011503 | Ga0496103_0011503_1295_1591 | 98 |
| 244 | 3300048906 | Ga0496103_0196712 | Ga0496103_0196712_742_1038 | 98 |
| 245 | 3300048906 | Ga0496103_0449315 | Ga0496103_0449315_286_594 | 98 |
| 246 | 3300048907 | Ga0496104_0002218 | Ga0496104_0002218_14265_14561 | 98 |
| 247 | 3300048907 | Ga0496104_0038000 | Ga0496104_0038000_257_553 | 98 |
| 248 | 3300048907 | Ga0496104_0303474 | Ga0496104_0303474_430_726 | 98 |
| 249 | 3300048907 | Ga0496104_0447155 | Ga0496104_0447155_44_340 | 98 |
| 250 | 3300048908 | Ga0496105_0014914 | Ga0496105_0014914_1842_2138 | 98 |
| 251 | 3300048908 | Ga0496105_0025956 | Ga0496105_0025956_3120_3416 | 98 |
| 252 | 3300048909 | Ga0496106_0003900 | Ga0496106_0003900_7881_8177 | 98 |
| 253 | 3300048909 | Ga0496106_0026843 | Ga0496106_0026843_2322_2630 | 98 |
| 254 | 3300048909 | Ga0496106_0047654 | Ga0496106_0047654_2499_2795 | 98 |
| 255 | 3300048909 | Ga0496106_0372413 | Ga0496106_0372413_688_984 | 98 |
| 256 | 3300048910 | Ga0496107_0016367 | Ga0496107_0016367_2837_3133 | 98 |
| 257 | 3300048910 | Ga0496107_0222140 | Ga0496107_0222140_1086_1382 | 98 |
| 258 | 3300048910 | Ga0496107_0263535 | Ga0496107_0263535_481_789 | 98 |
| 259 | 3300048910 | Ga0496107_0343101 | Ga0496107_0343101_727_1023 | 98 |
| 260 | 3300048910 | Ga0496107_0358709 | Ga0496107_0358709_80_376 | 98 |
| 261 | 3300048910 | Ga0496107_0950971 | Ga0496107_0950971_309_611 | 98 |
| 262 | 3300048911 | Ga0496108_0057187 | Ga0496108_0057187_1982_2290 | 98 |
| 263 | 3300048911 | Ga0496108_0180373 | Ga0496108_0180373_1511_1807 | 98 |
| 264 | 3300048911 | Ga0496108_0275534 | Ga0496108_0275534_580_882 | 98 |
| 265 | 3300048911 | Ga0496108_0451628 | Ga0496108_0451628_35_331 | 98 |
| 266 | 3300048911 | Ga0496108_1472549 | Ga0496108_1472549_146_442 | 98 |
| 267 | 3300048912 | Ga0496109_0022559 | Ga0496109_0022559_617_925 | 98 |
| 268 | 3300048912 | Ga0496109_0024902 | Ga0496109_0024902_3752_4048 | 98 |
| 269 | 3300048912 | Ga0496109_0165720 | Ga0496109_0165720_916_1218 | 98 |
| 270 | 3300048912 | Ga0496109_0264127 | Ga0496109_0264127_367_663 | 98 |
| 271 | 3300048912 | Ga0496109_0997186 | Ga0496109_0997186_23_319 | 98 |
| 272 | 3300048913 | Ga0496110_0066822 | Ga0496110_0066822_721_1029 | 98 |
| 273 | 3300048914 | Ga0496111_0010710 | Ga0496111_0010710_1086_1382 | 98 |
| 274 | 3300048914 | Ga0496111_0150008 | Ga0496111_0150008_780_1082 | 98 |
| 275 | 3300048914 | Ga0496111_0284008 | Ga0496111_0284008_349_657 | 98 |
| 276 | 3300048915 | Ga0496112_0198220 | Ga0496112_0198220_1277_1573 | 98 |
| 277 | 3300048915 | Ga0496112_0298617 | Ga0496112_0298617_196_498 | 98 |
| 278 | 3300048915 | Ga0496112_0329180 | Ga0496112_0329180_181_477 | 98 |
| 279 | 3300048915 | Ga0496112_0818046 | Ga0496112_0818046_242_538 | 98 |
| 280 | 3300048915 | Ga0496112_1102233 | Ga0496112_1102233_365_673 | 98 |
| 281 | 3300048915 | Ga0496112_1638728 | Ga0496112_1638728_156_452 | 98 |
| 282 | 3300048916 | Ga0496113_0071185 | Ga0496113_0071185_198_494 | 98 |
| 283 | 3300048916 | Ga0496113_0324999 | Ga0496113_0324999_497_799 | 98 |
| 284 | 3300048916 | Ga0496113_0359706 | Ga0496113_0359706_484_792 | 98 |
| 285 | 3300048917 | Ga0496114_0008736 | Ga0496114_0008736_7246_7542 | 98 |
| 286 | 3300048917 | Ga0496114_0229566 | Ga0496114_0229566_721_1029 | 98 |
| 287 | 3300048917 | Ga0496114_0282877 | Ga0496114_0282877_733_1029 | 98 |
| 288 | 3300048917 | Ga0496114_0618246 | Ga0496114_0618246_263_568 | 98 |
| 289 | 3300048918 | Ga0496115_0108794 | Ga0496115_0108794_359_667 | 98 |
| 290 | 3300048918 | Ga0496115_0224670 | Ga0496115_0224670_162_458 | 98 |
| 291 | 3300049583 | Ga0501067_0080425 | Ga0501067_0080425_937_1245 | 98 |
| 292 | 3300050512 | nmdc:mga0n895_892_c1 | nmdc:mga0n895_892_c1_16427_16735 | 98 |
| 293 | 3300050513 | nmdc:mga0rr50_11460_c1 | nmdc:mga0rr50_11460_c1_1917_2225 | 98 |
| 294 | 3300050514 | nmdc:mga08x19_292384_c1 | nmdc:mga08x19_292384_c1_658_966 | 98 |
| 295 | 3300050515 | nmdc:mga0a205_28719_c1 | nmdc:mga0a205_28719_c1_2684_2992 | 98 |
| 296 | 3300053078 | Ga0495612_0180125 | Ga0495612_0180125_69_365 | 98 |
| 297 | 3300005327 | Ga0070658_11212884 | Ga0070658_112128841 | 99 |
| 298 | 3300005329 | Ga0070683_100226322 | Ga0070683_1002263221 | 99 |
| 299 | 3300005336 | Ga0070680_101738745 | Ga0070680_1017387451 | 99 |
| 300 | 3300005336 | Ga0070680_101901709 | Ga0070680_1019017091 | 99 |
| 301 | 3300005339 | Ga0070660_100007596 | Ga0070660_1000075965 | 99 |
| 302 | 3300005339 | Ga0070660_100021467 | Ga0070660_1000214672 | 99 |
| 303 | 3300005339 | Ga0070660_100135957 | Ga0070660_1001359572 | 99 |
| 304 | 3300005344 | Ga0070661_100060787 | Ga0070661_1000607874 | 99 |
| 305 | 3300005344 | Ga0070661_100112887 | Ga0070661_1001128872 | 99 |
| 306 | 3300005366 | Ga0070659_100035598 | Ga0070659_1000355984 | 99 |
| 307 | 3300005366 | Ga0070659_100345434 | Ga0070659_1003454343 | 99 |
| 308 | 3300005367 | Ga0070667_101237269 | Ga0070667_1012372691 | 99 |
| 309 | 3300005435 | Ga0070714_100265556 | Ga0070714_1002655563 | 99 |
| 310 | 3300005435 | Ga0070714_100546286 | Ga0070714_1005462862 | 99 |
| 311 | 3300005440 | Ga0070705_100863960 | Ga0070705_1008639602 | 99 |
| 312 | 3300005445 | Ga0070708_100042687 | Ga0070708_1000426876 | 99 |
| 313 | 3300005445 | Ga0070708_100065381 | Ga0070708_1000653813 | 99 |
| 314 | 3300005445 | Ga0070708_100094407 | Ga0070708_1000944074 | 99 |
| 315 | 3300005456 | Ga0070678_101938165 | Ga0070678_1019381651 | 99 |
| 316 | 3300005458 | Ga0070681_10001955 | Ga0070681_1000195514 | 99 |
| 317 | 3300005458 | Ga0070681_10510298 | Ga0070681_105102982 | 99 |
| 318 | 3300005467 | Ga0070706_100004684 | Ga0070706_1000046844 | 99 |
| 319 | 3300005467 | Ga0070706_100211206 | Ga0070706_1002112061 | 99 |
| 320 | 3300005467 | Ga0070706_100732961 | Ga0070706_1007329612 | 99 |
| 321 | 3300005468 | Ga0070707_100004513 | Ga0070707_1000045132 | 99 |
| 322 | 3300005468 | Ga0070707_100273104 | Ga0070707_1002731042 | 99 |
| 323 | 3300005468 | Ga0070707_100457585 | Ga0070707_1004575852 | 99 |
| 324 | 3300005468 | Ga0070707_100672696 | Ga0070707_1006726962 | 99 |
| 325 | 3300005471 | Ga0070698_100056452 | Ga0070698_1000564523 | 99 |
| 326 | 3300005471 | Ga0070698_100753766 | Ga0070698_1007537662 | 99 |
| 327 | 3300005530 | Ga0070679_100135234 | Ga0070679_1001352343 | 99 |
| 328 | 3300005530 | Ga0070679_100171278 | Ga0070679_1001712783 | 99 |
| 329 | 3300005530 | Ga0070679_100322341 | Ga0070679_1003223412 | 99 |
| 330 | 3300005535 | Ga0070684_100030942 | Ga0070684_1000309424 | 99 |
| 331 | 3300005535 | Ga0070684_100101616 | Ga0070684_1001016163 | 99 |
| 332 | 3300005535 | Ga0070684_100132648 | Ga0070684_1001326483 | 99 |
| 333 | 3300005536 | Ga0070697_100438854 | Ga0070697_1004388541 | 99 |
| 334 | 3300005539 | Ga0068853_100052906 | Ga0068853_1000529062 | 99 |
| 335 | 3300005546 | Ga0070696_100096200 | Ga0070696_1000962003 | 99 |
| 336 | 3300005548 | Ga0070665_100804462 | Ga0070665_1008044622 | 99 |
| 337 | 3300005563 | Ga0068855_100023960 | Ga0068855_1000239604 | 99 |
| 338 | 3300005563 | Ga0068855_100637854 | Ga0068855_1006378542 | 99 |
| 339 | 3300005564 | Ga0070664_100441521 | Ga0070664_1004415212 | 99 |
| 340 | 3300005577 | Ga0068857_100011172 | Ga0068857_1000111725 | 99 |
| 341 | 3300005578 | Ga0068854_100825568 | Ga0068854_1008255681 | 99 |
| 342 | 3300005578 | Ga0068854_100995211 | Ga0068854_1009952111 | 99 |
| 343 | 3300005578 | Ga0068854_101037664 | Ga0068854_1010376642 | 99 |
| 344 | 3300005614 | Ga0068856_100216927 | Ga0068856_1002169272 | 99 |
| 345 | 3300005614 | Ga0068856_102206004 | Ga0068856_1022060042 | 99 |
| 346 | 3300005616 | Ga0068852_100085601 | Ga0068852_1000856012 | 99 |
| 347 | 3300005616 | Ga0068852_100232811 | Ga0068852_1002328113 | 99 |
| 348 | 3300006028 | Ga0070717_10285063 | Ga0070717_102850632 | 99 |
| 349 | 3300006175 | Ga0070712_100037595 | Ga0070712_1000375953 | 99 |
| 350 | 3300006237 | Ga0097621_102205234 | Ga0097621_1022052342 | 99 |
| 351 | 3300006914 | Ga0075436_100861195 | Ga0075436_1008611952 | 99 |
| 352 | 3300009093 | Ga0105240_11517974 | Ga0105240_115179742 | 99 |
| 353 | 3300009093 | Ga0105240_12229884 | Ga0105240_122298842 | 99 |
| 354 | 3300009098 | Ga0105245_10349933 | Ga0105245_103499332 | 99 |
| 355 | 3300009174 | Ga0105241_10833959 | Ga0105241_108339592 | 99 |
| 356 | 3300009176 | Ga0105242_11804535 | Ga0105242_118045351 | 99 |
| 357 | 3300009545 | Ga0105237_10091107 | Ga0105237_100911071 | 99 |
| 358 | 3300009545 | Ga0105237_10202129 | Ga0105237_102021293 | 99 |
| 359 | 3300009551 | Ga0105238_10043373 | Ga0105238_100433734 | 99 |
| 360 | 3300009551 | Ga0105238_10082150 | Ga0105238_100821504 | 99 |
| 361 | 3300009551 | Ga0105238_10822677 | Ga0105238_108226772 | 99 |
| 362 | 3300009553 | Ga0105249_13550048 | Ga0105249_135500481 | 99 |
| 363 | 3300010375 | Ga0105239_10064989 | Ga0105239_100649893 | 99 |
| 364 | 3300013100 | Ga0157373_10055667 | Ga0157373_100556673 | 99 |
| 365 | 3300013102 | Ga0157371_10131658 | Ga0157371_101316584 | 99 |
| 366 | 3300013104 | Ga0157370_10026787 | Ga0157370_100267874 | 99 |
| 367 | 3300013104 | Ga0157370_10132385 | Ga0157370_101323853 | 99 |
| 368 | 3300013104 | Ga0157370_10192255 | Ga0157370_101922552 | 99 |
| 369 | 3300013104 | Ga0157370_10273348 | Ga0157370_102733482 | 99 |
| 370 | 3300013105 | Ga0157369_10030091 | Ga0157369_100300916 | 99 |
| 371 | 3300013105 | Ga0157369_10040930 | Ga0157369_100409304 | 99 |
| 372 | 3300013105 | Ga0157369_10104213 | Ga0157369_101042133 | 99 |
| 373 | 3300013105 | Ga0157369_10408792 | Ga0157369_104087922 | 99 |
| 374 | 3300013296 | Ga0157374_10028775 | Ga0157374_100287754 | 99 |
| 375 | 3300013296 | Ga0157374_10170871 | Ga0157374_101708714 | 99 |
| 376 | 3300013296 | Ga0157374_11557326 | Ga0157374_115573262 | 99 |
| 377 | 3300013297 | Ga0157378_10069193 | Ga0157378_100691935 | 99 |
| 378 | 3300013307 | Ga0157372_10006332 | Ga0157372_1000633211 | 99 |
| 379 | 3300013307 | Ga0157372_10051234 | Ga0157372_100512342 | 99 |
| 380 | 3300013307 | Ga0157372_10083881 | Ga0157372_100838812 | 99 |
| 381 | 3300013307 | Ga0157372_12829193 | Ga0157372_128291931 | 99 |
| 382 | 3300014325 | Ga0163163_10488975 | Ga0163163_104889752 | 99 |
| 383 | 3300014326 | Ga0157380_12597902 | Ga0157380_125979021 | 99 |
| 384 | 3300014497 | Ga0182008_10125663 | Ga0182008_101256632 | 99 |
| 385 | 3300014497 | Ga0182008_10548333 | Ga0182008_105483331 | 99 |
| 386 | 3300014969 | Ga0157376_10322620 | Ga0157376_103226203 | 99 |
| 387 | 3300015261 | Ga0182006_1122101 | Ga0182006_11221012 | 99 |
| 388 | 3300015262 | Ga0182007_10098967 | Ga0182007_100989672 | 99 |
| 389 | 3300017792 | Ga0163161_11440430 | Ga0163161_114404302 | 99 |
| 390 | 3300020069 | Ga0197907_10913843 | Ga0197907_109138432 | 99 |
| 391 | 3300020070 | Ga0206356_10103907 | Ga0206356_101039072 | 99 |
| 392 | 3300020070 | Ga0206356_10503281 | Ga0206356_105032811 | 99 |
| 393 | 3300020070 | Ga0206356_10596004 | Ga0206356_105960045 | 99 |
| 394 | 3300020070 | Ga0206356_11115077 | Ga0206356_111150771 | 99 |
| 395 | 3300020076 | Ga0206355_1287509 | Ga0206355_12875092 | 99 |
| 396 | 3300020080 | Ga0206350_10489792 | Ga0206350_104897921 | 99 |
| 397 | 3300020081 | Ga0206354_10295194 | Ga0206354_102951941 | 99 |
| 398 | 3300020081 | Ga0206354_10669380 | Ga0206354_106693804 | 99 |
| 399 | 3300020082 | Ga0206353_11387566 | Ga0206353_113875666 | 99 |
| 400 | 3300020082 | Ga0206353_11491132 | Ga0206353_114911322 | 99 |
| 401 | 3300020082 | Ga0206353_11727024 | Ga0206353_117270242 | 99 |
| 402 | 3300020610 | Ga0154015_1029663 | Ga0154015_10296632 | 99 |
| 403 | 3300020610 | Ga0154015_1459760 | Ga0154015_14597602 | 99 |
| 404 | 3300021377 | Ga0213874_10071190 | Ga0213874_100711902 | 99 |
| 405 | 3300021384 | Ga0213876_10177042 | Ga0213876_101770422 | 99 |
| 406 | 3300022467 | Ga0224712_10006171 | Ga0224712_100061712 | 99 |
| 407 | 3300022467 | Ga0224712_10135788 | Ga0224712_101357882 | 99 |
| 408 | 3300022467 | Ga0224712_10175531 | Ga0224712_101755312 | 99 |
| 409 | 3300025904 | Ga0207647_10531479 | Ga0207647_105314792 | 99 |
| 410 | 3300025909 | Ga0207705_10051988 | Ga0207705_100519884 | 99 |
| 411 | 3300025910 | Ga0207684_10004965 | Ga0207684_100049653 | 99 |
| 412 | 3300025910 | Ga0207684_10264467 | Ga0207684_102644671 | 99 |
| 413 | 3300025911 | Ga0207654_10116834 | Ga0207654_101168342 | 99 |
| 414 | 3300025911 | Ga0207654_10171698 | Ga0207654_101716982 | 99 |
| 415 | 3300025911 | Ga0207654_10383394 | Ga0207654_103833942 | 99 |
| 416 | 3300025911 | Ga0207654_10662506 | Ga0207654_106625062 | 99 |
| 417 | 3300025912 | Ga0207707_10006792 | Ga0207707_100067929 | 99 |
| 418 | 3300025912 | Ga0207707_10008124 | Ga0207707_100081246 | 99 |
| 419 | 3300025913 | Ga0207695_10811588 | Ga0207695_108115882 | 99 |
| 420 | 3300025914 | Ga0207671_10282570 | Ga0207671_102825702 | 99 |
| 421 | 3300025914 | Ga0207671_10414442 | Ga0207671_104144421 | 99 |
| 422 | 3300025915 | Ga0207693_10071680 | Ga0207693_100716802 | 99 |
| 423 | 3300025917 | Ga0207660_10214069 | Ga0207660_102140692 | 99 |
| 424 | 3300025917 | Ga0207660_10381928 | Ga0207660_103819281 | 99 |
| 425 | 3300025919 | Ga0207657_10004765 | Ga0207657_100047653 | 99 |
| 426 | 3300025919 | Ga0207657_10016023 | Ga0207657_100160235 | 99 |
| 427 | 3300025919 | Ga0207657_10196543 | Ga0207657_101965432 | 99 |
| 428 | 3300025920 | Ga0207649_10021258 | Ga0207649_100212582 | 99 |
| 429 | 3300025920 | Ga0207649_10081017 | Ga0207649_100810172 | 99 |
| 430 | 3300025920 | Ga0207649_10218566 | Ga0207649_102185663 | 99 |
| 431 | 3300025921 | Ga0207652_10027233 | Ga0207652_100272332 | 99 |
| 432 | 3300025921 | Ga0207652_10100346 | Ga0207652_101003463 | 99 |
| 433 | 3300025921 | Ga0207652_10442742 | Ga0207652_104427421 | 99 |
| 434 | 3300025922 | Ga0207646_10042572 | Ga0207646_100425723 | 99 |
| 435 | 3300025922 | Ga0207646_10182184 | Ga0207646_101821843 | 99 |
| 436 | 3300025922 | Ga0207646_10347464 | Ga0207646_103474643 | 99 |
| 437 | 3300025922 | Ga0207646_10519811 | Ga0207646_105198112 | 99 |
| 438 | 3300025924 | Ga0207694_10022612 | Ga0207694_100226123 | 99 |
| 439 | 3300025927 | Ga0207687_10087942 | Ga0207687_100879423 | 99 |
| 440 | 3300025927 | Ga0207687_10456349 | Ga0207687_104563492 | 99 |
| 441 | 3300025929 | Ga0207664_10510534 | Ga0207664_105105342 | 99 |
| 442 | 3300025932 | Ga0207690_10113010 | Ga0207690_101130102 | 99 |
| 443 | 3300025932 | Ga0207690_10375101 | Ga0207690_103751012 | 99 |
| 444 | 3300025944 | Ga0207661_10372072 | Ga0207661_103720722 | 99 |
| 445 | 3300025944 | Ga0207661_10966109 | Ga0207661_109661092 | 99 |
| 446 | 3300025944 | Ga0207661_11537705 | Ga0207661_115377052 | 99 |
| 447 | 3300025949 | Ga0207667_10205237 | Ga0207667_102052373 | 99 |
| 448 | 3300025949 | Ga0207667_10310643 | Ga0207667_103106432 | 99 |
| 449 | 3300025949 | Ga0207667_10344476 | Ga0207667_103444761 | 99 |
| 450 | 3300025981 | Ga0207640_10705480 | Ga0207640_107054802 | 99 |
| 451 | 3300025981 | Ga0207640_11349502 | Ga0207640_113495022 | 99 |
| 452 | 3300026041 | Ga0207639_10159484 | Ga0207639_101594843 | 99 |
| 453 | 3300026041 | Ga0207639_11992275 | Ga0207639_119922752 | 99 |
| 454 | 3300026067 | Ga0207678_10261429 | Ga0207678_102614293 | 99 |
| 455 | 3300026078 | Ga0207702_10279314 | Ga0207702_102793143 | 99 |
| 456 | 3300026078 | Ga0207702_10373709 | Ga0207702_103737093 | 99 |
| 457 | 3300026078 | Ga0207702_10763958 | Ga0207702_107639581 | 99 |
| 458 | 3300026089 | Ga0207648_11997922 | Ga0207648_119979221 | 99 |
| 459 | 3300026116 | Ga0207674_10034277 | Ga0207674_100342773 | 99 |
| 460 | 3300026142 | Ga0207698_10036602 | Ga0207698_100366024 | 99 |
| 461 | 3300026142 | Ga0207698_10402650 | Ga0207698_104026502 | 99 |
| 462 | 3300026142 | Ga0207698_10656217 | Ga0207698_106562171 | 99 |
| 463 | 3300028379 | Ga0268266_10080384 | Ga0268266_100803844 | 99 |
| 464 | 3300028379 | Ga0268266_10223952 | Ga0268266_102239522 | 99 |
| 465 | 3300028573 | Ga0265334_10285742 | Ga0265334_102857422 | 99 |
| 466 | 3300028800 | Ga0265338_10881946 | Ga0265338_108819462 | 99 |
| 467 | 3300032002 | Ga0307416_100415878 | Ga0307416_1004158782 | 99 |
| 468 | 3300035089 | Ga0373944_0024448 | Ga0373944_0024448_1322_1621 | 99 |
| 469 | 3300035113 | Ga0373936_0016183 | Ga0373936_0016183_354_653 | 99 |
| 470 | 3300035116 | Ga0373945_0003861 | Ga0373945_0003861_46_345 | 99 |
| 471 | 3300035170 | Ga0373943_0008082 | Ga0373943_0008082_1024_1323 | 99 |
| 472 | 3300035171 | Ga0373946_0529395 | Ga0373946_0529395_272_571 | 99 |
| 473 | 3300035692 | Ga0373935_0094404 | Ga0373935_0094404_272_571 | 99 |
| 474 | 3300035692 | Ga0373935_1281963 | Ga0373935_1281963_60_359 | 99 |
| 475 | 3300035725 | Ga0373947_0000590 | Ga0373947_0000590_8399_8698 | 99 |
| 476 | 3300037068 | Ga0373925_0025998 | Ga0373925_0025998_11_310 | 99 |
| 477 | 3300037312 | Ga0395899_0055703 | Ga0395899_0055703_1735_2034 | 99 |
| 478 | 3300037312 | Ga0395899_0180397 | Ga0395899_0180397_768_1067 | 99 |
| 479 | 3300037312 | Ga0395899_0299345 | Ga0395899_0299345_61_423 | 99 |
| 480 | 3300037312 | Ga0395899_0368691 | Ga0395899_0368691_67_366 | 99 |
| 481 | 3300037312 | Ga0395899_0921280 | Ga0395899_0921280_77_376 | 99 |
| 482 | 3300037418 | Ga0395900_0015152 | Ga0395900_0015152_1791_2090 | 99 |
| 483 | 3300037418 | Ga0395900_0406131 | Ga0395900_0406131_757_1056 | 99 |
| 484 | 3300037418 | Ga0395900_0468924 | Ga0395900_0468924_398_697 | 99 |
| 485 | 3300037418 | Ga0395900_0474315 | Ga0395900_0474315_490_852 | 99 |
| 486 | 3300037418 | Ga0395900_1823630 | Ga0395900_1823630_74_373 | 99 |
| 487 | 3300037466 | Ga0395898_0038285 | Ga0395898_0038285_694_1038 | 99 |
| 488 | 3300037466 | Ga0395898_0077907 | Ga0395898_0077907_2183_2482 | 99 |
| 489 | 3300037466 | Ga0395898_0211411 | Ga0395898_0211411_758_1057 | 99 |
| 490 | 3300037466 | Ga0395898_0616880 | Ga0395898_0616880_321_620 | 99 |
| 491 | 3300037466 | Ga0395898_1071953 | Ga0395898_1071953_217_516 | 99 |
| 492 | 3300037466 | Ga0395898_1854759 | Ga0395898_1854759_79_441 | 99 |
| 493 | 3300037471 | Ga0395905_0444462 | Ga0395905_0444462_807_1106 | 99 |
| 494 | 3300037471 | Ga0395905_0741391 | Ga0395905_0741391_518_817 | 99 |
| 495 | 3300037471 | Ga0395905_0845780 | Ga0395905_0845780_164_463 | 99 |
| 496 | 3300037471 | Ga0395905_1331165 | Ga0395905_1331165_249_593 | 99 |
| 497 | 3300038443 | Ga0395901_0079715 | Ga0395901_0079715_2127_2426 | 99 |
| 498 | 3300038443 | Ga0395901_0126642 | Ga0395901_0126642_1171_1470 | 99 |
| 499 | 3300038443 | Ga0395901_0128336 | Ga0395901_0128336_2306_2605 | 99 |
| 500 | 3300038443 | Ga0395901_0735536 | Ga0395901_0735536_26_325 | 99 |
| 501 | 3300038443 | Ga0395901_0897983 | Ga0395901_0897983_16_315 | 99 |
| 502 | 3300039437 | Ga0436365_0489299 | Ga0436365_0489299_313_612 | 99 |
| 503 | 3300039437 | Ga0436365_0894153 | Ga0436365_0894153_580_879 | 99 |
| 504 | 3300039437 | Ga0436365_1695513 | Ga0436365_1695513_157_456 | 99 |
| 505 | 3300039437 | Ga0436365_1738713 | Ga0436365_1738713_1470_1769 | 99 |
| 506 | 3300039450 | Ga0436363_1518906 | Ga0436363_1518906_186_485 | 99 |
| 507 | 3300041496 | Ga0451839_0323294 | Ga0451839_0323294_31_330 | 99 |
| 508 | 3300041512 | Ga0451853_1552171 | Ga0451853_1552171_397_696 | 99 |
| 509 | 3300042005 | Ga0439448_0044150 | Ga0439448_0044150_121_420 | 99 |
| 510 | 3300042122 | Ga0450920_006037 | Ga0450920_006037_1803_2102 | 99 |
| 511 | 3300042146 | Ga0450907_096719 | Ga0450907_096719_116_415 | 99 |
| 512 | 3300042438 | Ga0439459_0155262 | Ga0439459_0155262_279_578 | 99 |
| 513 | 3300042531 | Ga0450918_032812 | Ga0450918_032812_301_600 | 99 |
| 514 | 3300044658 | Ga0466972_0283130 | Ga0466972_0283130_466_765 | 99 |
| 515 | 3300044658 | Ga0466972_0290705 | Ga0466972_0290705_51_350 | 99 |
| 516 | 3300044683 | Ga0466965_0407738 | Ga0466965_0407738_415_714 | 99 |
| 517 | 3300044684 | Ga0466966_0002834 | Ga0466966_0002834_4992_5291 | 99 |
| 518 | 3300044684 | Ga0466966_0108652 | Ga0466966_0108652_533_832 | 99 |
| 519 | 3300044684 | Ga0466966_0280549 | Ga0466966_0280549_17_316 | 99 |
| 520 | 3300044693 | Ga0466961_0011148 | Ga0466961_0011148_2603_2902 | 99 |
| 521 | 3300044693 | Ga0466961_0040813 | Ga0466961_0040813_1168_1467 | 99 |
| 522 | 3300044693 | Ga0466961_0142256 | Ga0466961_0142256_534_833 | 99 |
| 523 | 3300044693 | Ga0466961_0904722 | Ga0466961_0904722_211_510 | 99 |
| 524 | 3300044694 | Ga0466963_0000037 | Ga0466963_0000037_310_609 | 99 |
| 525 | 3300044694 | Ga0466963_0012580 | Ga0466963_0012580_3526_3825 | 99 |
| 526 | 3300044694 | Ga0466963_0019970 | Ga0466963_0019970_1229_1528 | 99 |
| 527 | 3300044694 | Ga0466963_0025907 | Ga0466963_0025907_2249_2548 | 99 |
| 528 | 3300044694 | Ga0466963_0039167 | Ga0466963_0039167_1351_1650 | 99 |
| 529 | 3300044694 | Ga0466963_0107955 | Ga0466963_0107955_241_540 | 99 |
| 530 | 3300044694 | Ga0466963_0434860 | Ga0466963_0434860_375_674 | 99 |
| 531 | 3300044706 | Ga0466964_0016749 | Ga0466964_0016749_1354_1653 | 99 |
| 532 | 3300044706 | Ga0466964_0025011 | Ga0466964_0025011_1296_1595 | 99 |
| 533 | 3300044706 | Ga0466964_0148086 | Ga0466964_0148086_106_405 | 99 |
| 534 | 3300044706 | Ga0466964_0175895 | Ga0466964_0175895_586_885 | 99 |
| 535 | 3300044706 | Ga0466964_0186342 | Ga0466964_0186342_289_588 | 99 |
| 536 | 3300044706 | Ga0466964_0835282 | Ga0466964_0835282_200_499 | 99 |
| 537 | 3300044719 | Ga0466971_0150491 | Ga0466971_0150491_246_545 | 99 |
| 538 | 3300044719 | Ga0466971_0356469 | Ga0466971_0356469_117_416 | 99 |
| 539 | 3300044719 | Ga0466971_0474972 | Ga0466971_0474972_255_554 | 99 |
| 540 | 3300044735 | Ga0466968_0015622 | Ga0466968_0015622_2196_2495 | 99 |
| 541 | 3300044765 | Ga0466970_0189969 | Ga0466970_0189969_800_1099 | 99 |
| 542 | 3300044765 | Ga0466970_0223888 | Ga0466970_0223888_72_371 | 99 |
| 543 | 3300044842 | Ga0466957_0106615 | Ga0466957_0106615_23_322 | 99 |
| 544 | 3300044842 | Ga0466957_0340807 | Ga0466957_0340807_448_747 | 99 |
| 545 | 3300044842 | Ga0466957_0487690 | Ga0466957_0487690_475_774 | 99 |
| 546 | 3300044842 | Ga0466957_0562358 | Ga0466957_0562358_180_479 | 99 |
| 547 | 3300044901 | Ga0466960_0756336 | Ga0466960_0756336_136_435 | 99 |
| 548 | 3300045049 | Ga0466959_0009015 | Ga0466959_0009015_1976_2275 | 99 |
| 549 | 3300045049 | Ga0466959_0101180 | Ga0466959_0101180_978_1277 | 99 |
| 550 | 3300045049 | Ga0466959_0199798 | Ga0466959_0199798_337_636 | 99 |
| 551 | 3300045049 | Ga0466959_0286203 | Ga0466959_0286203_395_694 | 99 |
| 552 | 3300045049 | Ga0466959_0722936 | Ga0466959_0722936_55_354 | 99 |
| 553 | 3300045836 | Ga0466958_0062153 | Ga0466958_0062153_1026_1325 | 99 |
| 554 | 3300045836 | Ga0466958_0179435 | Ga0466958_0179435_395_694 | 99 |
| 555 | 3300045836 | Ga0466958_0650196 | Ga0466958_0650196_55_354 | 99 |
| 556 | 3300045976 | Ga0466967_0005846 | Ga0466967_0005846_4761_5060 | 99 |
| 557 | 3300045976 | Ga0466967_0006284 | Ga0466967_0006284_4419_4718 | 99 |
| 558 | 3300045976 | Ga0466967_0018080 | Ga0466967_0018080_2651_2950 | 99 |
| 559 | 3300045976 | Ga0466967_0048083 | Ga0466967_0048083_288_587 | 99 |
| 560 | 3300045976 | Ga0466967_0075125 | Ga0466967_0075125_2415_2714 | 99 |
| 561 | 3300045976 | Ga0466967_0088756 | Ga0466967_0088756_13_312 | 99 |
| 562 | 3300045976 | Ga0466967_0112904 | Ga0466967_0112904_1344_1643 | 99 |
| 563 | 3300045976 | Ga0466967_0114331 | Ga0466967_0114331_105_404 | 99 |
| 564 | 3300045976 | Ga0466967_0114427 | Ga0466967_0114427_1558_1857 | 99 |
| 565 | 3300045976 | Ga0466967_0178941 | Ga0466967_0178941_642_941 | 99 |
| 566 | 3300045976 | Ga0466967_0215476 | Ga0466967_0215476_445_744 | 99 |
| 567 | 3300045976 | Ga0466967_0387149 | Ga0466967_0387149_115_414 | 99 |
| 568 | 3300045976 | Ga0466967_0490601 | Ga0466967_0490601_263_562 | 99 |
| 569 | 3300045976 | Ga0466967_0529334 | Ga0466967_0529334_849_1148 | 99 |
| 570 | 3300045976 | Ga0466967_0558042 | Ga0466967_0558042_581_880 | 99 |
| 571 | 3300045976 | Ga0466967_0610262 | Ga0466967_0610262_759_1058 | 99 |
| 572 | 3300045976 | Ga0466967_0625919 | Ga0466967_0625919_485_784 | 99 |
| 573 | 3300045976 | Ga0466967_0631097 | Ga0466967_0631097_167_466 | 99 |
| 574 | 3300045976 | Ga0466967_0733273 | Ga0466967_0733273_227_526 | 99 |
| 575 | 3300045976 | Ga0466967_0849445 | Ga0466967_0849445_533_832 | 99 |
| 576 | 3300045976 | Ga0466967_0947326 | Ga0466967_0947326_179_478 | 99 |
| 577 | 3300045976 | Ga0466967_0974087 | Ga0466967_0974087_483_782 | 99 |
| 578 | 3300045976 | Ga0466967_1128168 | Ga0466967_1128168_294_593 | 99 |
| 579 | 3300046461 | Ga0495641_0114789 | Ga0495641_0114789_650_949 | 99 |
| 580 | 3300046461 | Ga0495641_0118566 | Ga0495641_0118566_565_864 | 99 |
| 581 | 3300046463 | Ga0495653_0223428 | Ga0495653_0223428_335_634 | 99 |
| 582 | 3300046472 | Ga0495580_0201644 | Ga0495580_0201644_821_1120 | 99 |
| 583 | 3300046473 | Ga0495582_0170654 | Ga0495582_0170654_651_950 | 99 |
| 584 | 3300046473 | Ga0495582_0237450 | Ga0495582_0237450_549_848 | 99 |
| 585 | 3300046475 | Ga0495639_0244442 | Ga0495639_0244442_96_395 | 99 |
| 586 | 3300046511 | Ga0495608_0216221 | Ga0495608_0216221_811_1110 | 99 |
| 587 | 3300046517 | Ga0495630_0143360 | Ga0495630_0143360_1196_1495 | 99 |
| 588 | 3300046517 | Ga0495630_0160665 | Ga0495630_0160665_1046_1345 | 99 |
| 589 | 3300046517 | Ga0495630_0202847 | Ga0495630_0202847_589_888 | 99 |
| 590 | 3300046533 | Ga0495640_0256980 | Ga0495640_0256980_761_1060 | 99 |
| 591 | 3300046535 | Ga0495586_0006168 | Ga0495586_0006168_4176_4475 | 99 |
| 592 | 3300046535 | Ga0495586_0121463 | Ga0495586_0121463_87_386 | 99 |
| 593 | 3300046536 | Ga0495587_0110294 | Ga0495587_0110294_1167_1466 | 99 |
| 594 | 3300046536 | Ga0495587_0216860 | Ga0495587_0216860_487_786 | 99 |
| 595 | 3300046559 | Ga0495667_0376677 | Ga0495667_0376677_478_777 | 99 |
| 596 | 3300046615 | Ga0495656_0673042 | Ga0495656_0673042_65_364 | 99 |
| 597 | 3300046642 | Ga0495634_0117263 | Ga0495634_0117263_814_1113 | 99 |
| 598 | 3300046642 | Ga0495634_0489784 | Ga0495634_0489784_330_629 | 99 |
| 599 | 3300046680 | Ga0495646_0507906 | Ga0495646_0507906_138_437 | 99 |
| 600 | 3300046681 | Ga0495647_0075764 | Ga0495647_0075764_610_909 | 99 |
| 601 | 3300046694 | Ga0495649_0423914 | Ga0495649_0423914_10_309 | 99 |
| 602 | 3300047317 | Ga0495604_0774357 | Ga0495604_0774357_130_429 | 99 |
| 603 | 3300047319 | Ga0495674_0126270 | Ga0495674_0126270_1363_1662 | 99 |
| 604 | 3300047319 | Ga0495674_0237914 | Ga0495674_0237914_124_423 | 99 |
| 605 | 3300047319 | Ga0495674_0359859 | Ga0495674_0359859_869_1168 | 99 |
| 606 | 3300047321 | Ga0495676_0700229 | Ga0495676_0700229_148_447 | 99 |
| 607 | 3300047322 | Ga0495680_0864477 | Ga0495680_0864477_261_560 | 99 |
| 608 | 3300047673 | Ga0495593_0072214 | Ga0495593_0072214_65_364 | 99 |
| 609 | 3300048903 | Ga0496100_0030673 | Ga0496100_0030673_2537_2836 | 99 |
| 610 | 3300048904 | Ga0496101_0140299 | Ga0496101_0140299_445_744 | 99 |
| 611 | 3300048905 | Ga0496102_0005991 | Ga0496102_0005991_2338_2637 | 99 |
| 612 | 3300048906 | Ga0496103_0199074 | Ga0496103_0199074_797_1096 | 99 |
| 613 | 3300048907 | Ga0496104_0011990 | Ga0496104_0011990_247_546 | 99 |
| 614 | 3300048907 | Ga0496104_0813858 | Ga0496104_0813858_152_451 | 99 |
| 615 | 3300048908 | Ga0496105_0002671 | Ga0496105_0002671_1267_1566 | 99 |
| 616 | 3300048909 | Ga0496106_0003662 | Ga0496106_0003662_3382_3681 | 99 |
| 617 | 3300048910 | Ga0496107_0102525 | Ga0496107_0102525_948_1247 | 99 |
| 618 | 3300048911 | Ga0496108_0006069 | Ga0496108_0006069_2486_2785 | 99 |
| 619 | 3300048911 | Ga0496108_0640216 | Ga0496108_0640216_412_711 | 99 |
| 620 | 3300048912 | Ga0496109_0002789 | Ga0496109_0002789_822_1121 | 99 |
| 621 | 3300048913 | Ga0496110_0004178 | Ga0496110_0004178_751_1050 | 99 |
| 622 | 3300048914 | Ga0496111_0033409 | Ga0496111_0033409_2584_2883 | 99 |
| 623 | 3300048914 | Ga0496111_0179718 | Ga0496111_0179718_427_726 | 99 |
| 624 | 3300048914 | Ga0496111_0921586 | Ga0496111_0921586_45_344 | 99 |
| 625 | 3300048915 | Ga0496112_0446110 | Ga0496112_0446110_753_1052 | 99 |
| 626 | 3300048915 | Ga0496112_0584436 | Ga0496112_0584436_415_714 | 99 |
| 627 | 3300048915 | Ga0496112_1692982 | Ga0496112_1692982_224_523 | 99 |
| 628 | 3300048916 | Ga0496113_0026347 | Ga0496113_0026347_1664_1963 | 99 |
| 629 | 3300048917 | Ga0496114_0002457 | Ga0496114_0002457_247_546 | 99 |
| 630 | 3300048917 | Ga0496114_0258633 | Ga0496114_0258633_889_1188 | 99 |
| 631 | 3300048917 | Ga0496114_0685957 | Ga0496114_0685957_131_430 | 99 |
| 632 | 3300048918 | Ga0496115_0005151 | Ga0496115_0005151_1098_1397 | 99 |
| 633 | 3300049568 | Ga0501031_0344451 | Ga0501031_0344451_257_556 | 99 |
| 634 | 3300049569 | Ga0501032_0242821 | Ga0501032_0242821_472_771 | 99 |
| 635 | 3300049570 | Ga0501033_1052515 | Ga0501033_1052515_122_421 | 99 |
| 636 | 3300049571 | Ga0501034_0321166 | Ga0501034_0321166_421_720 | 99 |
| 637 | 3300049572 | Ga0501036_0356252 | Ga0501036_0356252_91_390 | 99 |
| 638 | 3300049572 | Ga0501036_0547212 | Ga0501036_0547212_594_893 | 99 |
| 639 | 3300049572 | Ga0501036_1398409 | Ga0501036_1398409_28_327 | 99 |
| 640 | 3300049575 | Ga0501039_0941766 | Ga0501039_0941766_117_416 | 99 |
| 641 | 3300049575 | Ga0501039_1042575 | Ga0501039_1042575_232_531 | 99 |
| 642 | 3300049575 | Ga0501039_1249633 | Ga0501039_1249633_252_551 | 99 |
| 643 | 3300049576 | Ga0501040_0131703 | Ga0501040_0131703_436_735 | 99 |
| 644 | 3300049577 | Ga0501041_0214980 | Ga0501041_0214980_128_427 | 99 |
| 645 | 3300049577 | Ga0501041_0562229 | Ga0501041_0562229_225_524 | 99 |
| 646 | 3300049580 | Ga0501046_0848257 | Ga0501046_0848257_276_575 | 99 |
| 647 | 3300049581 | Ga0501047_0061170 | Ga0501047_0061170_1569_1868 | 99 |
| 648 | 3300049581 | Ga0501047_0219398 | Ga0501047_0219398_949_1248 | 99 |
| 649 | 3300049581 | Ga0501047_0696142 | Ga0501047_0696142_69_368 | 99 |
| 650 | 3300049582 | Ga0501048_0242298 | Ga0501048_0242298_803_1102 | 99 |
| 651 | 3300049582 | Ga0501048_1066701 | Ga0501048_1066701_139_438 | 99 |
| 652 | 3300049582 | Ga0501048_1373482 | Ga0501048_1373482_136_435 | 99 |
| 653 | 3300049583 | Ga0501067_0000163 | Ga0501067_0000163_35611_35910 | 99 |
| 654 | 3300049584 | Ga0501068_0082316 | Ga0501068_0082316_992_1291 | 99 |
| 655 | 3300049585 | Ga0501069_0003809 | Ga0501069_0003809_4333_4632 | 99 |
| 656 | 3300049585 | Ga0501069_0129026 | Ga0501069_0129026_895_1194 | 99 |
| 657 | 3300049585 | Ga0501069_0325813 | Ga0501069_0325813_481_780 | 99 |
| 658 | 3300049585 | Ga0501069_0647349 | Ga0501069_0647349_140_439 | 99 |
| 659 | 3300049586 | Ga0501070_0003032 | Ga0501070_0003032_7379_7678 | 99 |
| 660 | 3300049586 | Ga0501070_0067716 | Ga0501070_0067716_1981_2280 | 99 |
| 661 | 3300049586 | Ga0501070_0310143 | Ga0501070_0310143_790_1089 | 99 |
| 662 | 3300049586 | Ga0501070_0323861 | Ga0501070_0323861_631_930 | 99 |
| 663 | 3300049586 | Ga0501070_0396149 | Ga0501070_0396149_303_602 | 99 |
| 664 | 3300049586 | Ga0501070_0883218 | Ga0501070_0883218_181_480 | 99 |
| 665 | 3300049587 | Ga0501071_0128485 | Ga0501071_0128485_531_830 | 99 |
| 666 | 3300049587 | Ga0501071_0268424 | Ga0501071_0268424_279_578 | 99 |
| 667 | 3300049588 | Ga0501072_0307219 | Ga0501072_0307219_947_1246 | 99 |
| 668 | 3300049588 | Ga0501072_0391156 | Ga0501072_0391156_21_320 | 99 |
| 669 | 3300049589 | Ga0501073_0739985 | Ga0501073_0739985_172_471 | 99 |
| 670 | 3300049589 | Ga0501073_1126670 | Ga0501073_1126670_190_489 | 99 |
| 671 | 3300049590 | Ga0501074_0012591 | Ga0501074_0012591_570_869 | 99 |
| 672 | 3300049590 | Ga0501074_0200257 | Ga0501074_0200257_253_552 | 99 |
| 673 | 3300049591 | Ga0501075_0179876 | Ga0501075_0179876_365_664 | 99 |
| 674 | 3300049591 | Ga0501075_0185043 | Ga0501075_0185043_979_1278 | 99 |
| 675 | 3300049591 | Ga0501075_0190546 | Ga0501075_0190546_846_1145 | 99 |
| 676 | 3300049591 | Ga0501075_0595823 | Ga0501075_0595823_224_523 | 99 |
| 677 | 3300049591 | Ga0501075_1475497 | Ga0501075_1475497_40_339 | 99 |
| 678 | 3300049592 | Ga0501076_0636894 | Ga0501076_0636894_253_552 | 99 |
| 679 | 3300049592 | Ga0501076_1797433 | Ga0501076_1797433_73_372 | 99 |
| 680 | 3300049593 | Ga0501077_0057161 | Ga0501077_0057161_1144_1443 | 99 |
| 681 | 3300049593 | Ga0501077_0261169 | Ga0501077_0261169_692_991 | 99 |
| 682 | 3300049593 | Ga0501077_0373892 | Ga0501077_0373892_488_787 | 99 |
| 683 | 3300049686 | Ga0501257_217013 | Ga0501257_217013_240_539 | 99 |
| 684 | 3300049741 | Ga0501079_0178201 | Ga0501079_0178201_1017_1316 | 99 |
| 685 | 3300049741 | Ga0501079_0386254 | Ga0501079_0386254_677_976 | 99 |
| 686 | 3300049741 | Ga0501079_0918928 | Ga0501079_0918928_162_461 | 99 |
| 687 | 3300049741 | Ga0501079_1580998 | Ga0501079_1580998_28_327 | 99 |
| 688 | 3300049742 | Ga0501080_0186373 | Ga0501080_0186373_660_959 | 99 |
| 689 | 3300049742 | Ga0501080_0248406 | Ga0501080_0248406_538_837 | 99 |
| 690 | 3300049742 | Ga0501080_0261699 | Ga0501080_0261699_1240_1539 | 99 |
| 691 | 3300049742 | Ga0501080_0497086 | Ga0501080_0497086_766_1065 | 99 |
| 692 | 3300049743 | Ga0501081_0147649 | Ga0501081_0147649_1202_1501 | 99 |
| 693 | 3300049743 | Ga0501081_0332671 | Ga0501081_0332671_511_810 | 99 |
| 694 | 3300049743 | Ga0501081_0903815 | Ga0501081_0903815_200_499 | 99 |
| 695 | 3300049743 | Ga0501081_1177611 | Ga0501081_1177611_166_465 | 99 |
| 696 | 3300049744 | Ga0501083_0217934 | Ga0501083_0217934_919_1218 | 99 |
| 697 | 3300049772 | Ga0501275_079780 | Ga0501275_079780_159_458 | 99 |
| 698 | 3300049823 | Ga0501044_0588971 | Ga0501044_0588971_294_593 | 99 |
| 699 | 3300050507 | nmdc:mga05p37_1933563_c1 | nmdc:mga05p37_1933563_c1_173_472 | 99 |
| 700 | 3300050513 | nmdc:mga0rr50_1340870_c1 | nmdc:mga0rr50_1340870_c1_129_428 | 99 |
| 701 | 3300050513 | nmdc:mga0rr50_1766530_c1 | nmdc:mga0rr50_1766530_c1_14_313 | 99 |
| 702 | 3300050513 | nmdc:mga0rr50_442247_c1 | nmdc:mga0rr50_442247_c1_650_949 | 99 |
| 703 | 3300050514 | nmdc:mga08x19_633109_c1 | nmdc:mga08x19_633109_c1_88_387 | 99 |
| 704 | 3300050514 | nmdc:mga08x19_784147_c1 | nmdc:mga08x19_784147_c1_263_562 | 99 |
| 705 | 3300050515 | nmdc:mga0a205_249680_c1 | nmdc:mga0a205_249680_c1_746_1045 | 99 |
| 706 | 3300053078 | Ga0495612_0120485 | Ga0495612_0120485_525_824 | 99 |
| 707 | 3300053084 | Ga0495595_0403410 | Ga0495595_0403410_238_537 | 99 |
| 708 | 3300054114 | Ga0501084_0373600 | Ga0501084_0373600_135_434 | 99 |
| 709 | 3300054114 | Ga0501084_0444499 | Ga0501084_0444499_108_407 | 99 |
| 710 | 3300054114 | Ga0501084_0647747 | Ga0501084_0647747_393_692 | 99 |
| 711 | 3300059491 | Ga0587070_168066 | Ga0587070_168066_14_313 | 99 |
| 712 | 3300059492 | Ga0587073_0203421 | Ga0587073_0203421_30_329 | 99 |
| 713 | 3300059505 | Ga0587083_0244555 | Ga0587083_0244555_201_500 | 99 |
| 714 | 3300059626 | Ga0587115_082845 | Ga0587115_082845_169_468 | 99 |
| 715 | 3300059626 | Ga0587115_115216 | Ga0587115_115216_164_463 | 99 |
| 716 | 3300059644 | Ga0587075_003998 | Ga0587075_003998_98_397 | 99 |
| 717 | 3300060353 | Ga0501082_0116044 | Ga0501082_0116044_253_552 | 99 |
| 718 | 3300060353 | Ga0501082_1798094 | Ga0501082_1798094_177_476 | 99 |
| 719 | 3300061719 | Ga0466962_0014187 | Ga0466962_0014187_293_592 | 99 |
| 720 | 3300061719 | Ga0466962_0023570 | Ga0466962_0023570_229_528 | 99 |
| 721 | 3300061734 | Ga0530510_0314571 | Ga0530510_0314571_546_845 | 99 |
| 722 | 3300061734 | Ga0530510_0952596 | Ga0530510_0952596_34_333 | 99 |
| 723 | 3300061734 | Ga0530510_0970792 | Ga0530510_0970792_231_530 | 99 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3lno-assembly1.cif.gz_A | crystal structure of domain of unknown function duf59 from bacillus anthracis | 0.9327 | 5 | 99 |
| 3cq2-assembly1.cif.gz_B | structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 | 0.9066 | 1 | 97 |
| 2cu6-assembly1.cif.gz_A | crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 | 0.9021 | 2 | 91 |
| 1wcj-assembly1.cif.gz_A | conserved hypothetical protein tm0487 from thermotoga maritima | 0.8892 | 2 | 97 |
| 3cq2-assembly1.cif.gz_B | structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 | 0.8892 | 1 | 97 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FZT0_1_88_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9722 | 13 | 97 | 3.30.300.130 |
| af_Q0JJS8_71_163_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9403 | 5 | 78 | 3.30.300.130 |
| af_Q2FZT0_1_88_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9295 | 13 | 97 | 3.30.300.130 |
| af_P76080_10_106_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9221 | 2 | 97 | 3.30.300.130 |
| af_Q8II78_18_117_3.30.300.130 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) | 0.9204 | 5 | 78 | 3.30.300.130 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9JNX4-F1-model_v4 | Metal-sulfur cluster assembly factor | 0.9945 | 1 | 99 |
|
| AF-A0A2E9VW27-F1-model_v4 | Rieske domain-containing protein | 0.9942 | 7 | 97 |
GO:0046872
GO:0051537 |
| AF-A0A7V5A2L2-F1-model_v4 | DUF59 domain-containing protein | 0.9926 | 2 | 97 |
|
| AF-A0A257VM95-F1-model_v4 | Rieske domain-containing protein | 0.9899 | 2 | 99 |
GO:0046872
GO:0051537 |
| AF-A0A7Y5N2I1-F1-model_v4 | DUF59 domain-containing protein | 0.9889 | 1 | 99 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar