F477477

General Info

Members Datasets Scaffolds Average Seq Length
723 295 723 100

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100065381|Ga0070708_1000653813
Length 115
Sequence MADMSEETTTQDKEGGAPTAEQVTEALKVVVDPELGINIVDLGLVYDVAVEDEVVKITYTLTTMGCPVGPLIEQQMQQVLTTLPGISNVESEMVFTPPWSPERMSEEARLAMGMF

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
190 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
191 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
192 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
247 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
248 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
249 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
250 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
251 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
264 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
265 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
266 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
267 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
268 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
271 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
274 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
275 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.13
Metatranscriptomes 3.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.48
Rhizosphere 87.28
Stem 0
Stem Tuber 0
Unclassified 1.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_11212884 3300005327 Bacteria 656
2 Ga0070683_100226322 3300005329 Bacteria 1777
3 Ga0070690_100069365 3300005330 Bacteria 2288
4 Ga0070690_100166404 3300005330 Bacteria 1514
5 Ga0068869_100130555 3300005334 Bacteria 1931
6 Ga0070680_100038117 3300005336 Bacteria 3886
7 Ga0070680_101738745 3300005336 Bacteria 540
8 Ga0070680_101901709 3300005336 Bacteria 516
9 Ga0070682_100012408 3300005337 Bacteria 4887
10 Ga0068868_100061984 3300005338 Bacteria 2963
11 Ga0068868_100476343 3300005338 Bacteria 1090
12 Ga0070660_100007596 3300005339 Bacteria 7557
13 Ga0070660_100021467 3300005339 Bacteria 4763
14 Ga0070660_100135957 3300005339 Bacteria 1969
15 Ga0070660_100351431 3300005339 Bacteria 1214
16 Ga0070689_100075774 3300005340 Bacteria 2634
17 Ga0070661_100060787 3300005344 Bacteria 2772
18 Ga0070661_100112887 3300005344 Bacteria 2030
19 Ga0070692_10009738 3300005345 Bacteria 4347
20 Ga0070671_100879510 3300005355 Bacteria 782
21 Ga0070674_100182410 3300005356 Bacteria 1609
22 Ga0070674_100272683 3300005356 Bacteria 1338
23 Ga0070673_101009370 3300005364 Bacteria 775
24 Ga0070688_100051117 3300005365 Bacteria 2578
25 Ga0070659_100035598 3300005366 Bacteria 3877
26 Ga0070659_100158972 3300005366 Bacteria 1847
27 Ga0070659_100345434 3300005366 Bacteria 1247
28 Ga0070667_100055300 3300005367 Bacteria 3352
29 Ga0070667_100514446 3300005367 Bacteria 1098
30 Ga0070667_101237269 3300005367 Bacteria 699
31 Ga0070714_100265556 3300005435 Bacteria 1590
32 Ga0070714_100546286 3300005435 Unclassified 1109
33 Ga0070713_100200477 3300005436 Bacteria 1802
34 Ga0070701_10174934 3300005438 Bacteria 1253
35 Ga0070711_100042752 3300005439 Bacteria 3065
36 Ga0070711_101576723 3300005439 Unclassified 574
37 Ga0070705_100095823 3300005440 Bacteria 1861
38 Ga0070705_100121261 3300005440 Bacteria 1689
39 Ga0070705_100863960 3300005440 Bacteria 725
40 Ga0070700_100249364 3300005441 Bacteria 1273
41 Ga0070694_100055019 3300005444 Bacteria 2698
42 Ga0070708_100042687 3300005445 Bacteria 3983
43 Ga0070708_100065381 3300005445 Bacteria 3261
44 Ga0070708_100094407 3300005445 Bacteria 2729
45 Ga0070708_101033397 3300005445 Bacteria 770
46 Ga0070663_100640697 3300005455 Bacteria 898
47 Ga0070663_100733596 3300005455 Unclassified 842
48 Ga0070678_100008202 3300005456 Bacteria 6245
49 Ga0070678_101938165 3300005456 Bacteria 557
50 Ga0070681_10001955 3300005458 Bacteria 18619
51 Ga0070681_10510298 3300005458 Bacteria 1116
52 Ga0068867_100080687 3300005459 Bacteria 2451
53 Ga0070685_10335328 3300005466 Bacteria 1029
54 Ga0070685_10380813 3300005466 Bacteria 972
55 Ga0070706_100004684 3300005467 Bacteria 13117
56 Ga0070706_100211206 3300005467 Bacteria 1812
57 Ga0070706_100686813 3300005467 Bacteria 950
58 Ga0070706_100732961 3300005467 Bacteria 916
59 Ga0070707_100004513 3300005468 Bacteria 13032
60 Ga0070707_100273104 3300005468 Bacteria 1643
61 Ga0070707_100457585 3300005468 Bacteria 1237
62 Ga0070707_100672696 3300005468 Unclassified 998
63 Ga0070698_100056452 3300005471 Bacteria 3979
64 Ga0070698_100753766 3300005471 Unclassified 917
65 Ga0070699_100181915 3300005518 Bacteria 1865
66 Ga0070699_100471394 3300005518 Bacteria 1139
67 Ga0070679_100057784 3300005530 Bacteria 3867
68 Ga0070679_100135234 3300005530 Bacteria 2446
69 Ga0070679_100171278 3300005530 Bacteria 2144
70 Ga0070679_100322341 3300005530 Bacteria 1494
71 Ga0070684_100030942 3300005535 Bacteria 4552
72 Ga0070684_100061807 3300005535 Bacteria 3279
73 Ga0070684_100101616 3300005535 Bacteria 2569
74 Ga0070684_100132648 3300005535 Bacteria 2248
75 Ga0070684_100902244 3300005535 Bacteria 828
76 Ga0070697_100438854 3300005536 Bacteria 1136
77 Ga0070697_100672856 3300005536 Bacteria 912
78 Ga0068853_100052906 3300005539 Bacteria 3497
79 Ga0068853_102170324 3300005539 Bacteria 538
80 Ga0070686_100053965 3300005544 Bacteria 2569
81 Ga0070695_100529849 3300005545 Bacteria 915
82 Ga0070696_100041484 3300005546 Bacteria 3180
83 Ga0070696_100096200 3300005546 Bacteria 2116
84 Ga0070696_101897979 3300005546 Bacteria 516
85 Ga0070693_100005617 3300005547 Bacteria 6047
86 Ga0070693_100206652 3300005547 Bacteria 1279
87 Ga0070665_100314565 3300005548 Bacteria 1570
88 Ga0070665_100804462 3300005548 Bacteria 953
89 Ga0070704_100488166 3300005549 Bacteria 1067
90 Ga0070704_100553092 3300005549 Bacteria 1006
91 Ga0068855_100023960 3300005563 Bacteria 7308
92 Ga0068855_100555096 3300005563 Bacteria 1243
93 Ga0068855_100637854 3300005563 Bacteria 1145
94 Ga0070664_100179626 3300005564 Bacteria 1880
95 Ga0070664_100441521 3300005564 Bacteria 1194
96 Ga0068857_100011172 3300005577 Bacteria 7809
97 Ga0068857_100327735 3300005577 Bacteria 1415
98 Ga0068857_100364879 3300005577 Bacteria 1339
99 Ga0068854_100200137 3300005578 Bacteria 1570
100 Ga0068854_100825568 3300005578 Bacteria 810
101 Ga0068854_100995211 3300005578 Unclassified 742
102 Ga0068854_101037664 3300005578 Bacteria 728
103 Ga0068856_100091442 3300005614 Bacteria 3027
104 Ga0068856_100216927 3300005614 Bacteria 1928
105 Ga0068856_101554709 3300005614 Unclassified 675
106 Ga0068856_102206004 3300005614 Unclassified 560
107 Ga0070702_100033934 3300005615 Bacteria 2810
108 Ga0070702_100060507 3300005615 Bacteria 2202
109 Ga0068852_100085601 3300005616 Bacteria 2808
110 Ga0068852_100186384 3300005616 Bacteria 1954
111 Ga0068852_100232811 3300005616 Bacteria 1757
112 Ga0068859_101418953 3300005617 Bacteria 766
113 Ga0068864_101298219 3300005618 Bacteria 728
114 Ga0068866_10088089 3300005718 Bacteria 1684
115 Ga0068866_10488061 3300005718 Bacteria 813
116 Ga0068870_10801653 3300005840 Bacteria 658
117 Ga0068858_100016243 3300005842 Bacteria 6993
118 Ga0068858_100031994 3300005842 Bacteria 4887
119 Ga0068858_102458821 3300005842 Unclassified 515
120 Ga0068860_100020071 3300005843 Bacteria 6474
121 Ga0070717_10285063 3300006028 Unclassified 1466
122 Ga0070715_10014322 3300006163 Bacteria 2935
123 Ga0070715_10256955 3300006163 Bacteria 916
124 Ga0070716_100572563 3300006173 Bacteria 845
125 Ga0070712_100037595 3300006175 Bacteria 3301
126 Ga0097621_100010903 3300006237 Bacteria 6672
127 Ga0097621_100130048 3300006237 Bacteria 2142
128 Ga0097621_102205234 3300006237 Unclassified 527
129 Ga0068871_100052258 3300006358 Bacteria 3309
130 Ga0068871_100127541 3300006358 Bacteria 2155
131 Ga0068871_101182205 3300006358 Unclassified 717
132 Ga0075433_10077960 3300006852 Bacteria 2919
133 Ga0075434_100052014 3300006871 Bacteria 4070
134 Ga0068865_100014192 3300006881 Bacteria 5057
135 Ga0068865_100234368 3300006881 Bacteria 1442
136 Ga0075436_100171437 3300006914 Bacteria 1532
137 Ga0075436_100861195 3300006914 Bacteria 677
138 Ga0097620_101418885 3300006931 Bacteria 766
139 Ga0075435_100194889 3300007076 Bacteria 1716
140 Ga0105240_11517974 3300009093 Bacteria 702
141 Ga0105240_11572672 3300009093 Bacteria 688
142 Ga0105240_12229884 3300009093 Bacteria 568
143 Ga0111539_10814118 3300009094 Bacteria 1087
144 Ga0105245_10015320 3300009098 Bacteria 6682
145 Ga0105245_10224157 3300009098 Bacteria 1815
146 Ga0105245_10349933 3300009098 Bacteria 1464
147 Ga0105245_10936573 3300009098 Bacteria 909
148 Ga0105247_10052990 3300009101 Bacteria 2501
149 Ga0105247_10304565 3300009101 Bacteria 1107
150 Ga0105243_10047355 3300009148 Bacteria 3384
151 Ga0105243_10267127 3300009148 Bacteria 1534
152 Ga0105243_10658793 3300009148 Bacteria 1015
153 Ga0105243_11227939 3300009148 Bacteria 764
154 Ga0105241_10060149 3300009174 Bacteria 2922
155 Ga0105241_10084415 3300009174 Bacteria 2493
156 Ga0105241_10833959 3300009174 Bacteria 851
157 Ga0105242_10132083 3300009176 Bacteria 2157
158 Ga0105242_10139756 3300009176 Bacteria 2100
159 Ga0105242_10531565 3300009176 Unclassified 1124
160 Ga0105242_11804535 3300009176 Unclassified 650
161 Ga0105248_10291615 3300009177 Bacteria 1837
162 Ga0105248_10392689 3300009177 Bacteria 1562
163 Ga0105237_10091107 3300009545 Bacteria 3038
164 Ga0105237_10202129 3300009545 Bacteria 1987
165 Ga0105237_10250546 3300009545 Bacteria 1773
166 Ga0105237_11083411 3300009545 Bacteria 808
167 Ga0105238_10031640 3300009551 Bacteria 5386
168 Ga0105238_10043373 3300009551 Bacteria 4551
169 Ga0105238_10082150 3300009551 Bacteria 3212
170 Ga0105238_10822677 3300009551 Bacteria 945
171 Ga0105249_10197315 3300009553 Bacteria 1968
172 Ga0105249_11694934 3300009553 Bacteria 705
173 Ga0105249_13550048 3300009553 Bacteria 502
174 Ga0105239_10021168 3300010375 Bacteria 7172
175 Ga0105239_10064989 3300010375 Bacteria 4006
176 Ga0105239_13164434 3300010375 Bacteria 536
177 Ga0105246_10095445 3300011119 Bacteria 2153
178 Ga0105246_11270223 3300011119 Unclassified 681
179 Ga0105246_12551739 3300011119 Bacteria 504
180 Ga0157337_1026718 3300012483 Bacteria 567
181 Ga0157373_10055667 3300013100 Bacteria 2809
182 Ga0157371_10131658 3300013102 Bacteria 1780
183 Ga0157370_10026787 3300013104 Bacteria 5687
184 Ga0157370_10132385 3300013104 Bacteria 2325
185 Ga0157370_10192255 3300013104 Bacteria 1894
186 Ga0157370_10273348 3300013104 Bacteria 1561
187 Ga0157369_10030091 3300013105 Bacteria 5991
188 Ga0157369_10040930 3300013105 Bacteria 5057
189 Ga0157369_10104213 3300013105 Bacteria 3021
190 Ga0157369_10408792 3300013105 Bacteria 1408
191 Ga0157374_10021270 3300013296 Bacteria 5769
192 Ga0157374_10028775 3300013296 Bacteria 5023
193 Ga0157374_10170871 3300013296 Bacteria 2120
194 Ga0157374_11557326 3300013296 Bacteria 685
195 Ga0157378_10028470 3300013297 Bacteria 4930
196 Ga0157378_10069193 3300013297 Bacteria 3166
197 Ga0157378_12674430 3300013297 Unclassified 551
198 Ga0157372_10006332 3300013307 Bacteria 12594
199 Ga0157372_10051234 3300013307 Bacteria 4594
200 Ga0157372_10083881 3300013307 Bacteria 3610
201 Ga0157372_10185482 3300013307 Bacteria 2409
202 Ga0157372_12829193 3300013307 Bacteria 556
203 Ga0157375_10541034 3300013308 Bacteria 1327
204 Ga0157375_11423138 3300013308 Bacteria 817
205 Ga0157375_11945663 3300013308 Bacteria 698
206 Ga0163163_10488975 3300014325 Bacteria 1292
207 Ga0163163_11318267 3300014325 Bacteria 784
208 Ga0157380_10426993 3300014326 Unclassified 1266
209 Ga0157380_12597902 3300014326 Bacteria 573
210 Ga0157380_12794223 3300014326 Bacteria 555
211 Ga0182008_10125663 3300014497 Bacteria 1277
212 Ga0182008_10548333 3300014497 Bacteria 642
213 Ga0157379_10133885 3300014968 Bacteria 2232
214 Ga0157376_10229361 3300014969 Bacteria 1724
215 Ga0157376_10322620 3300014969 Bacteria 1469
216 Ga0157376_10597358 3300014969 Unclassified 1098
217 Ga0157376_11149807 3300014969 Bacteria 803
218 Ga0157376_12100000 3300014969 Bacteria 603
219 Ga0182006_1122101 3300015261 Bacteria 904
220 Ga0182007_10098967 3300015262 Bacteria 964
221 Ga0163161_10201118 3300017792 Bacteria 1535
222 Ga0163161_10505719 3300017792 Bacteria 985
223 Ga0163161_11440430 3300017792 Bacteria 603
224 Ga0197907_10913843 3300020069 Bacteria 1073
225 Ga0197907_11110821 3300020069 Bacteria 529
226 Ga0206356_10103907 3300020070 Bacteria 975
227 Ga0206356_10503281 3300020070 Bacteria 565
228 Ga0206356_10596004 3300020070 Bacteria 2000
229 Ga0206356_11115077 3300020070 Bacteria 845
230 Ga0206356_11478649 3300020070 Bacteria 509
231 Ga0206355_1251211 3300020076 Bacteria 503
232 Ga0206355_1287509 3300020076 Bacteria 991
233 Ga0206350_10489792 3300020080 Bacteria 856
234 Ga0206354_10295194 3300020081 Bacteria 930
235 Ga0206354_10412236 3300020081 Bacteria 831
236 Ga0206354_10669380 3300020081 Bacteria 2394
237 Ga0206353_11387566 3300020082 Bacteria 4498
238 Ga0206353_11491132 3300020082 Bacteria 1633
239 Ga0206353_11727024 3300020082 Bacteria 886
240 Ga0154015_1029663 3300020610 Bacteria 617
241 Ga0154015_1459760 3300020610 Bacteria 530
242 Ga0213874_10071190 3300021377 Bacteria 1110
243 Ga0213876_10177042 3300021384 Bacteria 1135
244 Ga0224712_10006171 3300022467 Bacteria 3393
245 Ga0224712_10135788 3300022467 Bacteria 1078
246 Ga0224712_10175531 3300022467 Bacteria 963
247 Ga0207642_10519908 3300025899 Bacteria 731
248 Ga0207710_10164818 3300025900 Bacteria 1081
249 Ga0207710_10168932 3300025900 Bacteria 1069
250 Ga0207688_10056833 3300025901 Bacteria 2199
251 Ga0207680_10213416 3300025903 Unclassified 1320
252 Ga0207647_10291542 3300025904 Bacteria 930
253 Ga0207647_10531479 3300025904 Bacteria 654
254 Ga0207685_10011554 3300025905 Bacteria 2659
255 Ga0207685_10155657 3300025905 Bacteria 1039
256 Ga0207643_10356051 3300025908 Bacteria 919
257 Ga0207705_10051988 3300025909 Bacteria 2949
258 Ga0207684_10004965 3300025910 Bacteria 12408
259 Ga0207684_10264467 3300025910 Bacteria 1484
260 Ga0207684_10955404 3300025910 Bacteria 718
261 Ga0207654_10116834 3300025911 Bacteria 1669
262 Ga0207654_10171698 3300025911 Bacteria 1408
263 Ga0207654_10238293 3300025911 Bacteria 1215
264 Ga0207654_10383394 3300025911 Bacteria 974
265 Ga0207654_10662506 3300025911 Bacteria 748
266 Ga0207707_10006792 3300025912 Bacteria 9984
267 Ga0207707_10008124 3300025912 Bacteria 9112
268 Ga0207695_10811588 3300025913 Bacteria 816
269 Ga0207671_10282570 3300025914 Bacteria 1309
270 Ga0207671_10414442 3300025914 Bacteria 1072
271 Ga0207671_11368290 3300025914 Bacteria 550
272 Ga0207693_10071680 3300025915 Bacteria 2712
273 Ga0207663_10066038 3300025916 Bacteria 2314
274 Ga0207663_10386863 3300025916 Unclassified 1067
275 Ga0207660_10214069 3300025917 Bacteria 1510
276 Ga0207660_10381928 3300025917 Bacteria 1132
277 Ga0207657_10004765 3300025919 Bacteria 14310
278 Ga0207657_10016023 3300025919 Bacteria 7235
279 Ga0207657_10196543 3300025919 Bacteria 1625
280 Ga0207649_10021258 3300025920 Bacteria 3732
281 Ga0207649_10081017 3300025920 Bacteria 2101
282 Ga0207649_10218566 3300025920 Bacteria 1356
283 Ga0207652_10027233 3300025921 Bacteria 4762
284 Ga0207652_10100346 3300025921 Bacteria 2555
285 Ga0207652_10442742 3300025921 Bacteria 1171
286 Ga0207652_11156007 3300025921 Bacteria 675
287 Ga0207646_10042572 3300025922 Bacteria 4079
288 Ga0207646_10182184 3300025922 Bacteria 1897
289 Ga0207646_10347464 3300025922 Bacteria 1340
290 Ga0207646_10519811 3300025922 Unclassified 1072
291 Ga0207694_10022612 3300025924 Bacteria 4770
292 Ga0207694_10255449 3300025924 Bacteria 1435
293 Ga0207687_10033171 3300025927 Bacteria 3501
294 Ga0207687_10087942 3300025927 Bacteria 2259
295 Ga0207687_10238094 3300025927 Bacteria 1441
296 Ga0207687_10456349 3300025927 Bacteria 1061
297 Ga0207687_10620651 3300025927 Unclassified 913
298 Ga0207664_10510534 3300025929 Unclassified 1077
299 Ga0207644_10802325 3300025931 Bacteria 787
300 Ga0207690_10098751 3300025932 Bacteria 2080
301 Ga0207690_10113010 3300025932 Bacteria 1959
302 Ga0207690_10375101 3300025932 Bacteria 1129
303 Ga0207706_10266441 3300025933 Bacteria 1495
304 Ga0207686_10027445 3300025934 Bacteria 3335
305 Ga0207686_10047765 3300025934 Bacteria 2648
306 Ga0207686_11763859 3300025934 Unclassified 512
307 Ga0207709_10017610 3300025935 Bacteria 3989
308 Ga0207709_10167895 3300025935 Bacteria 1537
309 Ga0207709_10712520 3300025935 Bacteria 804
310 Ga0207709_10991680 3300025935 Bacteria 686
311 Ga0207669_10040730 3300025937 Bacteria 2698
312 Ga0207704_10202833 3300025938 Bacteria 1453
313 Ga0207704_10230971 3300025938 Bacteria 1376
314 Ga0207704_10331760 3300025938 Unclassified 1177
315 Ga0207665_10138286 3300025939 Bacteria 1734
316 Ga0207711_10142535 3300025941 Bacteria 2157
317 Ga0207661_10372072 3300025944 Bacteria 1292
318 Ga0207661_10966109 3300025944 Bacteria 785
319 Ga0207661_11537705 3300025944 Bacteria 609
320 Ga0207661_11693779 3300025944 Bacteria 577
321 Ga0207679_10234865 3300025945 Bacteria 1550
322 Ga0207667_10205237 3300025949 Bacteria 2021
323 Ga0207667_10310643 3300025949 Bacteria 1610
324 Ga0207667_10344476 3300025949 Bacteria 1520
325 Ga0207667_10962024 3300025949 Unclassified 843
326 Ga0207651_10781922 3300025960 Unclassified 845
327 Ga0207651_10988283 3300025960 Bacteria 752
328 Ga0207712_10926934 3300025961 Bacteria 771
329 Ga0207640_10038906 3300025981 Bacteria 3005
330 Ga0207640_10705480 3300025981 Bacteria 865
331 Ga0207640_11349502 3300025981 Bacteria 638
332 Ga0207640_11636438 3300025981 Bacteria 580
333 Ga0207658_10105364 3300025986 Bacteria 2218
334 Ga0207658_11822664 3300025986 Bacteria 555
335 Ga0207677_11279497 3300026023 Bacteria 673
336 Ga0207703_10264621 3300026035 Bacteria 1555
337 Ga0207703_10411685 3300026035 Bacteria 1256
338 Ga0207639_10159484 3300026041 Bacteria 1899
339 Ga0207639_11992275 3300026041 Bacteria 542
340 Ga0207639_12289086 3300026041 Bacteria 502
341 Ga0207678_10097724 3300026067 Bacteria 2509
342 Ga0207678_10261429 3300026067 Bacteria 1483
343 Ga0207678_10523298 3300026067 Bacteria 1035
344 Ga0207708_10004026 3300026075 Bacteria 10811
345 Ga0207708_10687931 3300026075 Bacteria 873
346 Ga0207702_10107003 3300026078 Bacteria 2479
347 Ga0207702_10279314 3300026078 Bacteria 1578
348 Ga0207702_10373709 3300026078 Bacteria 1369
349 Ga0207702_10763958 3300026078 Bacteria 954
350 Ga0207648_10129610 3300026089 Bacteria 2220
351 Ga0207648_11997922 3300026089 Bacteria 541
352 Ga0207676_11131269 3300026095 Bacteria 775
353 Ga0207674_10034277 3300026116 Bacteria 5310
354 Ga0207674_10446681 3300026116 Bacteria 1250
355 Ga0207683_10000876 3300026121 Bacteria 27583
356 Ga0207698_10036602 3300026142 Bacteria 3604
357 Ga0207698_10402650 3300026142 Bacteria 1308
358 Ga0207698_10656217 3300026142 Bacteria 1040
359 Ga0207698_11419273 3300026142 Bacteria 709
360 Ga0207698_11754108 3300026142 Bacteria 636
361 Ga0268266_10080384 3300028379 Bacteria 2840
362 Ga0268266_10223952 3300028379 Bacteria 1730
363 Ga0268264_10050649 3300028381 Bacteria 3458
364 Ga0265319_1028375 3300028563 Bacteria 1974
365 Ga0265319_1054231 3300028563 Bacteria 1315
366 Ga0265334_10285742 3300028573 Bacteria 566
367 Ga0265318_10173648 3300028577 Bacteria 789
368 Ga0265338_10327795 3300028800 Unclassified 1107
369 Ga0265338_10881946 3300028800 Bacteria 610
370 Ga0265320_10009779 3300031240 Bacteria 5755
371 Ga0265320_10016252 3300031240 Bacteria 4176
372 Ga0265327_10057127 3300031251 Bacteria 2008
373 Ga0307416_100415878 3300032002 Unclassified 1387
374 Ga0373944_0024448 3300035089 Bacteria 1771
375 Ga0373944_0126481 3300035089 Bacteria 885
376 Ga0373936_0016183 3300035113 Bacteria 2867
377 Ga0373945_0003861 3300035116 Bacteria 4734
378 Ga0373943_0008082 3300035170 Bacteria 4718
379 Ga0373943_0544967 3300035170 Bacteria 680
380 Ga0373943_0799242 3300035170 Bacteria 561
381 Ga0373946_0529395 3300035171 Bacteria 606
382 Ga0373931_0381312 3300035691 Unclassified 889
383 Ga0373935_0094404 3300035692 Bacteria 1963
384 Ga0373935_1281963 3300035692 Bacteria 547
385 Ga0373927_0223428 3300035695 Bacteria 1237
386 Ga0373947_0000590 3300035725 Bacteria 21313
387 Ga0373947_0326136 3300035725 Bacteria 1027
388 Ga0373925_0025998 3300037068 Bacteria 4280
389 Ga0373925_0446395 3300037068 Bacteria 1059
390 Ga0373925_0498867 3300037068 Bacteria 999
391 Ga0373925_1403180 3300037068 Bacteria 572
392 Ga0395899_0055703 3300037312 Bacteria 2924
393 Ga0395899_0180397 3300037312 Bacteria 1483
394 Ga0395899_0299345 3300037312 Bacteria 1089
395 Ga0395899_0368691 3300037312 Bacteria 957
396 Ga0395899_0921280 3300037312 Bacteria 532
397 Ga0395900_0015152 3300037418 Bacteria 7861
398 Ga0395900_0406131 3300037418 Bacteria 1325
399 Ga0395900_0468924 3300037418 Bacteria 1213
400 Ga0395900_0474315 3300037418 Bacteria 1204
401 Ga0395900_1823630 3300037418 Bacteria 519
402 Ga0395898_0038285 3300037466 Bacteria 4754
403 Ga0395898_0077907 3300037466 Bacteria 3199
404 Ga0395898_0211411 3300037466 Bacteria 1850
405 Ga0395898_0616880 3300037466 Bacteria 1027
406 Ga0395898_1071953 3300037466 Bacteria 740
407 Ga0395898_1854759 3300037466 Bacteria 523
408 Ga0395905_0444462 3300037471 Bacteria 1194
409 Ga0395905_0741391 3300037471 Bacteria 885
410 Ga0395905_0845780 3300037471 Bacteria 818
411 Ga0395905_1331165 3300037471 Bacteria 622
412 Ga0395901_0079715 3300038443 Bacteria 3419
413 Ga0395901_0126642 3300038443 Bacteria 2684
414 Ga0395901_0128336 3300038443 Bacteria 2665
415 Ga0395901_0735536 3300038443 Bacteria 981
416 Ga0395901_0897983 3300038443 Bacteria 868
417 Ga0436365_0489299 3300039437 Bacteria 840
418 Ga0436365_0894153 3300039437 Bacteria 2567
419 Ga0436365_1695513 3300039437 Bacteria 681
420 Ga0436365_1738713 3300039437 Bacteria 2309
421 Ga0436363_1518906 3300039450 Bacteria 586
422 Ga0451839_0323294 3300041496 Bacteria 506
423 Ga0451853_1552171 3300041512 Bacteria 707
424 Ga0439448_0044150 3300042005 Bacteria 1449
425 Ga0450920_006037 3300042122 Bacteria 2168
426 Ga0450907_096719 3300042146 Unclassified 514
427 Ga0439459_0155262 3300042438 Bacteria 601
428 Ga0450918_032812 3300042531 Unclassified 919
429 Ga0466972_0283130 3300044658 Bacteria 775
430 Ga0466972_0290705 3300044658 Bacteria 764
431 Ga0466965_0407738 3300044683 Bacteria 752
432 Ga0466966_0002834 3300044684 Bacteria 11411
433 Ga0466966_0108652 3300044684 Bacteria 1711
434 Ga0466966_0280549 3300044684 Bacteria 1002
435 Ga0466961_0011148 3300044693 Bacteria 5746
436 Ga0466961_0040813 3300044693 Bacteria 2975
437 Ga0466961_0142256 3300044693 Bacteria 1501
438 Ga0466961_0904722 3300044693 Bacteria 525
439 Ga0466963_0000037 3300044694 Bacteria 42541
440 Ga0466963_0012580 3300044694 Bacteria 5184
441 Ga0466963_0019970 3300044694 Bacteria 4210
442 Ga0466963_0025907 3300044694 Bacteria 3745
443 Ga0466963_0039167 3300044694 Bacteria 3103
444 Ga0466963_0107955 3300044694 Bacteria 1909
445 Ga0466963_0434860 3300044694 Bacteria 925
446 Ga0466964_0016749 3300044706 Bacteria 2801
447 Ga0466964_0025011 3300044706 Bacteria 2330
448 Ga0466964_0148086 3300044706 Bacteria 1085
449 Ga0466964_0175895 3300044706 Bacteria 1011
450 Ga0466964_0186342 3300044706 Bacteria 987
451 Ga0466964_0835282 3300044706 Bacteria 523
452 Ga0466971_0150491 3300044719 Bacteria 1086
453 Ga0466971_0356469 3300044719 Bacteria 708
454 Ga0466971_0474972 3300044719 Bacteria 615
455 Ga0466968_0015622 3300044735 Bacteria 3012
456 Ga0466968_0653972 3300044735 Bacteria 534
457 Ga0466970_0189969 3300044765 Bacteria 1141
458 Ga0466970_0223888 3300044765 Bacteria 1050
459 Ga0466957_0106615 3300044842 Bacteria 1773
460 Ga0466957_0340807 3300044842 Bacteria 1015
461 Ga0466957_0487690 3300044842 Bacteria 853
462 Ga0466957_0562358 3300044842 Bacteria 795
463 Ga0466960_0756336 3300044901 Bacteria 586
464 Ga0466959_0009015 3300045049 Bacteria 7075
465 Ga0466959_0101180 3300045049 Bacteria 2063
466 Ga0466959_0199798 3300045049 Bacteria 1392
467 Ga0466959_0286203 3300045049 Bacteria 1130
468 Ga0466959_0722936 3300045049 Bacteria 667
469 Ga0466958_0062153 3300045836 Bacteria 2276
470 Ga0466958_0179435 3300045836 Bacteria 1343
471 Ga0466958_0650196 3300045836 Bacteria 686
472 Ga0466967_0005846 3300045976 Bacteria 8607
473 Ga0466967_0006284 3300045976 Bacteria 8380
474 Ga0466967_0018080 3300045976 Bacteria 5623
475 Ga0466967_0048083 3300045976 Bacteria 3723
476 Ga0466967_0075125 3300045976 Bacteria 3037
477 Ga0466967_0088756 3300045976 Bacteria 2806
478 Ga0466967_0112904 3300045976 Bacteria 2499
479 Ga0466967_0114331 3300045976 Bacteria 2484
480 Ga0466967_0114427 3300045976 Bacteria 2483
481 Ga0466967_0178941 3300045976 Bacteria 1999
482 Ga0466967_0215476 3300045976 Bacteria 1822
483 Ga0466967_0387149 3300045976 Bacteria 1358
484 Ga0466967_0490601 3300045976 Bacteria 1204
485 Ga0466967_0529334 3300045976 Bacteria 1159
486 Ga0466967_0558042 3300045976 Archaea 1128
487 Ga0466967_0610262 3300045976 Bacteria 1077
488 Ga0466967_0625919 3300045976 Bacteria 1063
489 Ga0466967_0631097 3300045976 Unclassified 1059
490 Ga0466967_0733273 3300045976 Unclassified 980
491 Ga0466967_0790312 3300045976 Bacteria 942
492 Ga0466967_0849445 3300045976 Bacteria 907
493 Ga0466967_0947326 3300045976 Bacteria 857
494 Ga0466967_0974087 3300045976 Bacteria 844
495 Ga0466967_1128168 3300045976 Bacteria 781
496 Ga0495603_0097150 3300046455 Bacteria 1721
497 Ga0495603_0187160 3300046455 Bacteria 1197
498 Ga0495603_0189117 3300046455 Unclassified 1190
499 Ga0495641_0024564 3300046461 Bacteria 2973
500 Ga0495641_0114789 3300046461 Bacteria 1201
501 Ga0495641_0118566 3300046461 Bacteria 1180
502 Ga0495653_0223428 3300046463 Bacteria 1265
503 Ga0495580_0201644 3300046472 Bacteria 1370
504 Ga0495582_0042237 3300046473 Bacteria 2512
505 Ga0495582_0125183 3300046473 Unclassified 1450
506 Ga0495582_0170654 3300046473 Bacteria 1238
507 Ga0495582_0237450 3300046473 Bacteria 1044
508 Ga0495639_0244442 3300046475 Bacteria 886
509 Ga0495639_0421677 3300046475 Unclassified 676
510 Ga0495584_0646709 3300046491 Bacteria 539
511 Ga0495594_0153577 3300046499 Bacteria 1307
512 Ga0495608_0216221 3300046511 Bacteria 1204
513 Ga0495630_0143360 3300046517 Bacteria 1816
514 Ga0495630_0160665 3300046517 Bacteria 1711
515 Ga0495630_0202847 3300046517 Bacteria 1513
516 Ga0495630_1081795 3300046517 Bacteria 608
517 Ga0495640_0256980 3300046533 Bacteria 1092
518 Ga0495586_0006168 3300046535 Bacteria 6409
519 Ga0495586_0121463 3300046535 Unclassified 1460
520 Ga0495587_0110294 3300046536 Bacteria 1581
521 Ga0495587_0216860 3300046536 Bacteria 1080
522 Ga0495667_0376677 3300046559 Bacteria 895
523 Ga0495656_0673042 3300046615 Bacteria 556
524 Ga0495634_0117263 3300046642 Bacteria 1707
525 Ga0495634_0489784 3300046642 Bacteria 722
526 Ga0495588_0066979 3300046674 Bacteria 1864
527 Ga0495646_0507906 3300046680 Unclassified 618
528 Ga0495647_0075764 3300046681 Bacteria 1355
529 Ga0495658_0030986 3300046683 Bacteria 2909
530 Ga0495658_0273735 3300046683 Unclassified 1065
531 Ga0495670_0836024 3300046691 Unclassified 503
532 Ga0495649_0423914 3300046694 Bacteria 666
533 Ga0495581_0751410 3300047315 Bacteria 561
534 Ga0495604_0774357 3300047317 Bacteria 606
535 Ga0495674_0126270 3300047319 Bacteria 2158
536 Ga0495674_0237914 3300047319 Bacteria 1501
537 Ga0495674_0359859 3300047319 Bacteria 1180
538 Ga0495676_0154000 3300047321 Unclassified 1633
539 Ga0495676_0329227 3300047321 Unclassified 1025
540 Ga0495676_0700229 3300047321 Bacteria 655
541 Ga0495680_0864477 3300047322 Bacteria 587
542 Ga0495593_0072214 3300047673 Bacteria 1792
543 Ga0496100_0017728 3300048903 Bacteria 4210
544 Ga0496100_0028950 3300048903 Bacteria 3421
545 Ga0496100_0030673 3300048903 Bacteria 3336
546 Ga0496100_0566871 3300048903 Bacteria 880
547 Ga0496100_1020944 3300048903 Bacteria 651
548 Ga0496101_0000692 3300048904 Bacteria 20340
549 Ga0496101_0049101 3300048904 Bacteria 3034
550 Ga0496101_0140299 3300048904 Bacteria 1841
551 Ga0496101_0152153 3300048904 Bacteria 1770
552 Ga0496101_0746118 3300048904 Bacteria 772
553 Ga0496102_0005991 3300048905 Bacteria 10353
554 Ga0496102_0053045 3300048905 Bacteria 3696
555 Ga0496102_0335135 3300048905 Bacteria 1425
556 Ga0496102_0960865 3300048905 Bacteria 775
557 Ga0496103_0011503 3300048906 Bacteria 5244
558 Ga0496103_0196712 3300048906 Bacteria 1296
559 Ga0496103_0199074 3300048906 Bacteria 1288
560 Ga0496103_0449315 3300048906 Bacteria 827
561 Ga0496104_0002218 3300048907 Bacteria 16788
562 Ga0496104_0011990 3300048907 Bacteria 7776
563 Ga0496104_0038000 3300048907 Bacteria 4502
564 Ga0496104_0303474 3300048907 Bacteria 1509
565 Ga0496104_0447155 3300048907 Unclassified 1204
566 Ga0496104_0813858 3300048907 Bacteria 840
567 Ga0496105_0002671 3300048908 Bacteria 12983
568 Ga0496105_0014914 3300048908 Bacteria 6186
569 Ga0496105_0025956 3300048908 Bacteria 4774
570 Ga0496106_0003662 3300048909 Bacteria 11458
571 Ga0496106_0003900 3300048909 Bacteria 11133
572 Ga0496106_0026843 3300048909 Bacteria 4288
573 Ga0496106_0047654 3300048909 Bacteria 3226
574 Ga0496106_0372413 3300048909 Bacteria 1148
575 Ga0496107_0016367 3300048910 Bacteria 5204
576 Ga0496107_0102525 3300048910 Bacteria 2098
577 Ga0496107_0222140 3300048910 Bacteria 1405
578 Ga0496107_0263535 3300048910 Bacteria 1282
579 Ga0496107_0343101 3300048910 Bacteria 1111
580 Ga0496107_0358709 3300048910 Bacteria 1085
581 Ga0496107_0950971 3300048910 Bacteria 625
582 Ga0496108_0006069 3300048911 Bacteria 9769
583 Ga0496108_0057187 3300048911 Bacteria 3277
584 Ga0496108_0180373 3300048911 Bacteria 1828
585 Ga0496108_0275534 3300048911 Bacteria 1465
586 Ga0496108_0451628 3300048911 Bacteria 1123
587 Ga0496108_0640216 3300048911 Bacteria 925
588 Ga0496108_1472549 3300048911 Bacteria 567
589 Ga0496109_0002789 3300048912 Bacteria 14634
590 Ga0496109_0022559 3300048912 Bacteria 5577
591 Ga0496109_0024902 3300048912 Bacteria 5327
592 Ga0496109_0165720 3300048912 Bacteria 2071
593 Ga0496109_0264127 3300048912 Bacteria 1621
594 Ga0496109_0997186 3300048912 Bacteria 775
595 Ga0496110_0004178 3300048913 Bacteria 11153
596 Ga0496110_0066822 3300048913 Bacteria 3180
597 Ga0496111_0010710 3300048914 Bacteria 6167
598 Ga0496111_0033409 3300048914 Bacteria 3669
599 Ga0496111_0150008 3300048914 Bacteria 1729
600 Ga0496111_0179718 3300048914 Bacteria 1573
601 Ga0496111_0284008 3300048914 Bacteria 1228
602 Ga0496111_0921586 3300048914 Bacteria 629
603 Ga0496112_0198220 3300048915 Bacteria 1968
604 Ga0496112_0298617 3300048915 Bacteria 1556
605 Ga0496112_0329180 3300048915 Bacteria 1472
606 Ga0496112_0446110 3300048915 Bacteria 1232
607 Ga0496112_0584436 3300048915 Bacteria 1049
608 Ga0496112_0818046 3300048915 Bacteria 856
609 Ga0496112_1102233 3300048915 Bacteria 712
610 Ga0496112_1638728 3300048915 Bacteria 556
611 Ga0496112_1692982 3300048915 Bacteria 545
612 Ga0496113_0026347 3300048916 Bacteria 4156
613 Ga0496113_0071185 3300048916 Bacteria 2645
614 Ga0496113_0324999 3300048916 Bacteria 1233
615 Ga0496113_0359706 3300048916 Bacteria 1168
616 Ga0496114_0002457 3300048917 Bacteria 14154
617 Ga0496114_0008736 3300048917 Bacteria 8027
618 Ga0496114_0229566 3300048917 Bacteria 1630
619 Ga0496114_0258633 3300048917 Bacteria 1532
620 Ga0496114_0282877 3300048917 Bacteria 1462
621 Ga0496114_0618246 3300048917 Unclassified 954
622 Ga0496114_0685957 3300048917 Bacteria 899
623 Ga0496115_0005151 3300048918 Bacteria 9511
624 Ga0496115_0108794 3300048918 Bacteria 2276
625 Ga0496115_0224670 3300048918 Bacteria 1549
626 Ga0501031_0344451 3300049568 Bacteria 965
627 Ga0501032_0242821 3300049569 Bacteria 1170
628 Ga0501033_1052515 3300049570 Bacteria 542
629 Ga0501034_0321166 3300049571 Bacteria 1481
630 Ga0501036_0356252 3300049572 Bacteria 1222
631 Ga0501036_0547212 3300049572 Bacteria 962
632 Ga0501036_1398409 3300049572 Bacteria 567
633 Ga0501039_0941766 3300049575 Bacteria 672
634 Ga0501039_1042575 3300049575 Bacteria 635
635 Ga0501039_1249633 3300049575 Bacteria 574
636 Ga0501040_0131703 3300049576 Bacteria 1759
637 Ga0501041_0214980 3300049577 Bacteria 1206
638 Ga0501041_0562229 3300049577 Bacteria 727
639 Ga0501046_0848257 3300049580 Bacteria 639
640 Ga0501047_0061170 3300049581 Bacteria 3634
641 Ga0501047_0219398 3300049581 Bacteria 1758
642 Ga0501047_0696142 3300049581 Bacteria 834
643 Ga0501048_0242298 3300049582 Bacteria 1280
644 Ga0501048_1066701 3300049582 Bacteria 581
645 Ga0501048_1373482 3300049582 Bacteria 508
646 Ga0501067_0000163 3300049583 Bacteria 37467
647 Ga0501067_0080425 3300049583 Unclassified 1806
648 Ga0501068_0082316 3300049584 Bacteria 1977
649 Ga0501069_0003809 3300049585 Bacteria 7759
650 Ga0501069_0129026 3300049585 Unclassified 1447
651 Ga0501069_0325813 3300049585 Bacteria 903
652 Ga0501069_0647349 3300049585 Bacteria 636
653 Ga0501070_0003032 3300049586 Bacteria 14629
654 Ga0501070_0067716 3300049586 Bacteria 2957
655 Ga0501070_0310143 3300049586 Bacteria 1284
656 Ga0501070_0323861 3300049586 Bacteria 1253
657 Ga0501070_0396149 3300049586 Bacteria 1117
658 Ga0501070_0883218 3300049586 Unclassified 698
659 Ga0501071_0128485 3300049587 Bacteria 1882
660 Ga0501071_0268424 3300049587 Bacteria 1290
661 Ga0501072_0307219 3300049588 Bacteria 1261
662 Ga0501072_0391156 3300049588 Bacteria 1103
663 Ga0501073_0739985 3300049589 Bacteria 678
664 Ga0501073_1126670 3300049589 Bacteria 539
665 Ga0501074_0012591 3300049590 Bacteria 6149
666 Ga0501074_0200257 3300049590 Bacteria 1423
667 Ga0501075_0179876 3300049591 Bacteria 1614
668 Ga0501075_0185043 3300049591 Bacteria 1589
669 Ga0501075_0190546 3300049591 Bacteria 1564
670 Ga0501075_0595823 3300049591 Bacteria 843
671 Ga0501075_1475497 3300049591 Unclassified 515
672 Ga0501076_0636894 3300049592 Bacteria 880
673 Ga0501076_1797433 3300049592 Bacteria 502
674 Ga0501077_0057161 3300049593 Bacteria 2477
675 Ga0501077_0261169 3300049593 Bacteria 1101
676 Ga0501077_0373892 3300049593 Bacteria 910
677 Ga0501257_217013 3300049686 Unclassified 556
678 Ga0501079_0178201 3300049741 Bacteria 1658
679 Ga0501079_0386254 3300049741 Bacteria 1098
680 Ga0501079_0918928 3300049741 Bacteria 689
681 Ga0501079_1580998 3300049741 Unclassified 516
682 Ga0501080_0186373 3300049742 Bacteria 1908
683 Ga0501080_0248406 3300049742 Bacteria 1622
684 Ga0501080_0261699 3300049742 Unclassified 1576
685 Ga0501080_0497086 3300049742 Bacteria 1090
686 Ga0501081_0147649 3300049743 Bacteria 1688
687 Ga0501081_0332671 3300049743 Unclassified 1118
688 Ga0501081_0903815 3300049743 Bacteria 666
689 Ga0501081_1177611 3300049743 Bacteria 580
690 Ga0501083_0217934 3300049744 Bacteria 1244
691 Ga0501275_079780 3300049772 Unclassified 529
692 Ga0501044_0588971 3300049823 Unclassified 1006
693 nmdc:mga05p37_1933563_c1 3300050507 Bacteria 562
694 nmdc:mga0n895_892_c1 3300050512 Bacteria 21498
695 nmdc:mga0rr50_11460_c1 3300050513 Bacteria 5678
696 nmdc:mga0rr50_1340870_c1 3300050513 Bacteria 606
697 nmdc:mga0rr50_1766530_c1 3300050513 Unclassified 521
698 nmdc:mga0rr50_442247_c1 3300050513 Bacteria 1101
699 nmdc:mga08x19_292384_c1 3300050514 Bacteria 1130
700 nmdc:mga08x19_633109_c1 3300050514 Bacteria 758
701 nmdc:mga08x19_784147_c1 3300050514 Bacteria 677
702 nmdc:mga0a205_249680_c1 3300050515 Bacteria 1654
703 nmdc:mga0a205_28719_c1 3300050515 Bacteria 5319
704 Ga0495612_0120485 3300053078 Unclassified 1128
705 Ga0495612_0180125 3300053078 Bacteria 928
706 Ga0495595_0403410 3300053084 Bacteria 693
707 Ga0501084_0373600 3300054114 Bacteria 1205
708 Ga0501084_0444499 3300054114 Bacteria 1096
709 Ga0501084_0647747 3300054114 Bacteria 892
710 Ga0587070_168066 3300059491 Bacteria 562
711 Ga0587073_0203421 3300059492 Bacteria 595
712 Ga0587083_0217381 3300059505 Bacteria 554
713 Ga0587083_0244555 3300059505 Bacteria 532
714 Ga0587115_082845 3300059626 Bacteria 571
715 Ga0587115_115216 3300059626 Bacteria 512
716 Ga0587075_003998 3300059644 Bacteria 1687
717 Ga0501082_0116044 3300060353 Bacteria 2319
718 Ga0501082_1798094 3300060353 Bacteria 534
719 Ga0466962_0014187 3300061719 Bacteria 3838
720 Ga0466962_0023570 3300061719 Bacteria 2958
721 Ga0530510_0314571 3300061734 Bacteria 1173
722 Ga0530510_0952596 3300061734 Bacteria 656
723 Ga0530510_0970792 3300061734 Bacteria 650

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300012483 Ga0157337_1026718 Ga0157337_10267181 86
2 3300059505 Ga0587083_0217381 Ga0587083_0217381_226_516 96
3 3300005330 Ga0070690_100069365 Ga0070690_1000693653 98
4 3300005330 Ga0070690_100166404 Ga0070690_1001664042 98
5 3300005334 Ga0068869_100130555 Ga0068869_1001305553 98
6 3300005336 Ga0070680_100038117 Ga0070680_1000381174 98
7 3300005337 Ga0070682_100012408 Ga0070682_1000124084 98
8 3300005338 Ga0068868_100061984 Ga0068868_1000619842 98
9 3300005338 Ga0068868_100476343 Ga0068868_1004763431 98
10 3300005339 Ga0070660_100351431 Ga0070660_1003514312 98
11 3300005340 Ga0070689_100075774 Ga0070689_1000757742 98
12 3300005345 Ga0070692_10009738 Ga0070692_100097385 98
13 3300005355 Ga0070671_100879510 Ga0070671_1008795102 98
14 3300005356 Ga0070674_100182410 Ga0070674_1001824103 98
15 3300005356 Ga0070674_100272683 Ga0070674_1002726831 98
16 3300005364 Ga0070673_101009370 Ga0070673_1010093702 98
17 3300005365 Ga0070688_100051117 Ga0070688_1000511172 98
18 3300005366 Ga0070659_100158972 Ga0070659_1001589722 98
19 3300005367 Ga0070667_100055300 Ga0070667_1000553003 98
20 3300005367 Ga0070667_100514446 Ga0070667_1005144462 98
21 3300005436 Ga0070713_100200477 Ga0070713_1002004774 98
22 3300005438 Ga0070701_10174934 Ga0070701_101749343 98
23 3300005439 Ga0070711_100042752 Ga0070711_1000427522 98
24 3300005439 Ga0070711_101576723 Ga0070711_1015767231 98
25 3300005440 Ga0070705_100095823 Ga0070705_1000958231 98
26 3300005440 Ga0070705_100121261 Ga0070705_1001212615 98
27 3300005441 Ga0070700_100249364 Ga0070700_1002493642 98
28 3300005444 Ga0070694_100055019 Ga0070694_1000550192 98
29 3300005445 Ga0070708_101033397 Ga0070708_1010333971 98
30 3300005455 Ga0070663_100640697 Ga0070663_1006406972 98
31 3300005455 Ga0070663_100733596 Ga0070663_1007335962 98
32 3300005456 Ga0070678_100008202 Ga0070678_1000082027 98
33 3300005459 Ga0068867_100080687 Ga0068867_1000806875 98
34 3300005466 Ga0070685_10335328 Ga0070685_103353282 98
35 3300005466 Ga0070685_10380813 Ga0070685_103808132 98
36 3300005467 Ga0070706_100686813 Ga0070706_1006868132 98
37 3300005518 Ga0070699_100181915 Ga0070699_1001819152 98
38 3300005518 Ga0070699_100471394 Ga0070699_1004713942 98
39 3300005530 Ga0070679_100057784 Ga0070679_1000577843 98
40 3300005535 Ga0070684_100061807 Ga0070684_1000618075 98
41 3300005535 Ga0070684_100902244 Ga0070684_1009022442 98
42 3300005536 Ga0070697_100672856 Ga0070697_1006728561 98
43 3300005539 Ga0068853_102170324 Ga0068853_1021703242 98
44 3300005544 Ga0070686_100053965 Ga0070686_1000539655 98
45 3300005545 Ga0070695_100529849 Ga0070695_1005298493 98
46 3300005546 Ga0070696_100041484 Ga0070696_1000414844 98
47 3300005546 Ga0070696_101897979 Ga0070696_1018979791 98
48 3300005547 Ga0070693_100005617 Ga0070693_1000056171 98
49 3300005547 Ga0070693_100206652 Ga0070693_1002066522 98
50 3300005548 Ga0070665_100314565 Ga0070665_1003145652 98
51 3300005549 Ga0070704_100488166 Ga0070704_1004881662 98
52 3300005549 Ga0070704_100553092 Ga0070704_1005530922 98
53 3300005563 Ga0068855_100555096 Ga0068855_1005550963 98
54 3300005564 Ga0070664_100179626 Ga0070664_1001796263 98
55 3300005577 Ga0068857_100327735 Ga0068857_1003277352 98
56 3300005577 Ga0068857_100364879 Ga0068857_1003648793 98
57 3300005578 Ga0068854_100200137 Ga0068854_1002001372 98
58 3300005614 Ga0068856_100091442 Ga0068856_1000914424 98
59 3300005614 Ga0068856_101554709 Ga0068856_1015547092 98
60 3300005615 Ga0070702_100033934 Ga0070702_1000339345 98
61 3300005615 Ga0070702_100060507 Ga0070702_1000605072 98
62 3300005616 Ga0068852_100186384 Ga0068852_1001863843 98
63 3300005617 Ga0068859_101418953 Ga0068859_1014189532 98
64 3300005618 Ga0068864_101298219 Ga0068864_1012982192 98
65 3300005718 Ga0068866_10088089 Ga0068866_100880891 98
66 3300005718 Ga0068866_10488061 Ga0068866_104880613 98
67 3300005840 Ga0068870_10801653 Ga0068870_108016532 98
68 3300005842 Ga0068858_100016243 Ga0068858_1000162436 98
69 3300005842 Ga0068858_100031994 Ga0068858_1000319945 98
70 3300005842 Ga0068858_102458821 Ga0068858_1024588211 98
71 3300005843 Ga0068860_100020071 Ga0068860_1000200719 98
72 3300006163 Ga0070715_10014322 Ga0070715_100143225 98
73 3300006163 Ga0070715_10256955 Ga0070715_102569552 98
74 3300006173 Ga0070716_100572563 Ga0070716_1005725631 98
75 3300006237 Ga0097621_100010903 Ga0097621_1000109033 98
76 3300006237 Ga0097621_100130048 Ga0097621_1001300484 98
77 3300006358 Ga0068871_100052258 Ga0068871_1000522583 98
78 3300006358 Ga0068871_100127541 Ga0068871_1001275412 98
79 3300006358 Ga0068871_101182205 Ga0068871_1011822052 98
80 3300006852 Ga0075433_10077960 Ga0075433_100779602 98
81 3300006871 Ga0075434_100052014 Ga0075434_1000520145 98
82 3300006881 Ga0068865_100014192 Ga0068865_1000141925 98
83 3300006881 Ga0068865_100234368 Ga0068865_1002343683 98
84 3300006914 Ga0075436_100171437 Ga0075436_1001714372 98
85 3300006931 Ga0097620_101418885 Ga0097620_1014188852 98
86 3300007076 Ga0075435_100194889 Ga0075435_1001948893 98
87 3300009093 Ga0105240_11572672 Ga0105240_115726722 98
88 3300009094 Ga0111539_10814118 Ga0111539_108141181 98
89 3300009098 Ga0105245_10015320 Ga0105245_100153206 98
90 3300009098 Ga0105245_10224157 Ga0105245_102241572 98
91 3300009098 Ga0105245_10936573 Ga0105245_109365732 98
92 3300009101 Ga0105247_10052990 Ga0105247_100529902 98
93 3300009101 Ga0105247_10304565 Ga0105247_103045653 98
94 3300009148 Ga0105243_10047355 Ga0105243_100473554 98
95 3300009148 Ga0105243_10267127 Ga0105243_102671272 98
96 3300009148 Ga0105243_10658793 Ga0105243_106587932 98
97 3300009148 Ga0105243_11227939 Ga0105243_112279392 98
98 3300009174 Ga0105241_10060149 Ga0105241_100601493 98
99 3300009174 Ga0105241_10084415 Ga0105241_100844153 98
100 3300009176 Ga0105242_10132083 Ga0105242_101320834 98
101 3300009176 Ga0105242_10139756 Ga0105242_101397561 98
102 3300009176 Ga0105242_10531565 Ga0105242_105315652 98
103 3300009177 Ga0105248_10291615 Ga0105248_102916153 98
104 3300009177 Ga0105248_10392689 Ga0105248_103926893 98
105 3300009545 Ga0105237_10250546 Ga0105237_102505464 98
106 3300009545 Ga0105237_11083411 Ga0105237_110834112 98
107 3300009551 Ga0105238_10031640 Ga0105238_100316403 98
108 3300009553 Ga0105249_10197315 Ga0105249_101973154 98
109 3300009553 Ga0105249_11694934 Ga0105249_116949342 98
110 3300010375 Ga0105239_10021168 Ga0105239_100211683 98
111 3300010375 Ga0105239_13164434 Ga0105239_131644342 98
112 3300011119 Ga0105246_10095445 Ga0105246_100954454 98
113 3300011119 Ga0105246_11270223 Ga0105246_112702232 98
114 3300011119 Ga0105246_12551739 Ga0105246_125517392 98
115 3300013296 Ga0157374_10021270 Ga0157374_100212706 98
116 3300013297 Ga0157378_10028470 Ga0157378_100284708 98
117 3300013297 Ga0157378_12674430 Ga0157378_126744301 98
118 3300013307 Ga0157372_10185482 Ga0157372_101854823 98
119 3300013308 Ga0157375_10541034 Ga0157375_105410343 98
120 3300013308 Ga0157375_11423138 Ga0157375_114231381 98
121 3300013308 Ga0157375_11945663 Ga0157375_119456632 98
122 3300014325 Ga0163163_11318267 Ga0163163_113182672 98
123 3300014326 Ga0157380_10426993 Ga0157380_104269932 98
124 3300014326 Ga0157380_12794223 Ga0157380_127942231 98
125 3300014968 Ga0157379_10133885 Ga0157379_101338853 98
126 3300014969 Ga0157376_10229361 Ga0157376_102293612 98
127 3300014969 Ga0157376_10597358 Ga0157376_105973582 98
128 3300014969 Ga0157376_11149807 Ga0157376_111498072 98
129 3300014969 Ga0157376_12100000 Ga0157376_121000002 98
130 3300017792 Ga0163161_10201118 Ga0163161_102011182 98
131 3300017792 Ga0163161_10505719 Ga0163161_105057193 98
132 3300020069 Ga0197907_11110821 Ga0197907_111108211 98
133 3300020070 Ga0206356_11478649 Ga0206356_114786492 98
134 3300020076 Ga0206355_1251211 Ga0206355_12512112 98
135 3300020081 Ga0206354_10412236 Ga0206354_104122362 98
136 3300025899 Ga0207642_10519908 Ga0207642_105199081 98
137 3300025900 Ga0207710_10164818 Ga0207710_101648182 98
138 3300025900 Ga0207710_10168932 Ga0207710_101689322 98
139 3300025901 Ga0207688_10056833 Ga0207688_100568334 98
140 3300025903 Ga0207680_10213416 Ga0207680_102134163 98
141 3300025904 Ga0207647_10291542 Ga0207647_102915422 98
142 3300025905 Ga0207685_10011554 Ga0207685_100115545 98
143 3300025905 Ga0207685_10155657 Ga0207685_101556572 98
144 3300025908 Ga0207643_10356051 Ga0207643_103560512 98
145 3300025910 Ga0207684_10955404 Ga0207684_109554043 98
146 3300025911 Ga0207654_10238293 Ga0207654_102382932 98
147 3300025914 Ga0207671_11368290 Ga0207671_113682902 98
148 3300025916 Ga0207663_10066038 Ga0207663_100660383 98
149 3300025916 Ga0207663_10386863 Ga0207663_103868633 98
150 3300025921 Ga0207652_11156007 Ga0207652_111560072 98
151 3300025924 Ga0207694_10255449 Ga0207694_102554491 98
152 3300025927 Ga0207687_10033171 Ga0207687_100331712 98
153 3300025927 Ga0207687_10238094 Ga0207687_102380943 98
154 3300025927 Ga0207687_10620651 Ga0207687_106206511 98
155 3300025931 Ga0207644_10802325 Ga0207644_108023252 98
156 3300025932 Ga0207690_10098751 Ga0207690_100987512 98
157 3300025933 Ga0207706_10266441 Ga0207706_102664413 98
158 3300025934 Ga0207686_10027445 Ga0207686_100274453 98
159 3300025934 Ga0207686_10047765 Ga0207686_100477652 98
160 3300025934 Ga0207686_11763859 Ga0207686_117638592 98
161 3300025935 Ga0207709_10017610 Ga0207709_100176105 98
162 3300025935 Ga0207709_10167895 Ga0207709_101678953 98
163 3300025935 Ga0207709_10712520 Ga0207709_107125202 98
164 3300025935 Ga0207709_10991680 Ga0207709_109916802 98
165 3300025937 Ga0207669_10040730 Ga0207669_100407305 98
166 3300025938 Ga0207704_10202833 Ga0207704_102028331 98
167 3300025938 Ga0207704_10230971 Ga0207704_102309714 98
168 3300025938 Ga0207704_10331760 Ga0207704_103317603 98
169 3300025939 Ga0207665_10138286 Ga0207665_101382862 98
170 3300025941 Ga0207711_10142535 Ga0207711_101425352 98
171 3300025944 Ga0207661_11693779 Ga0207661_116937792 98
172 3300025945 Ga0207679_10234865 Ga0207679_102348653 98
173 3300025949 Ga0207667_10962024 Ga0207667_109620242 98
174 3300025960 Ga0207651_10781922 Ga0207651_107819222 98
175 3300025960 Ga0207651_10988283 Ga0207651_109882832 98
176 3300025961 Ga0207712_10926934 Ga0207712_109269342 98
177 3300025981 Ga0207640_10038906 Ga0207640_100389063 98
178 3300025981 Ga0207640_11636438 Ga0207640_116364381 98
179 3300025986 Ga0207658_10105364 Ga0207658_101053644 98
180 3300025986 Ga0207658_11822664 Ga0207658_118226641 98
181 3300026023 Ga0207677_11279497 Ga0207677_112794971 98
182 3300026035 Ga0207703_10264621 Ga0207703_102646212 98
183 3300026035 Ga0207703_10411685 Ga0207703_104116852 98
184 3300026041 Ga0207639_12289086 Ga0207639_122890861 98
185 3300026067 Ga0207678_10097724 Ga0207678_100977245 98
186 3300026067 Ga0207678_10523298 Ga0207678_105232982 98
187 3300026075 Ga0207708_10004026 Ga0207708_1000402610 98
188 3300026075 Ga0207708_10687931 Ga0207708_106879311 98
189 3300026078 Ga0207702_10107003 Ga0207702_101070034 98
190 3300026089 Ga0207648_10129610 Ga0207648_101296104 98
191 3300026095 Ga0207676_11131269 Ga0207676_111312692 98
192 3300026116 Ga0207674_10446681 Ga0207674_104466812 98
193 3300026121 Ga0207683_10000876 Ga0207683_1000087611 98
194 3300026142 Ga0207698_11419273 Ga0207698_114192731 98
195 3300026142 Ga0207698_11754108 Ga0207698_117541082 98
196 3300028381 Ga0268264_10050649 Ga0268264_100506495 98
197 3300028563 Ga0265319_1028375 Ga0265319_10283753 98
198 3300028563 Ga0265319_1054231 Ga0265319_10542312 98
199 3300028577 Ga0265318_10173648 Ga0265318_101736482 98
200 3300028800 Ga0265338_10327795 Ga0265338_103277953 98
201 3300031240 Ga0265320_10009779 Ga0265320_100097796 98
202 3300031240 Ga0265320_10016252 Ga0265320_100162525 98
203 3300031251 Ga0265327_10057127 Ga0265327_100571273 98
204 3300035089 Ga0373944_0126481 Ga0373944_0126481_378_674 98
205 3300035170 Ga0373943_0544967 Ga0373943_0544967_43_339 98
206 3300035170 Ga0373943_0799242 Ga0373943_0799242_109_414 98
207 3300035691 Ga0373931_0381312 Ga0373931_0381312_307_612 98
208 3300035695 Ga0373927_0223428 Ga0373927_0223428_803_1099 98
209 3300035725 Ga0373947_0326136 Ga0373947_0326136_667_963 98
210 3300037068 Ga0373925_0446395 Ga0373925_0446395_73_375 98
211 3300037068 Ga0373925_0498867 Ga0373925_0498867_404_700 98
212 3300037068 Ga0373925_1403180 Ga0373925_1403180_132_428 98
213 3300044735 Ga0466968_0653972 Ga0466968_0653972_108_404 98
214 3300045976 Ga0466967_0790312 Ga0466967_0790312_456_752 98
215 3300046455 Ga0495603_0097150 Ga0495603_0097150_368_664 98
216 3300046455 Ga0495603_0187160 Ga0495603_0187160_570_866 98
217 3300046455 Ga0495603_0189117 Ga0495603_0189117_799_1104 98
218 3300046461 Ga0495641_0024564 Ga0495641_0024564_1672_1977 98
219 3300046473 Ga0495582_0042237 Ga0495582_0042237_1657_1953 98
220 3300046473 Ga0495582_0125183 Ga0495582_0125183_1085_1390 98
221 3300046475 Ga0495639_0421677 Ga0495639_0421677_38_343 98
222 3300046491 Ga0495584_0646709 Ga0495584_0646709_121_417 98
223 3300046499 Ga0495594_0153577 Ga0495594_0153577_889_1185 98
224 3300046517 Ga0495630_1081795 Ga0495630_1081795_48_344 98
225 3300046674 Ga0495588_0066979 Ga0495588_0066979_1071_1367 98
226 3300046683 Ga0495658_0030986 Ga0495658_0030986_2041_2337 98
227 3300046683 Ga0495658_0273735 Ga0495658_0273735_679_984 98
228 3300046691 Ga0495670_0836024 Ga0495670_0836024_73_369 98
229 3300047315 Ga0495581_0751410 Ga0495581_0751410_198_494 98
230 3300047321 Ga0495676_0154000 Ga0495676_0154000_225_521 98
231 3300047321 Ga0495676_0329227 Ga0495676_0329227_683_988 98
232 3300048903 Ga0496100_0017728 Ga0496100_0017728_3828_4136 98
233 3300048903 Ga0496100_0028950 Ga0496100_0028950_1080_1376 98
234 3300048903 Ga0496100_0566871 Ga0496100_0566871_377_673 98
235 3300048903 Ga0496100_1020944 Ga0496100_1020944_325_621 98
236 3300048904 Ga0496101_0000692 Ga0496101_0000692_12995_13291 98
237 3300048904 Ga0496101_0049101 Ga0496101_0049101_1350_1658 98
238 3300048904 Ga0496101_0152153 Ga0496101_0152153_351_647 98
239 3300048904 Ga0496101_0746118 Ga0496101_0746118_204_500 98
240 3300048905 Ga0496102_0053045 Ga0496102_0053045_2158_2454 98
241 3300048905 Ga0496102_0335135 Ga0496102_0335135_842_1138 98
242 3300048905 Ga0496102_0960865 Ga0496102_0960865_380_676 98
243 3300048906 Ga0496103_0011503 Ga0496103_0011503_1295_1591 98
244 3300048906 Ga0496103_0196712 Ga0496103_0196712_742_1038 98
245 3300048906 Ga0496103_0449315 Ga0496103_0449315_286_594 98
246 3300048907 Ga0496104_0002218 Ga0496104_0002218_14265_14561 98
247 3300048907 Ga0496104_0038000 Ga0496104_0038000_257_553 98
248 3300048907 Ga0496104_0303474 Ga0496104_0303474_430_726 98
249 3300048907 Ga0496104_0447155 Ga0496104_0447155_44_340 98
250 3300048908 Ga0496105_0014914 Ga0496105_0014914_1842_2138 98
251 3300048908 Ga0496105_0025956 Ga0496105_0025956_3120_3416 98
252 3300048909 Ga0496106_0003900 Ga0496106_0003900_7881_8177 98
253 3300048909 Ga0496106_0026843 Ga0496106_0026843_2322_2630 98
254 3300048909 Ga0496106_0047654 Ga0496106_0047654_2499_2795 98
255 3300048909 Ga0496106_0372413 Ga0496106_0372413_688_984 98
256 3300048910 Ga0496107_0016367 Ga0496107_0016367_2837_3133 98
257 3300048910 Ga0496107_0222140 Ga0496107_0222140_1086_1382 98
258 3300048910 Ga0496107_0263535 Ga0496107_0263535_481_789 98
259 3300048910 Ga0496107_0343101 Ga0496107_0343101_727_1023 98
260 3300048910 Ga0496107_0358709 Ga0496107_0358709_80_376 98
261 3300048910 Ga0496107_0950971 Ga0496107_0950971_309_611 98
262 3300048911 Ga0496108_0057187 Ga0496108_0057187_1982_2290 98
263 3300048911 Ga0496108_0180373 Ga0496108_0180373_1511_1807 98
264 3300048911 Ga0496108_0275534 Ga0496108_0275534_580_882 98
265 3300048911 Ga0496108_0451628 Ga0496108_0451628_35_331 98
266 3300048911 Ga0496108_1472549 Ga0496108_1472549_146_442 98
267 3300048912 Ga0496109_0022559 Ga0496109_0022559_617_925 98
268 3300048912 Ga0496109_0024902 Ga0496109_0024902_3752_4048 98
269 3300048912 Ga0496109_0165720 Ga0496109_0165720_916_1218 98
270 3300048912 Ga0496109_0264127 Ga0496109_0264127_367_663 98
271 3300048912 Ga0496109_0997186 Ga0496109_0997186_23_319 98
272 3300048913 Ga0496110_0066822 Ga0496110_0066822_721_1029 98
273 3300048914 Ga0496111_0010710 Ga0496111_0010710_1086_1382 98
274 3300048914 Ga0496111_0150008 Ga0496111_0150008_780_1082 98
275 3300048914 Ga0496111_0284008 Ga0496111_0284008_349_657 98
276 3300048915 Ga0496112_0198220 Ga0496112_0198220_1277_1573 98
277 3300048915 Ga0496112_0298617 Ga0496112_0298617_196_498 98
278 3300048915 Ga0496112_0329180 Ga0496112_0329180_181_477 98
279 3300048915 Ga0496112_0818046 Ga0496112_0818046_242_538 98
280 3300048915 Ga0496112_1102233 Ga0496112_1102233_365_673 98
281 3300048915 Ga0496112_1638728 Ga0496112_1638728_156_452 98
282 3300048916 Ga0496113_0071185 Ga0496113_0071185_198_494 98
283 3300048916 Ga0496113_0324999 Ga0496113_0324999_497_799 98
284 3300048916 Ga0496113_0359706 Ga0496113_0359706_484_792 98
285 3300048917 Ga0496114_0008736 Ga0496114_0008736_7246_7542 98
286 3300048917 Ga0496114_0229566 Ga0496114_0229566_721_1029 98
287 3300048917 Ga0496114_0282877 Ga0496114_0282877_733_1029 98
288 3300048917 Ga0496114_0618246 Ga0496114_0618246_263_568 98
289 3300048918 Ga0496115_0108794 Ga0496115_0108794_359_667 98
290 3300048918 Ga0496115_0224670 Ga0496115_0224670_162_458 98
291 3300049583 Ga0501067_0080425 Ga0501067_0080425_937_1245 98
292 3300050512 nmdc:mga0n895_892_c1 nmdc:mga0n895_892_c1_16427_16735 98
293 3300050513 nmdc:mga0rr50_11460_c1 nmdc:mga0rr50_11460_c1_1917_2225 98
294 3300050514 nmdc:mga08x19_292384_c1 nmdc:mga08x19_292384_c1_658_966 98
295 3300050515 nmdc:mga0a205_28719_c1 nmdc:mga0a205_28719_c1_2684_2992 98
296 3300053078 Ga0495612_0180125 Ga0495612_0180125_69_365 98
297 3300005327 Ga0070658_11212884 Ga0070658_112128841 99
298 3300005329 Ga0070683_100226322 Ga0070683_1002263221 99
299 3300005336 Ga0070680_101738745 Ga0070680_1017387451 99
300 3300005336 Ga0070680_101901709 Ga0070680_1019017091 99
301 3300005339 Ga0070660_100007596 Ga0070660_1000075965 99
302 3300005339 Ga0070660_100021467 Ga0070660_1000214672 99
303 3300005339 Ga0070660_100135957 Ga0070660_1001359572 99
304 3300005344 Ga0070661_100060787 Ga0070661_1000607874 99
305 3300005344 Ga0070661_100112887 Ga0070661_1001128872 99
306 3300005366 Ga0070659_100035598 Ga0070659_1000355984 99
307 3300005366 Ga0070659_100345434 Ga0070659_1003454343 99
308 3300005367 Ga0070667_101237269 Ga0070667_1012372691 99
309 3300005435 Ga0070714_100265556 Ga0070714_1002655563 99
310 3300005435 Ga0070714_100546286 Ga0070714_1005462862 99
311 3300005440 Ga0070705_100863960 Ga0070705_1008639602 99
312 3300005445 Ga0070708_100042687 Ga0070708_1000426876 99
313 3300005445 Ga0070708_100065381 Ga0070708_1000653813 99
314 3300005445 Ga0070708_100094407 Ga0070708_1000944074 99
315 3300005456 Ga0070678_101938165 Ga0070678_1019381651 99
316 3300005458 Ga0070681_10001955 Ga0070681_1000195514 99
317 3300005458 Ga0070681_10510298 Ga0070681_105102982 99
318 3300005467 Ga0070706_100004684 Ga0070706_1000046844 99
319 3300005467 Ga0070706_100211206 Ga0070706_1002112061 99
320 3300005467 Ga0070706_100732961 Ga0070706_1007329612 99
321 3300005468 Ga0070707_100004513 Ga0070707_1000045132 99
322 3300005468 Ga0070707_100273104 Ga0070707_1002731042 99
323 3300005468 Ga0070707_100457585 Ga0070707_1004575852 99
324 3300005468 Ga0070707_100672696 Ga0070707_1006726962 99
325 3300005471 Ga0070698_100056452 Ga0070698_1000564523 99
326 3300005471 Ga0070698_100753766 Ga0070698_1007537662 99
327 3300005530 Ga0070679_100135234 Ga0070679_1001352343 99
328 3300005530 Ga0070679_100171278 Ga0070679_1001712783 99
329 3300005530 Ga0070679_100322341 Ga0070679_1003223412 99
330 3300005535 Ga0070684_100030942 Ga0070684_1000309424 99
331 3300005535 Ga0070684_100101616 Ga0070684_1001016163 99
332 3300005535 Ga0070684_100132648 Ga0070684_1001326483 99
333 3300005536 Ga0070697_100438854 Ga0070697_1004388541 99
334 3300005539 Ga0068853_100052906 Ga0068853_1000529062 99
335 3300005546 Ga0070696_100096200 Ga0070696_1000962003 99
336 3300005548 Ga0070665_100804462 Ga0070665_1008044622 99
337 3300005563 Ga0068855_100023960 Ga0068855_1000239604 99
338 3300005563 Ga0068855_100637854 Ga0068855_1006378542 99
339 3300005564 Ga0070664_100441521 Ga0070664_1004415212 99
340 3300005577 Ga0068857_100011172 Ga0068857_1000111725 99
341 3300005578 Ga0068854_100825568 Ga0068854_1008255681 99
342 3300005578 Ga0068854_100995211 Ga0068854_1009952111 99
343 3300005578 Ga0068854_101037664 Ga0068854_1010376642 99
344 3300005614 Ga0068856_100216927 Ga0068856_1002169272 99
345 3300005614 Ga0068856_102206004 Ga0068856_1022060042 99
346 3300005616 Ga0068852_100085601 Ga0068852_1000856012 99
347 3300005616 Ga0068852_100232811 Ga0068852_1002328113 99
348 3300006028 Ga0070717_10285063 Ga0070717_102850632 99
349 3300006175 Ga0070712_100037595 Ga0070712_1000375953 99
350 3300006237 Ga0097621_102205234 Ga0097621_1022052342 99
351 3300006914 Ga0075436_100861195 Ga0075436_1008611952 99
352 3300009093 Ga0105240_11517974 Ga0105240_115179742 99
353 3300009093 Ga0105240_12229884 Ga0105240_122298842 99
354 3300009098 Ga0105245_10349933 Ga0105245_103499332 99
355 3300009174 Ga0105241_10833959 Ga0105241_108339592 99
356 3300009176 Ga0105242_11804535 Ga0105242_118045351 99
357 3300009545 Ga0105237_10091107 Ga0105237_100911071 99
358 3300009545 Ga0105237_10202129 Ga0105237_102021293 99
359 3300009551 Ga0105238_10043373 Ga0105238_100433734 99
360 3300009551 Ga0105238_10082150 Ga0105238_100821504 99
361 3300009551 Ga0105238_10822677 Ga0105238_108226772 99
362 3300009553 Ga0105249_13550048 Ga0105249_135500481 99
363 3300010375 Ga0105239_10064989 Ga0105239_100649893 99
364 3300013100 Ga0157373_10055667 Ga0157373_100556673 99
365 3300013102 Ga0157371_10131658 Ga0157371_101316584 99
366 3300013104 Ga0157370_10026787 Ga0157370_100267874 99
367 3300013104 Ga0157370_10132385 Ga0157370_101323853 99
368 3300013104 Ga0157370_10192255 Ga0157370_101922552 99
369 3300013104 Ga0157370_10273348 Ga0157370_102733482 99
370 3300013105 Ga0157369_10030091 Ga0157369_100300916 99
371 3300013105 Ga0157369_10040930 Ga0157369_100409304 99
372 3300013105 Ga0157369_10104213 Ga0157369_101042133 99
373 3300013105 Ga0157369_10408792 Ga0157369_104087922 99
374 3300013296 Ga0157374_10028775 Ga0157374_100287754 99
375 3300013296 Ga0157374_10170871 Ga0157374_101708714 99
376 3300013296 Ga0157374_11557326 Ga0157374_115573262 99
377 3300013297 Ga0157378_10069193 Ga0157378_100691935 99
378 3300013307 Ga0157372_10006332 Ga0157372_1000633211 99
379 3300013307 Ga0157372_10051234 Ga0157372_100512342 99
380 3300013307 Ga0157372_10083881 Ga0157372_100838812 99
381 3300013307 Ga0157372_12829193 Ga0157372_128291931 99
382 3300014325 Ga0163163_10488975 Ga0163163_104889752 99
383 3300014326 Ga0157380_12597902 Ga0157380_125979021 99
384 3300014497 Ga0182008_10125663 Ga0182008_101256632 99
385 3300014497 Ga0182008_10548333 Ga0182008_105483331 99
386 3300014969 Ga0157376_10322620 Ga0157376_103226203 99
387 3300015261 Ga0182006_1122101 Ga0182006_11221012 99
388 3300015262 Ga0182007_10098967 Ga0182007_100989672 99
389 3300017792 Ga0163161_11440430 Ga0163161_114404302 99
390 3300020069 Ga0197907_10913843 Ga0197907_109138432 99
391 3300020070 Ga0206356_10103907 Ga0206356_101039072 99
392 3300020070 Ga0206356_10503281 Ga0206356_105032811 99
393 3300020070 Ga0206356_10596004 Ga0206356_105960045 99
394 3300020070 Ga0206356_11115077 Ga0206356_111150771 99
395 3300020076 Ga0206355_1287509 Ga0206355_12875092 99
396 3300020080 Ga0206350_10489792 Ga0206350_104897921 99
397 3300020081 Ga0206354_10295194 Ga0206354_102951941 99
398 3300020081 Ga0206354_10669380 Ga0206354_106693804 99
399 3300020082 Ga0206353_11387566 Ga0206353_113875666 99
400 3300020082 Ga0206353_11491132 Ga0206353_114911322 99
401 3300020082 Ga0206353_11727024 Ga0206353_117270242 99
402 3300020610 Ga0154015_1029663 Ga0154015_10296632 99
403 3300020610 Ga0154015_1459760 Ga0154015_14597602 99
404 3300021377 Ga0213874_10071190 Ga0213874_100711902 99
405 3300021384 Ga0213876_10177042 Ga0213876_101770422 99
406 3300022467 Ga0224712_10006171 Ga0224712_100061712 99
407 3300022467 Ga0224712_10135788 Ga0224712_101357882 99
408 3300022467 Ga0224712_10175531 Ga0224712_101755312 99
409 3300025904 Ga0207647_10531479 Ga0207647_105314792 99
410 3300025909 Ga0207705_10051988 Ga0207705_100519884 99
411 3300025910 Ga0207684_10004965 Ga0207684_100049653 99
412 3300025910 Ga0207684_10264467 Ga0207684_102644671 99
413 3300025911 Ga0207654_10116834 Ga0207654_101168342 99
414 3300025911 Ga0207654_10171698 Ga0207654_101716982 99
415 3300025911 Ga0207654_10383394 Ga0207654_103833942 99
416 3300025911 Ga0207654_10662506 Ga0207654_106625062 99
417 3300025912 Ga0207707_10006792 Ga0207707_100067929 99
418 3300025912 Ga0207707_10008124 Ga0207707_100081246 99
419 3300025913 Ga0207695_10811588 Ga0207695_108115882 99
420 3300025914 Ga0207671_10282570 Ga0207671_102825702 99
421 3300025914 Ga0207671_10414442 Ga0207671_104144421 99
422 3300025915 Ga0207693_10071680 Ga0207693_100716802 99
423 3300025917 Ga0207660_10214069 Ga0207660_102140692 99
424 3300025917 Ga0207660_10381928 Ga0207660_103819281 99
425 3300025919 Ga0207657_10004765 Ga0207657_100047653 99
426 3300025919 Ga0207657_10016023 Ga0207657_100160235 99
427 3300025919 Ga0207657_10196543 Ga0207657_101965432 99
428 3300025920 Ga0207649_10021258 Ga0207649_100212582 99
429 3300025920 Ga0207649_10081017 Ga0207649_100810172 99
430 3300025920 Ga0207649_10218566 Ga0207649_102185663 99
431 3300025921 Ga0207652_10027233 Ga0207652_100272332 99
432 3300025921 Ga0207652_10100346 Ga0207652_101003463 99
433 3300025921 Ga0207652_10442742 Ga0207652_104427421 99
434 3300025922 Ga0207646_10042572 Ga0207646_100425723 99
435 3300025922 Ga0207646_10182184 Ga0207646_101821843 99
436 3300025922 Ga0207646_10347464 Ga0207646_103474643 99
437 3300025922 Ga0207646_10519811 Ga0207646_105198112 99
438 3300025924 Ga0207694_10022612 Ga0207694_100226123 99
439 3300025927 Ga0207687_10087942 Ga0207687_100879423 99
440 3300025927 Ga0207687_10456349 Ga0207687_104563492 99
441 3300025929 Ga0207664_10510534 Ga0207664_105105342 99
442 3300025932 Ga0207690_10113010 Ga0207690_101130102 99
443 3300025932 Ga0207690_10375101 Ga0207690_103751012 99
444 3300025944 Ga0207661_10372072 Ga0207661_103720722 99
445 3300025944 Ga0207661_10966109 Ga0207661_109661092 99
446 3300025944 Ga0207661_11537705 Ga0207661_115377052 99
447 3300025949 Ga0207667_10205237 Ga0207667_102052373 99
448 3300025949 Ga0207667_10310643 Ga0207667_103106432 99
449 3300025949 Ga0207667_10344476 Ga0207667_103444761 99
450 3300025981 Ga0207640_10705480 Ga0207640_107054802 99
451 3300025981 Ga0207640_11349502 Ga0207640_113495022 99
452 3300026041 Ga0207639_10159484 Ga0207639_101594843 99
453 3300026041 Ga0207639_11992275 Ga0207639_119922752 99
454 3300026067 Ga0207678_10261429 Ga0207678_102614293 99
455 3300026078 Ga0207702_10279314 Ga0207702_102793143 99
456 3300026078 Ga0207702_10373709 Ga0207702_103737093 99
457 3300026078 Ga0207702_10763958 Ga0207702_107639581 99
458 3300026089 Ga0207648_11997922 Ga0207648_119979221 99
459 3300026116 Ga0207674_10034277 Ga0207674_100342773 99
460 3300026142 Ga0207698_10036602 Ga0207698_100366024 99
461 3300026142 Ga0207698_10402650 Ga0207698_104026502 99
462 3300026142 Ga0207698_10656217 Ga0207698_106562171 99
463 3300028379 Ga0268266_10080384 Ga0268266_100803844 99
464 3300028379 Ga0268266_10223952 Ga0268266_102239522 99
465 3300028573 Ga0265334_10285742 Ga0265334_102857422 99
466 3300028800 Ga0265338_10881946 Ga0265338_108819462 99
467 3300032002 Ga0307416_100415878 Ga0307416_1004158782 99
468 3300035089 Ga0373944_0024448 Ga0373944_0024448_1322_1621 99
469 3300035113 Ga0373936_0016183 Ga0373936_0016183_354_653 99
470 3300035116 Ga0373945_0003861 Ga0373945_0003861_46_345 99
471 3300035170 Ga0373943_0008082 Ga0373943_0008082_1024_1323 99
472 3300035171 Ga0373946_0529395 Ga0373946_0529395_272_571 99
473 3300035692 Ga0373935_0094404 Ga0373935_0094404_272_571 99
474 3300035692 Ga0373935_1281963 Ga0373935_1281963_60_359 99
475 3300035725 Ga0373947_0000590 Ga0373947_0000590_8399_8698 99
476 3300037068 Ga0373925_0025998 Ga0373925_0025998_11_310 99
477 3300037312 Ga0395899_0055703 Ga0395899_0055703_1735_2034 99
478 3300037312 Ga0395899_0180397 Ga0395899_0180397_768_1067 99
479 3300037312 Ga0395899_0299345 Ga0395899_0299345_61_423 99
480 3300037312 Ga0395899_0368691 Ga0395899_0368691_67_366 99
481 3300037312 Ga0395899_0921280 Ga0395899_0921280_77_376 99
482 3300037418 Ga0395900_0015152 Ga0395900_0015152_1791_2090 99
483 3300037418 Ga0395900_0406131 Ga0395900_0406131_757_1056 99
484 3300037418 Ga0395900_0468924 Ga0395900_0468924_398_697 99
485 3300037418 Ga0395900_0474315 Ga0395900_0474315_490_852 99
486 3300037418 Ga0395900_1823630 Ga0395900_1823630_74_373 99
487 3300037466 Ga0395898_0038285 Ga0395898_0038285_694_1038 99
488 3300037466 Ga0395898_0077907 Ga0395898_0077907_2183_2482 99
489 3300037466 Ga0395898_0211411 Ga0395898_0211411_758_1057 99
490 3300037466 Ga0395898_0616880 Ga0395898_0616880_321_620 99
491 3300037466 Ga0395898_1071953 Ga0395898_1071953_217_516 99
492 3300037466 Ga0395898_1854759 Ga0395898_1854759_79_441 99
493 3300037471 Ga0395905_0444462 Ga0395905_0444462_807_1106 99
494 3300037471 Ga0395905_0741391 Ga0395905_0741391_518_817 99
495 3300037471 Ga0395905_0845780 Ga0395905_0845780_164_463 99
496 3300037471 Ga0395905_1331165 Ga0395905_1331165_249_593 99
497 3300038443 Ga0395901_0079715 Ga0395901_0079715_2127_2426 99
498 3300038443 Ga0395901_0126642 Ga0395901_0126642_1171_1470 99
499 3300038443 Ga0395901_0128336 Ga0395901_0128336_2306_2605 99
500 3300038443 Ga0395901_0735536 Ga0395901_0735536_26_325 99
501 3300038443 Ga0395901_0897983 Ga0395901_0897983_16_315 99
502 3300039437 Ga0436365_0489299 Ga0436365_0489299_313_612 99
503 3300039437 Ga0436365_0894153 Ga0436365_0894153_580_879 99
504 3300039437 Ga0436365_1695513 Ga0436365_1695513_157_456 99
505 3300039437 Ga0436365_1738713 Ga0436365_1738713_1470_1769 99
506 3300039450 Ga0436363_1518906 Ga0436363_1518906_186_485 99
507 3300041496 Ga0451839_0323294 Ga0451839_0323294_31_330 99
508 3300041512 Ga0451853_1552171 Ga0451853_1552171_397_696 99
509 3300042005 Ga0439448_0044150 Ga0439448_0044150_121_420 99
510 3300042122 Ga0450920_006037 Ga0450920_006037_1803_2102 99
511 3300042146 Ga0450907_096719 Ga0450907_096719_116_415 99
512 3300042438 Ga0439459_0155262 Ga0439459_0155262_279_578 99
513 3300042531 Ga0450918_032812 Ga0450918_032812_301_600 99
514 3300044658 Ga0466972_0283130 Ga0466972_0283130_466_765 99
515 3300044658 Ga0466972_0290705 Ga0466972_0290705_51_350 99
516 3300044683 Ga0466965_0407738 Ga0466965_0407738_415_714 99
517 3300044684 Ga0466966_0002834 Ga0466966_0002834_4992_5291 99
518 3300044684 Ga0466966_0108652 Ga0466966_0108652_533_832 99
519 3300044684 Ga0466966_0280549 Ga0466966_0280549_17_316 99
520 3300044693 Ga0466961_0011148 Ga0466961_0011148_2603_2902 99
521 3300044693 Ga0466961_0040813 Ga0466961_0040813_1168_1467 99
522 3300044693 Ga0466961_0142256 Ga0466961_0142256_534_833 99
523 3300044693 Ga0466961_0904722 Ga0466961_0904722_211_510 99
524 3300044694 Ga0466963_0000037 Ga0466963_0000037_310_609 99
525 3300044694 Ga0466963_0012580 Ga0466963_0012580_3526_3825 99
526 3300044694 Ga0466963_0019970 Ga0466963_0019970_1229_1528 99
527 3300044694 Ga0466963_0025907 Ga0466963_0025907_2249_2548 99
528 3300044694 Ga0466963_0039167 Ga0466963_0039167_1351_1650 99
529 3300044694 Ga0466963_0107955 Ga0466963_0107955_241_540 99
530 3300044694 Ga0466963_0434860 Ga0466963_0434860_375_674 99
531 3300044706 Ga0466964_0016749 Ga0466964_0016749_1354_1653 99
532 3300044706 Ga0466964_0025011 Ga0466964_0025011_1296_1595 99
533 3300044706 Ga0466964_0148086 Ga0466964_0148086_106_405 99
534 3300044706 Ga0466964_0175895 Ga0466964_0175895_586_885 99
535 3300044706 Ga0466964_0186342 Ga0466964_0186342_289_588 99
536 3300044706 Ga0466964_0835282 Ga0466964_0835282_200_499 99
537 3300044719 Ga0466971_0150491 Ga0466971_0150491_246_545 99
538 3300044719 Ga0466971_0356469 Ga0466971_0356469_117_416 99
539 3300044719 Ga0466971_0474972 Ga0466971_0474972_255_554 99
540 3300044735 Ga0466968_0015622 Ga0466968_0015622_2196_2495 99
541 3300044765 Ga0466970_0189969 Ga0466970_0189969_800_1099 99
542 3300044765 Ga0466970_0223888 Ga0466970_0223888_72_371 99
543 3300044842 Ga0466957_0106615 Ga0466957_0106615_23_322 99
544 3300044842 Ga0466957_0340807 Ga0466957_0340807_448_747 99
545 3300044842 Ga0466957_0487690 Ga0466957_0487690_475_774 99
546 3300044842 Ga0466957_0562358 Ga0466957_0562358_180_479 99
547 3300044901 Ga0466960_0756336 Ga0466960_0756336_136_435 99
548 3300045049 Ga0466959_0009015 Ga0466959_0009015_1976_2275 99
549 3300045049 Ga0466959_0101180 Ga0466959_0101180_978_1277 99
550 3300045049 Ga0466959_0199798 Ga0466959_0199798_337_636 99
551 3300045049 Ga0466959_0286203 Ga0466959_0286203_395_694 99
552 3300045049 Ga0466959_0722936 Ga0466959_0722936_55_354 99
553 3300045836 Ga0466958_0062153 Ga0466958_0062153_1026_1325 99
554 3300045836 Ga0466958_0179435 Ga0466958_0179435_395_694 99
555 3300045836 Ga0466958_0650196 Ga0466958_0650196_55_354 99
556 3300045976 Ga0466967_0005846 Ga0466967_0005846_4761_5060 99
557 3300045976 Ga0466967_0006284 Ga0466967_0006284_4419_4718 99
558 3300045976 Ga0466967_0018080 Ga0466967_0018080_2651_2950 99
559 3300045976 Ga0466967_0048083 Ga0466967_0048083_288_587 99
560 3300045976 Ga0466967_0075125 Ga0466967_0075125_2415_2714 99
561 3300045976 Ga0466967_0088756 Ga0466967_0088756_13_312 99
562 3300045976 Ga0466967_0112904 Ga0466967_0112904_1344_1643 99
563 3300045976 Ga0466967_0114331 Ga0466967_0114331_105_404 99
564 3300045976 Ga0466967_0114427 Ga0466967_0114427_1558_1857 99
565 3300045976 Ga0466967_0178941 Ga0466967_0178941_642_941 99
566 3300045976 Ga0466967_0215476 Ga0466967_0215476_445_744 99
567 3300045976 Ga0466967_0387149 Ga0466967_0387149_115_414 99
568 3300045976 Ga0466967_0490601 Ga0466967_0490601_263_562 99
569 3300045976 Ga0466967_0529334 Ga0466967_0529334_849_1148 99
570 3300045976 Ga0466967_0558042 Ga0466967_0558042_581_880 99
571 3300045976 Ga0466967_0610262 Ga0466967_0610262_759_1058 99
572 3300045976 Ga0466967_0625919 Ga0466967_0625919_485_784 99
573 3300045976 Ga0466967_0631097 Ga0466967_0631097_167_466 99
574 3300045976 Ga0466967_0733273 Ga0466967_0733273_227_526 99
575 3300045976 Ga0466967_0849445 Ga0466967_0849445_533_832 99
576 3300045976 Ga0466967_0947326 Ga0466967_0947326_179_478 99
577 3300045976 Ga0466967_0974087 Ga0466967_0974087_483_782 99
578 3300045976 Ga0466967_1128168 Ga0466967_1128168_294_593 99
579 3300046461 Ga0495641_0114789 Ga0495641_0114789_650_949 99
580 3300046461 Ga0495641_0118566 Ga0495641_0118566_565_864 99
581 3300046463 Ga0495653_0223428 Ga0495653_0223428_335_634 99
582 3300046472 Ga0495580_0201644 Ga0495580_0201644_821_1120 99
583 3300046473 Ga0495582_0170654 Ga0495582_0170654_651_950 99
584 3300046473 Ga0495582_0237450 Ga0495582_0237450_549_848 99
585 3300046475 Ga0495639_0244442 Ga0495639_0244442_96_395 99
586 3300046511 Ga0495608_0216221 Ga0495608_0216221_811_1110 99
587 3300046517 Ga0495630_0143360 Ga0495630_0143360_1196_1495 99
588 3300046517 Ga0495630_0160665 Ga0495630_0160665_1046_1345 99
589 3300046517 Ga0495630_0202847 Ga0495630_0202847_589_888 99
590 3300046533 Ga0495640_0256980 Ga0495640_0256980_761_1060 99
591 3300046535 Ga0495586_0006168 Ga0495586_0006168_4176_4475 99
592 3300046535 Ga0495586_0121463 Ga0495586_0121463_87_386 99
593 3300046536 Ga0495587_0110294 Ga0495587_0110294_1167_1466 99
594 3300046536 Ga0495587_0216860 Ga0495587_0216860_487_786 99
595 3300046559 Ga0495667_0376677 Ga0495667_0376677_478_777 99
596 3300046615 Ga0495656_0673042 Ga0495656_0673042_65_364 99
597 3300046642 Ga0495634_0117263 Ga0495634_0117263_814_1113 99
598 3300046642 Ga0495634_0489784 Ga0495634_0489784_330_629 99
599 3300046680 Ga0495646_0507906 Ga0495646_0507906_138_437 99
600 3300046681 Ga0495647_0075764 Ga0495647_0075764_610_909 99
601 3300046694 Ga0495649_0423914 Ga0495649_0423914_10_309 99
602 3300047317 Ga0495604_0774357 Ga0495604_0774357_130_429 99
603 3300047319 Ga0495674_0126270 Ga0495674_0126270_1363_1662 99
604 3300047319 Ga0495674_0237914 Ga0495674_0237914_124_423 99
605 3300047319 Ga0495674_0359859 Ga0495674_0359859_869_1168 99
606 3300047321 Ga0495676_0700229 Ga0495676_0700229_148_447 99
607 3300047322 Ga0495680_0864477 Ga0495680_0864477_261_560 99
608 3300047673 Ga0495593_0072214 Ga0495593_0072214_65_364 99
609 3300048903 Ga0496100_0030673 Ga0496100_0030673_2537_2836 99
610 3300048904 Ga0496101_0140299 Ga0496101_0140299_445_744 99
611 3300048905 Ga0496102_0005991 Ga0496102_0005991_2338_2637 99
612 3300048906 Ga0496103_0199074 Ga0496103_0199074_797_1096 99
613 3300048907 Ga0496104_0011990 Ga0496104_0011990_247_546 99
614 3300048907 Ga0496104_0813858 Ga0496104_0813858_152_451 99
615 3300048908 Ga0496105_0002671 Ga0496105_0002671_1267_1566 99
616 3300048909 Ga0496106_0003662 Ga0496106_0003662_3382_3681 99
617 3300048910 Ga0496107_0102525 Ga0496107_0102525_948_1247 99
618 3300048911 Ga0496108_0006069 Ga0496108_0006069_2486_2785 99
619 3300048911 Ga0496108_0640216 Ga0496108_0640216_412_711 99
620 3300048912 Ga0496109_0002789 Ga0496109_0002789_822_1121 99
621 3300048913 Ga0496110_0004178 Ga0496110_0004178_751_1050 99
622 3300048914 Ga0496111_0033409 Ga0496111_0033409_2584_2883 99
623 3300048914 Ga0496111_0179718 Ga0496111_0179718_427_726 99
624 3300048914 Ga0496111_0921586 Ga0496111_0921586_45_344 99
625 3300048915 Ga0496112_0446110 Ga0496112_0446110_753_1052 99
626 3300048915 Ga0496112_0584436 Ga0496112_0584436_415_714 99
627 3300048915 Ga0496112_1692982 Ga0496112_1692982_224_523 99
628 3300048916 Ga0496113_0026347 Ga0496113_0026347_1664_1963 99
629 3300048917 Ga0496114_0002457 Ga0496114_0002457_247_546 99
630 3300048917 Ga0496114_0258633 Ga0496114_0258633_889_1188 99
631 3300048917 Ga0496114_0685957 Ga0496114_0685957_131_430 99
632 3300048918 Ga0496115_0005151 Ga0496115_0005151_1098_1397 99
633 3300049568 Ga0501031_0344451 Ga0501031_0344451_257_556 99
634 3300049569 Ga0501032_0242821 Ga0501032_0242821_472_771 99
635 3300049570 Ga0501033_1052515 Ga0501033_1052515_122_421 99
636 3300049571 Ga0501034_0321166 Ga0501034_0321166_421_720 99
637 3300049572 Ga0501036_0356252 Ga0501036_0356252_91_390 99
638 3300049572 Ga0501036_0547212 Ga0501036_0547212_594_893 99
639 3300049572 Ga0501036_1398409 Ga0501036_1398409_28_327 99
640 3300049575 Ga0501039_0941766 Ga0501039_0941766_117_416 99
641 3300049575 Ga0501039_1042575 Ga0501039_1042575_232_531 99
642 3300049575 Ga0501039_1249633 Ga0501039_1249633_252_551 99
643 3300049576 Ga0501040_0131703 Ga0501040_0131703_436_735 99
644 3300049577 Ga0501041_0214980 Ga0501041_0214980_128_427 99
645 3300049577 Ga0501041_0562229 Ga0501041_0562229_225_524 99
646 3300049580 Ga0501046_0848257 Ga0501046_0848257_276_575 99
647 3300049581 Ga0501047_0061170 Ga0501047_0061170_1569_1868 99
648 3300049581 Ga0501047_0219398 Ga0501047_0219398_949_1248 99
649 3300049581 Ga0501047_0696142 Ga0501047_0696142_69_368 99
650 3300049582 Ga0501048_0242298 Ga0501048_0242298_803_1102 99
651 3300049582 Ga0501048_1066701 Ga0501048_1066701_139_438 99
652 3300049582 Ga0501048_1373482 Ga0501048_1373482_136_435 99
653 3300049583 Ga0501067_0000163 Ga0501067_0000163_35611_35910 99
654 3300049584 Ga0501068_0082316 Ga0501068_0082316_992_1291 99
655 3300049585 Ga0501069_0003809 Ga0501069_0003809_4333_4632 99
656 3300049585 Ga0501069_0129026 Ga0501069_0129026_895_1194 99
657 3300049585 Ga0501069_0325813 Ga0501069_0325813_481_780 99
658 3300049585 Ga0501069_0647349 Ga0501069_0647349_140_439 99
659 3300049586 Ga0501070_0003032 Ga0501070_0003032_7379_7678 99
660 3300049586 Ga0501070_0067716 Ga0501070_0067716_1981_2280 99
661 3300049586 Ga0501070_0310143 Ga0501070_0310143_790_1089 99
662 3300049586 Ga0501070_0323861 Ga0501070_0323861_631_930 99
663 3300049586 Ga0501070_0396149 Ga0501070_0396149_303_602 99
664 3300049586 Ga0501070_0883218 Ga0501070_0883218_181_480 99
665 3300049587 Ga0501071_0128485 Ga0501071_0128485_531_830 99
666 3300049587 Ga0501071_0268424 Ga0501071_0268424_279_578 99
667 3300049588 Ga0501072_0307219 Ga0501072_0307219_947_1246 99
668 3300049588 Ga0501072_0391156 Ga0501072_0391156_21_320 99
669 3300049589 Ga0501073_0739985 Ga0501073_0739985_172_471 99
670 3300049589 Ga0501073_1126670 Ga0501073_1126670_190_489 99
671 3300049590 Ga0501074_0012591 Ga0501074_0012591_570_869 99
672 3300049590 Ga0501074_0200257 Ga0501074_0200257_253_552 99
673 3300049591 Ga0501075_0179876 Ga0501075_0179876_365_664 99
674 3300049591 Ga0501075_0185043 Ga0501075_0185043_979_1278 99
675 3300049591 Ga0501075_0190546 Ga0501075_0190546_846_1145 99
676 3300049591 Ga0501075_0595823 Ga0501075_0595823_224_523 99
677 3300049591 Ga0501075_1475497 Ga0501075_1475497_40_339 99
678 3300049592 Ga0501076_0636894 Ga0501076_0636894_253_552 99
679 3300049592 Ga0501076_1797433 Ga0501076_1797433_73_372 99
680 3300049593 Ga0501077_0057161 Ga0501077_0057161_1144_1443 99
681 3300049593 Ga0501077_0261169 Ga0501077_0261169_692_991 99
682 3300049593 Ga0501077_0373892 Ga0501077_0373892_488_787 99
683 3300049686 Ga0501257_217013 Ga0501257_217013_240_539 99
684 3300049741 Ga0501079_0178201 Ga0501079_0178201_1017_1316 99
685 3300049741 Ga0501079_0386254 Ga0501079_0386254_677_976 99
686 3300049741 Ga0501079_0918928 Ga0501079_0918928_162_461 99
687 3300049741 Ga0501079_1580998 Ga0501079_1580998_28_327 99
688 3300049742 Ga0501080_0186373 Ga0501080_0186373_660_959 99
689 3300049742 Ga0501080_0248406 Ga0501080_0248406_538_837 99
690 3300049742 Ga0501080_0261699 Ga0501080_0261699_1240_1539 99
691 3300049742 Ga0501080_0497086 Ga0501080_0497086_766_1065 99
692 3300049743 Ga0501081_0147649 Ga0501081_0147649_1202_1501 99
693 3300049743 Ga0501081_0332671 Ga0501081_0332671_511_810 99
694 3300049743 Ga0501081_0903815 Ga0501081_0903815_200_499 99
695 3300049743 Ga0501081_1177611 Ga0501081_1177611_166_465 99
696 3300049744 Ga0501083_0217934 Ga0501083_0217934_919_1218 99
697 3300049772 Ga0501275_079780 Ga0501275_079780_159_458 99
698 3300049823 Ga0501044_0588971 Ga0501044_0588971_294_593 99
699 3300050507 nmdc:mga05p37_1933563_c1 nmdc:mga05p37_1933563_c1_173_472 99
700 3300050513 nmdc:mga0rr50_1340870_c1 nmdc:mga0rr50_1340870_c1_129_428 99
701 3300050513 nmdc:mga0rr50_1766530_c1 nmdc:mga0rr50_1766530_c1_14_313 99
702 3300050513 nmdc:mga0rr50_442247_c1 nmdc:mga0rr50_442247_c1_650_949 99
703 3300050514 nmdc:mga08x19_633109_c1 nmdc:mga08x19_633109_c1_88_387 99
704 3300050514 nmdc:mga08x19_784147_c1 nmdc:mga08x19_784147_c1_263_562 99
705 3300050515 nmdc:mga0a205_249680_c1 nmdc:mga0a205_249680_c1_746_1045 99
706 3300053078 Ga0495612_0120485 Ga0495612_0120485_525_824 99
707 3300053084 Ga0495595_0403410 Ga0495595_0403410_238_537 99
708 3300054114 Ga0501084_0373600 Ga0501084_0373600_135_434 99
709 3300054114 Ga0501084_0444499 Ga0501084_0444499_108_407 99
710 3300054114 Ga0501084_0647747 Ga0501084_0647747_393_692 99
711 3300059491 Ga0587070_168066 Ga0587070_168066_14_313 99
712 3300059492 Ga0587073_0203421 Ga0587073_0203421_30_329 99
713 3300059505 Ga0587083_0244555 Ga0587083_0244555_201_500 99
714 3300059626 Ga0587115_082845 Ga0587115_082845_169_468 99
715 3300059626 Ga0587115_115216 Ga0587115_115216_164_463 99
716 3300059644 Ga0587075_003998 Ga0587075_003998_98_397 99
717 3300060353 Ga0501082_0116044 Ga0501082_0116044_253_552 99
718 3300060353 Ga0501082_1798094 Ga0501082_1798094_177_476 99
719 3300061719 Ga0466962_0014187 Ga0466962_0014187_293_592 99
720 3300061719 Ga0466962_0023570 Ga0466962_0023570_229_528 99
721 3300061734 Ga0530510_0314571 Ga0530510_0314571_546_845 99
722 3300061734 Ga0530510_0952596 Ga0530510_0952596_34_333 99
723 3300061734 Ga0530510_0970792 Ga0530510_0970792_231_530 99

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01883

FeS_assembly_P

Iron-sulfur cluster assembly protein

20

91

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lno-assembly1.cif.gz_A crystal structure of domain of unknown function duf59 from bacillus anthracis 0.9327 5 99
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.9066 1 97
2cu6-assembly1.cif.gz_A crystal structure of the dtdp-4-keto-l-rhamnose reductase-related protein from thermus thermophilus hb8 0.9021 2 91
1wcj-assembly1.cif.gz_A conserved hypothetical protein tm0487 from thermotoga maritima 0.8892 2 97
3cq2-assembly1.cif.gz_B structure of the dtdp-4-keto-l-rhamnose reductase related protein (other form) from thermus thermophilus hb8 0.8892 1 97
ID Description Score Start End Superfamily
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9722 13 97 3.30.300.130
af_Q0JJS8_71_163_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9403 5 78 3.30.300.130
af_Q2FZT0_1_88_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9295 13 97 3.30.300.130
af_P76080_10_106_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9221 2 97 3.30.300.130
af_Q8II78_18_117_3.30.300.130 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;Fe-S cluster assembly (FSCA) 0.9204 5 78 3.30.300.130
ID Description Score Start End GO Terms
AF-A0A7V9JNX4-F1-model_v4 Metal-sulfur cluster assembly factor 0.9945 1 99
AF-A0A2E9VW27-F1-model_v4 Rieske domain-containing protein 0.9942 7 97 GO:0046872
GO:0051537
AF-A0A7V5A2L2-F1-model_v4 DUF59 domain-containing protein 0.9926 2 97
AF-A0A257VM95-F1-model_v4 Rieske domain-containing protein 0.9899 2 99 GO:0046872
GO:0051537
AF-A0A7Y5N2I1-F1-model_v4 DUF59 domain-containing protein 0.9889 1 99

Feature Viewer

pLDDT pTM Quality
93.89 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map