F477498

General Info

Members Datasets Scaffolds Average Seq Length
723 366 1446 150

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_11515798|Ga0207703_115157982
Length 144
Sequence MFDLVADVERYPEFVPLCSALKVRQRMTRPDGTEVLVADMTVSFKLVKESFTSRVTLDRANQKILVEYLQGPFSKLENRWTFEPKMSQQGDDVCDVGFFLAYEFKSRMLAMLMGSMFDAAFARFSAAFEKRADAIYGRRKLASS

Samples

Sample ID Description Type Environment
1 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
109 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
110 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
112 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
113 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
115 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
116 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
117 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
118 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
119 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
120 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
121 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
125 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
209 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
210 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
211 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
214 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
217 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
218 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
219 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
222 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
231 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
232 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
233 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
234 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
235 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
236 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
237 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
238 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
239 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
240 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
241 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
242 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
243 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
244 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
252 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
253 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
263 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
264 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
265 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
266 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
267 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
268 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
269 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
270 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
271 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
272 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
273 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
282 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
283 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
286 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
287 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
288 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
295 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
296 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
297 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
298 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
299 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
300 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
301 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
302 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
303 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
304 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
305 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
306 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
307 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
308 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
309 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
310 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
311 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
312 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
329 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
330 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
331 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
332 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
333 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
341 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
342 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
345 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
346 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
347 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
348 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
349 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
350 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
351 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
352 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
353 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
354 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
355 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
356 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
357 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
358 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
359 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
360 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
361 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
362 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
363 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
364 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
365 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
366 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.92
Nodule 0
Rhizoplane 10.37
Rhizosphere 82.02
Stem 0
Stem Tuber 0
Unclassified 0.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207703_11515798 3300026035 Bacteria 645
2 JGI24746J21847_1009959 3300001977 Bacteria 1412
3 JGI24740J21852_10021354 3300001979 Bacteria 2246
4 JGI24739J22299_10001456 3300001989 Bacteria 8919
5 JGI24739J22299_10026087 3300001989 Bacteria 2053
6 JGI24739J22299_10054087 3300001989 Bacteria 1287
7 JGI24737J22298_10005128 3300001990 Bacteria 4535
8 JGI24743J22301_10006212 3300001991 Bacteria 2027
9 JGI24735J21928_10030385 3300002067 Bacteria 1606
10 JGI24750J21931_1002228 3300002070 Bacteria 2345
11 JGI24745J21846_1016970 3300002073 Bacteria 846
12 JGI24749J21850_1001515 3300002076 Bacteria 3285
13 JGI24742J22300_10001318 3300002244 Bacteria 3897
14 JGI25153J46596_10003743 3300003215 Bacteria 8395
15 JGI25405J52794_10005737 3300003911 Bacteria 2250
16 JGI25405J52794_10017813 3300003911 Bacteria 1415
17 Ga0070676_10024663 3300005328 Bacteria 3391
18 Ga0070683_100174960 3300005329 Bacteria 2038
19 Ga0070690_100007563 3300005330 Bacteria 6220
20 Ga0070670_100008735 3300005331 Bacteria 8651
21 Ga0070670_100167148 3300005331 Bacteria 1907
22 Ga0070670_100800311 3300005331 Bacteria 851
23 Ga0068869_100345513 3300005334 Bacteria 1212
24 Ga0068869_100700498 3300005334 Bacteria 864
25 Ga0070680_101529646 3300005336 Bacteria 578
26 Ga0070682_100044190 3300005337 Bacteria 2758
27 Ga0070682_100234067 3300005337 Bacteria 1315
28 Ga0068868_101574862 3300005338 Bacteria 617
29 Ga0070660_100494236 3300005339 Bacteria 1017
30 Ga0070689_100000967 3300005340 Bacteria 17930
31 Ga0070689_100642890 3300005340 Bacteria 922
32 Ga0070691_10044964 3300005341 Bacteria 2094
33 Ga0070687_100009878 3300005343 Bacteria 4101
34 Ga0070661_100372238 3300005344 Bacteria 1125
35 Ga0070668_100052238 3300005347 Bacteria 3150
36 Ga0070669_100007946 3300005353 Bacteria 7581
37 Ga0070675_100037093 3300005354 Bacteria 3969
38 Ga0070675_101819622 3300005354 Bacteria 562
39 Ga0070671_100032872 3300005355 Bacteria 4288
40 Ga0070671_100110878 3300005355 Bacteria 2305
41 Ga0070674_100042825 3300005356 Bacteria 3077
42 Ga0070673_100074272 3300005364 Bacteria 2740
43 Ga0070673_100682654 3300005364 Bacteria 942
44 Ga0070673_101529898 3300005364 Bacteria 629
45 Ga0070688_100019094 3300005365 Bacteria 3968
46 Ga0070667_100019000 3300005367 Bacteria 5697
47 Ga0070709_10002556 3300005434 Bacteria 9845
48 Ga0070714_100237929 3300005435 Bacteria 1680
49 Ga0070714_100912844 3300005435 Bacteria 853
50 Ga0070713_100133988 3300005436 Bacteria 2187
51 Ga0070713_100228106 3300005436 Bacteria 1692
52 Ga0070713_100237362 3300005436 Bacteria 1659
53 Ga0070713_100271331 3300005436 Bacteria 1553
54 Ga0070713_100462208 3300005436 Bacteria 1193
55 Ga0070713_100476582 3300005436 Bacteria 1175
56 Ga0070713_100696509 3300005436 Bacteria 970
57 Ga0070710_10003499 3300005437 Bacteria 7443
58 Ga0070701_10025963 3300005438 Bacteria 2851
59 Ga0070711_100036598 3300005439 Bacteria 3288
60 Ga0070711_100063104 3300005439 Bacteria 2585
61 Ga0070711_100097037 3300005439 Bacteria 2136
62 Ga0070705_100158313 3300005440 Bacteria 1511
63 Ga0070694_100594920 3300005444 Bacteria 890
64 Ga0070663_100013120 3300005455 Bacteria 5267
65 Ga0070663_100246294 3300005455 Bacteria 1413
66 Ga0070678_100145198 3300005456 Bacteria 1904
67 Ga0070662_100002162 3300005457 Bacteria 12040
68 Ga0070662_101019197 3300005457 Bacteria 709
69 Ga0070681_10185503 3300005458 Bacteria 2001
70 Ga0070681_11129256 3300005458 Bacteria 705
71 Ga0068867_100013198 3300005459 Bacteria 5851
72 Ga0068867_101813053 3300005459 Bacteria 574
73 Ga0070685_10009064 3300005466 Bacteria 5133
74 Ga0070706_100305606 3300005467 Bacteria 1484
75 Ga0070706_100397810 3300005467 Bacteria 1282
76 Ga0070699_100005593 3300005518 Bacteria 11025
77 Ga0070699_100328365 3300005518 Bacteria 1375
78 Ga0070699_101550368 3300005518 Bacteria 607
79 Ga0070679_100114213 3300005530 Bacteria 2686
80 Ga0070684_100660322 3300005535 Bacteria 974
81 Ga0070697_100189731 3300005536 Bacteria 1744
82 Ga0070697_100480935 3300005536 Bacteria 1084
83 Ga0068853_100012248 3300005539 Bacteria 6974
84 Ga0068853_100026914 3300005539 Bacteria 4832
85 Ga0068853_100110036 3300005539 Bacteria 2447
86 Ga0068853_100425948 3300005539 Bacteria 1245
87 Ga0070672_100413511 3300005543 Bacteria 1157
88 Ga0070686_100040654 3300005544 Bacteria 2902
89 Ga0070686_100238448 3300005544 Bacteria 1323
90 Ga0070696_100667241 3300005546 Bacteria 844
91 Ga0070693_100674583 3300005547 Bacteria 754
92 Ga0070665_100201713 3300005548 Bacteria 1990
93 Ga0068855_100089590 3300005563 Bacteria 3552
94 Ga0068855_100490801 3300005563 Bacteria 1336
95 Ga0068855_100571405 3300005563 Bacteria 1222
96 Ga0068855_101807440 3300005563 Bacteria 621
97 Ga0070664_100009552 3300005564 Bacteria 7863
98 Ga0070664_100403123 3300005564 Bacteria 1251
99 Ga0068857_100008808 3300005577 Bacteria 8737
100 Ga0068857_100184714 3300005577 Bacteria 1898
101 Ga0068857_100311230 3300005577 Bacteria 1453
102 Ga0068854_100063790 3300005578 Bacteria 2675
103 Ga0068856_100017571 3300005614 Bacteria 6931
104 Ga0068856_100251661 3300005614 Bacteria 1782
105 Ga0070702_100002923 3300005615 Bacteria 7525
106 Ga0068852_100020749 3300005616 Bacteria 5228
107 Ga0068852_100264815 3300005616 Bacteria 1652
108 Ga0068852_102268896 3300005616 Bacteria 564
109 Ga0068859_100051867 3300005617 Bacteria 4124
110 Ga0068864_100001898 3300005618 Bacteria 17152
111 Ga0068866_10087119 3300005718 Bacteria 1691
112 Ga0068866_10795922 3300005718 Bacteria 657
113 Ga0068861_100004160 3300005719 Bacteria 9705
114 Ga0068851_10001023 3300005834 Bacteria 12145
115 Ga0068870_10002614 3300005840 Bacteria 7536
116 Ga0068863_100032827 3300005841 Bacteria 4946
117 Ga0068858_100014619 3300005842 Bacteria 7394
118 Ga0068858_101516856 3300005842 Bacteria 661
119 Ga0068860_100024192 3300005843 Bacteria 5872
120 Ga0068862_101296246 3300005844 Bacteria 729
121 Ga0081455_10000769 3300005937 Bacteria 41419
122 Ga0081455_10026586 3300005937 Bacteria 5318
123 Ga0081455_10027091 3300005937 Bacteria 5257
124 Ga0081455_10071741 3300005937 Bacteria 2869
125 Ga0081455_10330314 3300005937 Bacteria 1082
126 Ga0081455_10694514 3300005937 Bacteria 649
127 Ga0081540_1010215 3300005983 Bacteria 6376
128 Ga0081540_1039221 3300005983 Bacteria 2485
129 Ga0081539_10283512 3300005985 Bacteria 720
130 Ga0070717_10004466 3300006028 Bacteria 10108
131 Ga0070717_10310243 3300006028 Bacteria 1404
132 Ga0070717_10463177 3300006028 Bacteria 1143
133 Ga0070717_10506975 3300006028 Bacteria 1091
134 Ga0070717_11287235 3300006028 Bacteria 665
135 Ga0075365_10015754 3300006038 Bacteria 4579
136 Ga0075365_10062835 3300006038 Bacteria 2484
137 Ga0075365_10085419 3300006038 Bacteria 2143
138 Ga0075365_10348333 3300006038 Bacteria 1044
139 Ga0075365_10372319 3300006038 Bacteria 1007
140 Ga0075365_10898473 3300006038 Bacteria 624
141 Ga0075368_10007136 3300006042 Bacteria 3935
142 Ga0075368_10206675 3300006042 Bacteria 832
143 Ga0075363_100126371 3300006048 Bacteria 1432
144 Ga0075363_100207153 3300006048 Bacteria 1122
145 Ga0075364_10093296 3300006051 Bacteria 1999
146 Ga0075364_10099383 3300006051 Bacteria 1936
147 Ga0075364_10834607 3300006051 Bacteria 628
148 Ga0070715_10000347 3300006163 Bacteria 11579
149 Ga0070716_100130371 3300006173 Bacteria 1588
150 Ga0070712_100003016 3300006175 Bacteria 10420
151 Ga0070712_100026231 3300006175 Bacteria 3880
152 Ga0070712_100049430 3300006175 Bacteria 2920
153 Ga0070712_100152448 3300006175 Bacteria 1776
154 Ga0070712_100771182 3300006175 Bacteria 824
155 Ga0075362_10525645 3300006177 Bacteria 607
156 Ga0075367_10048184 3300006178 Bacteria 2509
157 Ga0075367_10088746 3300006178 Bacteria 1879
158 Ga0075367_10381039 3300006178 Bacteria 891
159 Ga0075369_10128996 3300006186 Bacteria 1148
160 Ga0075369_10269167 3300006186 Bacteria 793
161 Ga0075366_10120979 3300006195 Bacteria 1578
162 Ga0075366_10418658 3300006195 Bacteria 825
163 Ga0097621_100039768 3300006237 Bacteria 3779
164 Ga0097621_100245332 3300006237 Bacteria 1567
165 Ga0075370_10097419 3300006353 Bacteria 1700
166 Ga0075370_10196742 3300006353 Bacteria 1189
167 Ga0068871_100036846 3300006358 Bacteria 3896
168 Ga0068871_101152587 3300006358 Bacteria 726
169 Ga0075428_100018688 3300006844 Bacteria 7663
170 Ga0075428_100447242 3300006844 Bacteria 1384
171 Ga0075428_100598172 3300006844 Bacteria 1178
172 Ga0075430_100418142 3300006846 Bacteria 1106
173 Ga0075430_100631218 3300006846 Bacteria 884
174 Ga0075431_100026031 3300006847 Bacteria 5998
175 Ga0075431_100114412 3300006847 Bacteria 2785
176 Ga0075431_100166212 3300006847 Bacteria 2268
177 Ga0075431_100187329 3300006847 Bacteria 2121
178 Ga0075431_100797312 3300006847 Bacteria 918
179 Ga0075431_100820280 3300006847 Bacteria 903
180 Ga0075433_10479191 3300006852 Bacteria 1096
181 Ga0075433_10608007 3300006852 Bacteria 960
182 Ga0075434_100211613 3300006871 Bacteria 1959
183 Ga0075434_100587560 3300006871 Bacteria 1133
184 Ga0075434_101128435 3300006871 Bacteria 797
185 Ga0075429_100060029 3300006880 Bacteria 3313
186 Ga0075429_100267923 3300006880 Bacteria 1496
187 Ga0068865_100007834 3300006881 Bacteria 6592
188 Ga0075436_100345290 3300006914 Bacteria 1072
189 Ga0075436_100610970 3300006914 Bacteria 804
190 Ga0097620_100051867 3300006931 Bacteria 4124
191 Ga0075435_100408376 3300007076 Bacteria 1169
192 Ga0075435_100519269 3300007076 Bacteria 1030
193 Ga0075435_100646097 3300007076 Bacteria 918
194 Ga0099794_10026267 3300007265 Bacteria 2690
195 Ga0099795_10226539 3300007788 Bacteria 798
196 Ga0099795_10312214 3300007788 Bacteria 694
197 Ga0105251_10182659 3300009011 Bacteria 945
198 Ga0105250_10071617 3300009092 Bacteria 1400
199 Ga0105240_10006954 3300009093 Bacteria 16527
200 Ga0105240_10035911 3300009093 Bacteria 6382
201 Ga0111539_10087467 3300009094 Bacteria 3661
202 Ga0111539_10180712 3300009094 Bacteria 2464
203 Ga0111539_10276828 3300009094 Bacteria 1953
204 Ga0111539_10705305 3300009094 Bacteria 1175
205 Ga0105245_10006893 3300009098 Bacteria 9963
206 Ga0105245_10639676 3300009098 Bacteria 1093
207 Ga0105247_10018709 3300009101 Bacteria 4158
208 Ga0105247_10056074 3300009101 Bacteria 2433
209 Ga0114129_10001944 3300009147 Bacteria 28299
210 Ga0114129_10040151 3300009147 Bacteria 6597
211 Ga0114129_10098301 3300009147 Bacteria 4051
212 Ga0114129_10309335 3300009147 Bacteria 2104
213 Ga0114129_10311809 3300009147 Bacteria 2094
214 Ga0114129_10920400 3300009147 Bacteria 1107
215 Ga0114129_10934028 3300009147 Bacteria 1097
216 Ga0114129_11109634 3300009147 Bacteria 990
217 Ga0114129_12047534 3300009147 Bacteria 691
218 Ga0114129_12276415 3300009147 Bacteria 651
219 Ga0105243_10059727 3300009148 Bacteria 3044
220 Ga0105243_11399801 3300009148 Bacteria 720
221 Ga0105241_10070565 3300009174 Bacteria 2711
222 Ga0105241_10616775 3300009174 Bacteria 982
223 Ga0105241_12084520 3300009174 Bacteria 560
224 Ga0105242_11551883 3300009176 Bacteria 694
225 Ga0105248_10039250 3300009177 Bacteria 5302
226 Ga0105248_10339650 3300009177 Bacteria 1691
227 Ga0105237_10078259 3300009545 Bacteria 3296
228 Ga0105237_10082355 3300009545 Bacteria 3209
229 Ga0105237_10890373 3300009545 Bacteria 897
230 Ga0105238_10019670 3300009551 Bacteria 6875
231 Ga0105238_10021668 3300009551 Bacteria 6547
232 Ga0105238_10667567 3300009551 Bacteria 1050
233 Ga0105238_10843394 3300009551 Bacteria 933
234 Ga0105238_10882641 3300009551 Bacteria 912
235 Ga0105249_10050302 3300009553 Bacteria 3800
236 Ga0105249_10191404 3300009553 Bacteria 1997
237 Ga0105249_11007271 3300009553 Bacteria 902
238 Ga0099796_10135434 3300010159 Bacteria 958
239 Ga0105239_10009651 3300010375 Bacteria 10852
240 Ga0105239_10055003 3300010375 Bacteria 4365
241 Ga0105239_10359368 3300010375 Bacteria 1644
242 Ga0105239_10532646 3300010375 Bacteria 1337
243 Ga0105239_10665155 3300010375 Bacteria 1190
244 Ga0105246_10009628 3300011119 Bacteria 5954
245 Ga0105246_10100891 3300011119 Bacteria 2101
246 Ga0105246_10479358 3300011119 Bacteria 1052
247 Ga0105246_11048461 3300011119 Bacteria 741
248 Ga0105246_11919459 3300011119 Bacteria 569
249 Ga0157373_10842507 3300013100 Bacteria 678
250 Ga0157371_10184223 3300013102 Bacteria 1494
251 Ga0157374_12522509 3300013296 Bacteria 542
252 Ga0157378_12525043 3300013297 Bacteria 566
253 Ga0163162_10303286 3300013306 Bacteria 1729
254 Ga0163162_10380602 3300013306 Bacteria 1544
255 Ga0163162_10639657 3300013306 Bacteria 1188
256 Ga0157375_10010362 3300013308 Bacteria 8207
257 Ga0157375_10907229 3300013308 Bacteria 1025
258 Ga0163163_10027764 3300014325 Bacteria 5426
259 Ga0163163_10148238 3300014325 Bacteria 2390
260 Ga0163163_10764763 3300014325 Bacteria 1029
261 Ga0157377_10036245 3300014745 Bacteria 2713
262 Ga0157379_10043505 3300014968 Bacteria 4010
263 Ga0157376_10054684 3300014969 Bacteria 3329
264 Ga0157376_10875488 3300014969 Bacteria 915
265 Ga0182007_10074373 3300015262 Bacteria 1113
266 Ga0163161_10059714 3300017792 Bacteria 2774
267 Ga0163161_10271684 3300017792 Bacteria 1327
268 Ga0163161_10472499 3300017792 Bacteria 1017
269 Ga0213872_10085482 3300021361 Bacteria 1414
270 Ga0213876_10757198 3300021384 Bacteria 517
271 Ga0209758_1000385 3300025297 Bacteria 76280
272 Ga0209758_1004265 3300025297 Bacteria 12075
273 Ga0207656_10240644 3300025321 Bacteria 884
274 Ga0207692_10067001 3300025898 Bacteria 1878
275 Ga0207642_10279922 3300025899 Bacteria 959
276 Ga0207710_10008488 3300025900 Bacteria 4331
277 Ga0207710_10046672 3300025900 Bacteria 1934
278 Ga0207688_10000130 3300025901 Bacteria 31681
279 Ga0207688_10253502 3300025901 Bacteria 1066
280 Ga0207647_10002995 3300025904 Bacteria 12710
281 Ga0207685_10001506 3300025905 Bacteria 4920
282 Ga0207699_10022832 3300025906 Bacteria 3396
283 Ga0207645_10014020 3300025907 Bacteria 5376
284 Ga0207643_10001746 3300025908 Bacteria 12172
285 Ga0207684_10451734 3300025910 Bacteria 1103
286 Ga0207654_10001364 3300025911 Bacteria 12968
287 Ga0207707_10153694 3300025912 Bacteria 2012
288 Ga0207695_10017258 3300025913 Bacteria 8405
289 Ga0207695_10283663 3300025913 Bacteria 1550
290 Ga0207671_10045011 3300025914 Bacteria 3263
291 Ga0207671_10540728 3300025914 Bacteria 929
292 Ga0207693_10002125 3300025915 Bacteria 17286
293 Ga0207693_10003370 3300025915 Bacteria 13645
294 Ga0207693_10005879 3300025915 Bacteria 10179
295 Ga0207693_10156158 3300025915 Bacteria 1794
296 Ga0207693_10326082 3300025915 Bacteria 1202
297 Ga0207663_10049276 3300025916 Bacteria 2612
298 Ga0207663_10055204 3300025916 Bacteria 2491
299 Ga0207662_10016703 3300025918 Bacteria 4144
300 Ga0207662_10180055 3300025918 Bacteria 1360
301 Ga0207657_10301660 3300025919 Bacteria 1269
302 Ga0207657_11167377 3300025919 Bacteria 586
303 Ga0207652_10798608 3300025921 Bacteria 838
304 Ga0207646_10368961 3300025922 Bacteria 1297
305 Ga0207681_10500907 3300025923 Bacteria 994
306 Ga0207694_10000504 3300025924 Bacteria 35370
307 Ga0207650_10015384 3300025925 Bacteria 5327
308 Ga0207650_10017455 3300025925 Bacteria 5026
309 Ga0207650_11043340 3300025925 Bacteria 696
310 Ga0207659_10011589 3300025926 Bacteria 5576
311 Ga0207659_10078426 3300025926 Bacteria 2434
312 Ga0207687_10032174 3300025927 Bacteria 3551
313 Ga0207687_10274735 3300025927 Bacteria 1348
314 Ga0207700_10064281 3300025928 Bacteria 2794
315 Ga0207700_10093303 3300025928 Bacteria 2382
316 Ga0207700_10115523 3300025928 Bacteria 2167
317 Ga0207700_10125092 3300025928 Bacteria 2090
318 Ga0207700_10475692 3300025928 Bacteria 1103
319 Ga0207700_11293933 3300025928 Bacteria 650
320 Ga0207664_10097999 3300025929 Bacteria 2417
321 Ga0207664_11187934 3300025929 Bacteria 681
322 Ga0207644_10070322 3300025931 Bacteria 2558
323 Ga0207644_10083692 3300025931 Bacteria 2363
324 Ga0207644_10151584 3300025931 Bacteria 1794
325 Ga0207706_10086505 3300025933 Bacteria 2755
326 Ga0207709_10897398 3300025935 Bacteria 720
327 Ga0207670_10127149 3300025936 Bacteria 1861
328 Ga0207670_10191560 3300025936 Bacteria 1548
329 Ga0207669_10090581 3300025937 Bacteria 1989
330 Ga0207669_10265902 3300025937 Bacteria 1285
331 Ga0207704_10012092 3300025938 Bacteria 4275
332 Ga0207665_10000889 3300025939 Bacteria 20183
333 Ga0207665_10216365 3300025939 Bacteria 1402
334 Ga0207691_10000921 3300025940 Bacteria 29187
335 Ga0207691_10423938 3300025940 Bacteria 1134
336 Ga0207711_10256251 3300025941 Bacteria 1607
337 Ga0207689_10000756 3300025942 Bacteria 31021
338 Ga0207661_10522995 3300025944 Bacteria 1085
339 Ga0207679_10213802 3300025945 Bacteria 1619
340 Ga0207679_10313273 3300025945 Bacteria 1356
341 Ga0207667_10003168 3300025949 Bacteria 20350
342 Ga0207667_10111596 3300025949 Bacteria 2820
343 Ga0207667_10332679 3300025949 Bacteria 1551
344 Ga0207667_11098230 3300025949 Bacteria 779
345 Ga0207651_10058696 3300025960 Bacteria 2660
346 Ga0207712_10012542 3300025961 Bacteria 5415
347 Ga0207712_10142335 3300025961 Bacteria 1842
348 Ga0207712_10338272 3300025961 Bacteria 1247
349 Ga0207668_10152483 3300025972 Bacteria 1791
350 Ga0207640_10006934 3300025981 Bacteria 6232
351 Ga0207677_10003059 3300026023 Bacteria 8845
352 Ga0207703_10009970 3300026035 Bacteria 7451
353 Ga0207703_10530181 3300026035 Bacteria 1108
354 Ga0207639_10014458 3300026041 Bacteria 5553
355 Ga0207639_10074048 3300026041 Bacteria 2673
356 Ga0207639_11078408 3300026041 Bacteria 753
357 Ga0207678_10061639 3300026067 Bacteria 3226
358 Ga0207678_10493028 3300026067 Bacteria 1067
359 Ga0207708_10000567 3300026075 Bacteria 28570
360 Ga0207702_10000093 3300026078 Bacteria 103678
361 Ga0207702_10021704 3300026078 Bacteria 5316
362 Ga0207702_10781685 3300026078 Bacteria 943
363 Ga0207641_10027274 3300026088 Bacteria 4717
364 Ga0207648_10005442 3300026089 Bacteria 12831
365 Ga0207648_11210163 3300026089 Bacteria 709
366 Ga0207676_10006676 3300026095 Bacteria 8161
367 Ga0207674_10002601 3300026116 Bacteria 22677
368 Ga0207674_10007742 3300026116 Bacteria 12504
369 Ga0207674_10415934 3300026116 Bacteria 1299
370 Ga0207675_100004334 3300026118 Bacteria 13711
371 Ga0207683_10005967 3300026121 Bacteria 10435
372 Ga0207683_10311426 3300026121 Bacteria 1441
373 Ga0207698_10018326 3300026142 Bacteria 4768
374 Ga0209813_10181121 3300027866 Bacteria 771
375 Ga0209813_10181783 3300027866 Bacteria 770
376 Ga0207428_10131921 3300027907 Bacteria 1911
377 Ga0268266_10444335 3300028379 Bacteria 1232
378 Ga0268266_10925088 3300028379 Bacteria 843
379 Ga0268265_10004767 3300028380 Bacteria 9353
380 Ga0268264_10109846 3300028381 Bacteria 2413
381 Ga0265762_1032358 3300030760 Bacteria 998
382 Ga0265763_1000350 3300030763 Bacteria 2658
383 Ga0265760_10058314 3300031090 Bacteria 1170
384 Ga0265332_10108740 3300031238 Bacteria 1168
385 Ga0265325_10007216 3300031241 Bacteria 6682
386 Ga0265325_10048161 3300031241 Bacteria 2204
387 Ga0265325_10117224 3300031241 Bacteria 1287
388 Ga0265340_10189811 3300031247 Bacteria 927
389 Ga0265331_10262757 3300031250 Bacteria 774
390 Ga0265331_10583387 3300031250 Bacteria 505
391 Ga0373958_0010083 3300034819 Bacteria 1568
392 Ga0373926_0180952 3300035083 Bacteria 808
393 Ga0373944_0010821 3300035089 Bacteria 2492
394 Ga0373944_0172290 3300035089 Bacteria 772
395 Ga0373949_0045077 3300035090 Bacteria 1096
396 Ga0373923_0304996 3300035111 Bacteria 754
397 Ga0373936_0009948 3300035113 Bacteria 3589
398 Ga0373936_0027118 3300035113 Bacteria 2247
399 Ga0373939_0022027 3300035114 Bacteria 1752
400 Ga0373939_0216835 3300035114 Bacteria 731
401 Ga0373945_0089338 3300035116 Bacteria 1191
402 Ga0373957_0459526 3300035120 Bacteria 552
403 Ga0373960_0015216 3300035121 Bacteria 1960
404 Ga0373943_0003811 3300035170 Bacteria 6850
405 Ga0373943_0039562 3300035170 Bacteria 2272
406 Ga0373943_0061670 3300035170 Bacteria 1875
407 Ga0373946_0046370 3300035171 Bacteria 1801
408 Ga0373946_0430229 3300035171 Bacteria 670
409 Ga0373946_0438765 3300035171 Bacteria 663
410 Ga0373946_0649064 3300035171 Bacteria 549
411 Ga0373955_0388214 3300035172 Bacteria 848
412 Ga0373955_0534036 3300035172 Bacteria 717
413 Ga0373942_0264297 3300035207 Bacteria 588
414 Ga0373961_0023086 3300035241 Bacteria 1670
415 Ga0373931_0008972 3300035691 Bacteria 4766
416 Ga0373931_0603333 3300035691 Bacteria 718
417 Ga0373935_0026553 3300035692 Bacteria 3574
418 Ga0373935_0264869 3300035692 Bacteria 1206
419 Ga0373935_0486712 3300035692 Bacteria 894
420 Ga0373927_0006272 3300035695 Bacteria 8117
421 Ga0373927_0017150 3300035695 Bacteria 4771
422 Ga0373927_0080673 3300035695 Bacteria 2108
423 Ga0373927_0210608 3300035695 Bacteria 1277
424 Ga0373927_0868201 3300035695 Bacteria 596
425 Ga0373947_0000419 3300035725 Bacteria 24144
426 Ga0373947_0011663 3300035725 Bacteria 5042
427 Ga0373947_0020175 3300035725 Bacteria 3846
428 Ga0373947_0680399 3300035725 Bacteria 702
429 Ga0373937_0840773 3300036401 Bacteria 866
430 Ga0373937_1913999 3300036401 Bacteria 539
431 Ga0373925_0001403 3300037068 Bacteria 20944
432 Ga0373925_0116397 3300037068 Bacteria 2070
433 Ga0373925_0235140 3300037068 Bacteria 1466
434 Ga0373925_0565249 3300037068 Bacteria 936
435 Ga0395900_0231768 3300037418 Bacteria 1857
436 Ga0395905_0040581 3300037471 Bacteria 4367
437 Ga0395901_1555467 3300038443 Bacteria 616
438 Ga0436365_0176812 3300039437 Bacteria 786
439 Ga0436365_0789682 3300039437 Bacteria 1831
440 Ga0436361_1147554 3300039447 Bacteria 2768
441 Ga0436362_0362248 3300039453 Bacteria 882
442 Ga0451798_0810439 3300041458 Bacteria 583
443 Ga0451851_0085469 3300041507 Bacteria 749
444 Ga0450905_068443 3300042142 Bacteria 603
445 Ga0495627_130232 3300046453 Bacteria 708
446 Ga0495592_0026300 3300046454 Bacteria 4413
447 Ga0495592_0338382 3300046454 Bacteria 968
448 Ga0495592_0619412 3300046454 Bacteria 658
449 Ga0495603_0226776 3300046455 Bacteria 1077
450 Ga0495590_0035344 3300046457 Bacteria 1745
451 Ga0495629_0072255 3300046459 Bacteria 2408
452 Ga0495629_0350292 3300046459 Bacteria 1007
453 Ga0495629_0524935 3300046459 Bacteria 796
454 Ga0495638_0013417 3300046460 Bacteria 5579
455 Ga0495638_0357851 3300046460 Bacteria 769
456 Ga0495651_0065195 3300046462 Bacteria 2782
457 Ga0495580_0114698 3300046472 Bacteria 1871
458 Ga0495582_0022260 3300046473 Bacteria 3468
459 Ga0495639_0021411 3300046475 Bacteria 2830
460 Ga0495662_0022416 3300046476 Bacteria 3049
461 Ga0495662_0084754 3300046476 Bacteria 1543
462 Ga0495662_0188808 3300046476 Bacteria 1016
463 Ga0495664_0000928 3300046477 Bacteria 15124
464 Ga0495584_0046457 3300046491 Bacteria 2190
465 Ga0495584_0090870 3300046491 Bacteria 1540
466 Ga0495584_0342101 3300046491 Bacteria 760
467 Ga0495584_0474274 3300046491 Bacteria 637
468 Ga0495585_0459521 3300046492 Bacteria 608
469 Ga0495594_0090445 3300046499 Bacteria 1715
470 Ga0495607_0176934 3300046501 Bacteria 1073
471 Ga0495607_0248075 3300046501 Bacteria 858
472 Ga0495608_0567507 3300046511 Unclassified 683
473 Ga0495618_0003037 3300046514 Bacteria 10604
474 Ga0495618_0012973 3300046514 Bacteria 5066
475 Ga0495618_0130082 3300046514 Bacteria 1611
476 Ga0495630_0007927 3300046517 Bacteria 7618
477 Ga0495630_0056535 3300046517 Bacteria 2940
478 Ga0495630_0117955 3300046517 Bacteria 2012
479 Ga0495631_0097704 3300046518 Bacteria 1264
480 Ga0495632_0160735 3300046519 Bacteria 1035
481 Ga0495637_0030126 3300046520 Bacteria 2408
482 Ga0495637_0267574 3300046520 Bacteria 612
483 Ga0495663_0083468 3300046525 Bacteria 1032
484 Ga0495666_0021630 3300046526 Bacteria 3184
485 Ga0495652_0022851 3300046529 Bacteria 5548
486 Ga0495652_0113709 3300046529 Bacteria 2173
487 Ga0495652_0265172 3300046529 Bacteria 1266
488 Ga0495654_0411620 3300046530 Bacteria 536
489 Ga0495665_0010010 3300046531 Bacteria 5137
490 Ga0495640_0004705 3300046533 Bacteria 10876
491 Ga0495640_0044696 3300046533 Bacteria 3078
492 Ga0495640_0141190 3300046533 Bacteria 1552
493 Ga0495587_0345236 3300046536 Bacteria 830
494 Ga0495598_0000289 3300046537 Bacteria 9097
495 Ga0495609_0223143 3300046538 Bacteria 782
496 Ga0495645_0750843 3300046543 Bacteria 589
497 Ga0495622_0418745 3300046557 Bacteria 576
498 Ga0495633_0052880 3300046558 Bacteria 1912
499 Ga0495667_0221824 3300046559 Bacteria 1206
500 Ga0495656_0051811 3300046615 Bacteria 1758
501 Ga0495656_0122307 3300046615 Bacteria 1230
502 Ga0495656_0687676 3300046615 Bacteria 550
503 Ga0495668_0026470 3300046616 Bacteria 3291
504 Ga0495668_0141666 3300046616 Bacteria 1316
505 Ga0495634_0023534 3300046642 Bacteria 4327
506 Ga0495634_0085680 3300046642 Bacteria 2053
507 Ga0495634_0103673 3300046642 Bacteria 1835
508 Ga0495634_0115327 3300046642 Bacteria 1724
509 Ga0495635_0011699 3300046663 Bacteria 6151
510 Ga0495635_0016348 3300046663 Bacteria 5180
511 Ga0495635_0077320 3300046663 Bacteria 2280
512 Ga0495659_0058184 3300046664 Bacteria 1422
513 Ga0495599_0414773 3300046678 Bacteria 801
514 Ga0495623_0409141 3300046679 Bacteria 728
515 Ga0495646_0221481 3300046680 Bacteria 1023
516 Ga0495647_0016756 3300046681 Bacteria 2586
517 Ga0495647_0148114 3300046681 Bacteria 1005
518 Ga0495658_0054559 3300046683 Bacteria 2274
519 Ga0495613_0169643 3300046689 Bacteria 1549
520 Ga0495624_0002027 3300046690 Bacteria 15429
521 Ga0495624_0054853 3300046690 Bacteria 2512
522 Ga0495624_0384216 3300046690 Bacteria 843
523 Ga0495670_0012262 3300046691 Bacteria 4215
524 Ga0495670_0375256 3300046691 Bacteria 767
525 Ga0495671_0168754 3300046692 Bacteria 1064
526 Ga0495671_0199024 3300046692 Bacteria 972
527 Ga0495649_0042518 3300046694 Bacteria 2483
528 Ga0495589_0279191 3300046794 Bacteria 777
529 Ga0495589_0488959 3300046794 Bacteria 562
530 Ga0495600_0057600 3300046809 Bacteria 2538
531 Ga0495581_0006507 3300047315 Bacteria 6776
532 Ga0495581_0129571 3300047315 Bacteria 1470
533 Ga0495604_0069037 3300047317 Bacteria 2680
534 Ga0495674_0015010 3300047319 Bacteria 7249
535 Ga0495674_0492064 3300047319 Bacteria 982
536 Ga0495676_0031123 3300047321 Bacteria 4517
537 Ga0495676_0092252 3300047321 Bacteria 2261
538 Ga0495676_0131485 3300047321 Bacteria 1806
539 Ga0495676_0331100 3300047321 Bacteria 1021
540 Ga0495683_0403226 3300047323 Bacteria 568
541 Ga0495684_0003842 3300047471 Bacteria 11702
542 Ga0495684_0017704 3300047471 Bacteria 5487
543 Ga0495684_0278542 3300047471 Bacteria 1207
544 Ga0495684_0396369 3300047471 Bacteria 970
545 Ga0495593_0017938 3300047673 Bacteria 3983
546 Ga0495593_0378130 3300047673 Bacteria 708
547 Ga0495602_0538703 3300048088 Bacteria 811
548 Ga0495614_0613777 3300048089 Bacteria 523
549 Ga0495615_0066822 3300048090 Bacteria 961
550 Ga0495626_0260019 3300048091 Bacteria 694
551 Ga0496100_0002071 3300048903 Bacteria 10079
552 Ga0496100_0010711 3300048903 Bacteria 5201
553 Ga0496100_0041213 3300048903 Bacteria 2942
554 Ga0496100_0510663 3300048903 Bacteria 927
555 Ga0496100_0668737 3300048903 Bacteria 809
556 Ga0496101_0008555 3300048904 Bacteria 6689
557 Ga0496101_0015090 3300048904 Bacteria 5199
558 Ga0496101_0065851 3300048904 Bacteria 2641
559 Ga0496101_0515159 3300048904 Bacteria 945
560 Ga0496102_0001429 3300048905 Bacteria 21190
561 Ga0496102_0025109 3300048905 Bacteria 5300
562 Ga0496102_0276486 3300048905 Bacteria 1583
563 Ga0496102_0555998 3300048905 Bacteria 1070
564 Ga0496102_0893814 3300048905 Bacteria 810
565 Ga0496102_1058324 3300048905 Bacteria 731
566 Ga0496103_0007492 3300048906 Bacteria 6503
567 Ga0496103_0010187 3300048906 Bacteria 5558
568 Ga0496103_0136741 3300048906 Bacteria 1566
569 Ga0496103_0340324 3300048906 Bacteria 965
570 Ga0496104_0001675 3300048907 Bacteria 19135
571 Ga0496104_0002135 3300048907 Bacteria 17161
572 Ga0496104_0005707 3300048907 Bacteria 10889
573 Ga0496104_0008597 3300048907 Bacteria 9080
574 Ga0496104_0018812 3300048907 Bacteria 6310
575 Ga0496104_0164548 3300048907 Bacteria 2127
576 Ga0496104_0826189 3300048907 Bacteria 832
577 Ga0496105_0002427 3300048908 Bacteria 13506
578 Ga0496105_0009393 3300048908 Bacteria 7648
579 Ga0496105_0015808 3300048908 Bacteria 6020
580 Ga0496105_0017970 3300048908 Bacteria 5675
581 Ga0496105_0019401 3300048908 Bacteria 5484
582 Ga0496105_0268326 3300048908 Bacteria 1379
583 Ga0496106_0014475 3300048909 Bacteria 5828
584 Ga0496106_0018044 3300048909 Bacteria 5217
585 Ga0496106_0036897 3300048909 Bacteria 3655
586 Ga0496106_0257040 3300048909 Bacteria 1397
587 Ga0496106_0466686 3300048909 Bacteria 1014
588 Ga0496107_0002699 3300048910 Bacteria 11626
589 Ga0496107_0180414 3300048910 Bacteria 1568
590 Ga0496107_0271921 3300048910 Bacteria 1261
591 Ga0496108_0003780 3300048911 Bacteria 12116
592 Ga0496108_0018895 3300048911 Bacteria 5651
593 Ga0496108_0192772 3300048911 Bacteria 1766
594 Ga0496108_0987788 3300048911 Bacteria 719
595 Ga0496109_0002529 3300048912 Bacteria 15326
596 Ga0496109_0006297 3300048912 Bacteria 9990
597 Ga0496109_0423455 3300048912 Bacteria 1258
598 Ga0496110_0018457 3300048913 Bacteria 5850
599 Ga0496110_0026273 3300048913 Bacteria 4979
600 Ga0496110_0131948 3300048913 Bacteria 2256
601 Ga0496110_0341463 3300048913 Bacteria 1364
602 Ga0496110_0454478 3300048913 Bacteria 1167
603 Ga0496111_0005574 3300048914 Bacteria 8092
604 Ga0496111_0218797 3300048914 Bacteria 1415
605 Ga0496111_0295120 3300048914 Bacteria 1202
606 Ga0496112_0001666 3300048915 Bacteria 17271
607 Ga0496112_0007677 3300048915 Bacteria 9597
608 Ga0496112_0151374 3300048915 Bacteria 2287
609 Ga0496112_0492739 3300048915 Bacteria 1161
610 Ga0496112_0650042 3300048915 Bacteria 984
611 Ga0496113_0001223 3300048916 Bacteria 14099
612 Ga0496113_0003026 3300048916 Bacteria 9964
613 Ga0496113_0876445 3300048916 Bacteria 711
614 Ga0496114_0001258 3300048917 Bacteria 19186
615 Ga0496114_0004304 3300048917 Bacteria 11016
616 Ga0496114_0077244 3300048917 Bacteria 2807
617 Ga0496114_0338000 3300048917 Bacteria 1331
618 Ga0496114_0870397 3300048917 Bacteria 781
619 Ga0496115_0025296 3300048918 Bacteria 4621
620 Ga0496115_0032583 3300048918 Bacteria 4111
621 Ga0496115_0084156 3300048918 Bacteria 2593
622 Ga0496115_0401806 3300048918 Bacteria 1111
623 Ga0496115_0421557 3300048918 Bacteria 1081
624 Ga0496115_0791759 3300048918 Bacteria 739
625 Ga0496124_0798143 3300048927 Bacteria 585
626 Ga0501031_0563034 3300049568 Bacteria 734
627 Ga0501033_0233888 3300049570 Bacteria 1305
628 Ga0501034_0060536 3300049571 Bacteria 3803
629 Ga0501036_1245390 3300049572 Bacteria 606
630 Ga0501039_0245895 3300049575 Bacteria 1407
631 Ga0501040_0905930 3300049576 Bacteria 639
632 Ga0501041_0566256 3300049577 Bacteria 724
633 Ga0501042_0369037 3300049578 Bacteria 1039
634 Ga0501046_0151885 3300049580 Bacteria 1747
635 Ga0501048_0258445 3300049582 Bacteria 1237
636 Ga0501067_0588477 3300049583 Bacteria 624
637 Ga0501072_0142294 3300049588 Bacteria 1913
638 Ga0501072_0261557 3300049588 Bacteria 1377
639 Ga0501072_0418095 3300049588 Bacteria 1063
640 Ga0501072_1165409 3300049588 Bacteria 599
641 Ga0501073_0084180 3300049589 Bacteria 2213
642 Ga0501073_0277749 3300049589 Bacteria 1156
643 Ga0501075_0897123 3300049591 Bacteria 674
644 Ga0501075_1382130 3300049591 Bacteria 533
645 Ga0501076_0123386 3300049592 Bacteria 2098
646 Ga0501076_0543416 3300049592 Bacteria 958
647 Ga0501077_0126808 3300049593 Bacteria 1618
648 Ga0501077_0281657 3300049593 Bacteria 1058
649 Ga0501077_0419805 3300049593 Unclassified 856
650 Ga0501079_0412571 3300049741 Bacteria 1059
651 Ga0501079_0979742 3300049741 Bacteria 666
652 Ga0501080_0013702 3300049742 Bacteria 7467
653 Ga0501080_1383484 3300049742 Bacteria 601
654 Ga0501081_0959004 3300049743 Unclassified 646
655 Ga0501083_0066368 3300049744 Bacteria 2402
656 Ga0501083_0211543 3300049744 Bacteria 1264
657 Ga0501044_0331722 3300049823 Bacteria 1444
658 nmdc:mga03n38_255287_c1 3300050490 Bacteria 927
659 nmdc:mga00v17_383335_c1 3300050491 Bacteria 914
660 nmdc:mga00v17_95964_c1 3300050491 Bacteria 1867
661 nmdc:mga0yw44_15992_c1 3300050492 Bacteria 4040
662 nmdc:mga0yw44_361726_c1 3300050492 Bacteria 978
663 nmdc:mga0yw44_415607_c1 3300050492 Bacteria 910
664 nmdc:mga0yw44_4458_c1 3300050492 Bacteria 6424
665 nmdc:mga0yw44_7144_c1 3300050492 Bacteria 5469
666 nmdc:mga0k408_412483_c1 3300050493 Bacteria 803
667 nmdc:mga0k408_739417_c1 3300050493 Bacteria 575
668 nmdc:mga0k408_82207_c1 3300050493 Bacteria 1887
669 nmdc:mga06z11_167724_c1 3300050494 Bacteria 1259
670 nmdc:mga06z11_756488_c1 3300050494 Bacteria 592
671 nmdc:mga04h51_129024_c1 3300050495 Bacteria 949
672 nmdc:mga04h51_208768_c1 3300050495 Bacteria 770
673 nmdc:mga07m45_145133_c1 3300050496 Bacteria 1375
674 nmdc:mga07m45_238218_c1 3300050496 Bacteria 1059
675 nmdc:mga05p37_1138298_c1 3300050507 Bacteria 813
676 nmdc:mga05p37_21683_c1 3300050507 Bacteria 7782
677 nmdc:mga05p37_4437_c1 3300050507 Bacteria 16397
678 nmdc:mga05p37_473675_c1 3300050507 Bacteria 1444
679 nmdc:mga05p37_773776_c1 3300050507 Bacteria 1054
680 nmdc:mga05p37_873250_c1 3300050507 Bacteria 974
681 nmdc:mga09592_202839_c1 3300050508 Bacteria 1717
682 nmdc:mga09592_963584_c1 3300050508 Bacteria 715
683 nmdc:mga0qj67_172638_c1 3300050509 Bacteria 1756
684 nmdc:mga0qj67_537601_c1 3300050509 Bacteria 938
685 nmdc:mga06r32_113815_c1 3300050510 Bacteria 2663
686 nmdc:mga06r32_394091_c1 3300050510 Bacteria 1367
687 nmdc:mga06r32_737585_c1 3300050510 Bacteria 949
688 nmdc:mga06r32_934007_c1 3300050510 Bacteria 823
689 nmdc:mga08y16_1194130_c1 3300050511 Bacteria 732
690 nmdc:mga08y16_1248479_c1 3300050511 Bacteria 712
691 nmdc:mga08y16_1527656_c1 3300050511 Bacteria 627
692 nmdc:mga08y16_195830_c1 3300050511 Bacteria 2095
693 nmdc:mga08y16_202302_c1 3300050511 Bacteria 2058
694 nmdc:mga0n895_1458161_c1 3300050512 Bacteria 652
695 nmdc:mga0n895_261831_c1 3300050512 Bacteria 1755
696 nmdc:mga0n895_267749_c1 3300050512 Bacteria 1733
697 nmdc:mga0rr50_168948_c1 3300050513 Bacteria 1780
698 nmdc:mga0rr50_270368_c1 3300050513 Bacteria 1416
699 nmdc:mga0rr50_623036_c1 3300050513 Bacteria 920
700 nmdc:mga08x19_310475_c1 3300050514 Bacteria 1096
701 nmdc:mga0a205_120098_c1 3300050515 Bacteria 2527
702 nmdc:mga0a205_470946_c1 3300050515 Bacteria 1115
703 nmdc:mga0sz30_131949_c1 3300050516 Bacteria 1101
704 Ga0495601_0005944 3300053077 Bacteria 7118
705 Ga0495612_0000842 3300053078 Bacteria 12454
706 Ga0495612_0072046 3300053078 Bacteria 1442
707 Ga0495612_0363183 3300053078 Bacteria 655
708 Ga0495595_0061269 3300053084 Bacteria 1762
709 Ga0495619_0001378 3300053085 Bacteria 15980
710 Ga0495619_0034104 3300053085 Bacteria 3308
711 Ga0495619_0052965 3300053085 Bacteria 2683
712 Ga0500566_0496325 3300053094 Bacteria 526
713 Ga0500593_019045 3300053117 Bacteria 3000
714 Ga0500658_0305120 3300053134 Bacteria 732
715 Ga0500568_0244108 3300053139 Bacteria 654
716 Ga0501084_0064064 3300054114 Bacteria 3077
717 Ga0501082_0324303 3300060353 Bacteria 1342
718 Ga0501082_0411039 3300060353 Bacteria 1181
719 Ga0501082_1663250 3300060353 Bacteria 557
720 Ga0530510_0086663 3300061734 Bacteria 2282
721 Ga0530510_0160064 3300061734 Bacteria 1665
722 Ga0530510_0303606 3300061734 Bacteria 1195
723 Ga0530510_1035324 3300061734 Bacteria 628
724 Ga0207703_11515798
725 JGI24746J21847_1009959
726 JGI24740J21852_10021354
727 JGI24739J22299_10001456
728 JGI24739J22299_10026087
729 JGI24739J22299_10054087
730 JGI24737J22298_10005128
731 JGI24743J22301_10006212
732 JGI24735J21928_10030385
733 JGI24750J21931_1002228
734 JGI24745J21846_1016970
735 JGI24749J21850_1001515
736 JGI24742J22300_10001318
737 JGI25153J46596_10003743
738 JGI25405J52794_10005737
739 JGI25405J52794_10017813
740 Ga0070676_10024663
741 Ga0070683_100174960
742 Ga0070690_100007563
743 Ga0070670_100008735
744 Ga0070670_100167148
745 Ga0070670_100800311
746 Ga0068869_100345513
747 Ga0068869_100700498
748 Ga0070680_101529646
749 Ga0070682_100044190
750 Ga0070682_100234067
751 Ga0068868_101574862
752 Ga0070660_100494236
753 Ga0070689_100000967
754 Ga0070689_100642890
755 Ga0070691_10044964
756 Ga0070687_100009878
757 Ga0070661_100372238
758 Ga0070668_100052238
759 Ga0070669_100007946
760 Ga0070675_100037093
761 Ga0070675_101819622
762 Ga0070671_100032872
763 Ga0070671_100110878
764 Ga0070674_100042825
765 Ga0070673_100074272
766 Ga0070673_100682654
767 Ga0070673_101529898
768 Ga0070688_100019094
769 Ga0070667_100019000
770 Ga0070709_10002556
771 Ga0070714_100237929
772 Ga0070714_100912844
773 Ga0070713_100133988
774 Ga0070713_100228106
775 Ga0070713_100237362
776 Ga0070713_100271331
777 Ga0070713_100462208
778 Ga0070713_100476582
779 Ga0070713_100696509
780 Ga0070710_10003499
781 Ga0070701_10025963
782 Ga0070711_100036598
783 Ga0070711_100063104
784 Ga0070711_100097037
785 Ga0070705_100158313
786 Ga0070694_100594920
787 Ga0070663_100013120
788 Ga0070663_100246294
789 Ga0070678_100145198
790 Ga0070662_100002162
791 Ga0070662_101019197
792 Ga0070681_10185503
793 Ga0070681_11129256
794 Ga0068867_100013198
795 Ga0068867_101813053
796 Ga0070685_10009064
797 Ga0070706_100305606
798 Ga0070706_100397810
799 Ga0070699_100005593
800 Ga0070699_100328365
801 Ga0070699_101550368
802 Ga0070679_100114213
803 Ga0070684_100660322
804 Ga0070697_100189731
805 Ga0070697_100480935
806 Ga0068853_100012248
807 Ga0068853_100026914
808 Ga0068853_100110036
809 Ga0068853_100425948
810 Ga0070672_100413511
811 Ga0070686_100040654
812 Ga0070686_100238448
813 Ga0070696_100667241
814 Ga0070693_100674583
815 Ga0070665_100201713
816 Ga0068855_100089590
817 Ga0068855_100490801
818 Ga0068855_100571405
819 Ga0068855_101807440
820 Ga0070664_100009552
821 Ga0070664_100403123
822 Ga0068857_100008808
823 Ga0068857_100184714
824 Ga0068857_100311230
825 Ga0068854_100063790
826 Ga0068856_100017571
827 Ga0068856_100251661
828 Ga0070702_100002923
829 Ga0068852_100020749
830 Ga0068852_100264815
831 Ga0068852_102268896
832 Ga0068859_100051867
833 Ga0068864_100001898
834 Ga0068866_10087119
835 Ga0068866_10795922
836 Ga0068861_100004160
837 Ga0068851_10001023
838 Ga0068870_10002614
839 Ga0068863_100032827
840 Ga0068858_100014619
841 Ga0068858_101516856
842 Ga0068860_100024192
843 Ga0068862_101296246
844 Ga0081455_10000769
845 Ga0081455_10026586
846 Ga0081455_10027091
847 Ga0081455_10071741
848 Ga0081455_10330314
849 Ga0081455_10694514
850 Ga0081540_1010215
851 Ga0081540_1039221
852 Ga0081539_10283512
853 Ga0070717_10004466
854 Ga0070717_10310243
855 Ga0070717_10463177
856 Ga0070717_10506975
857 Ga0070717_11287235
858 Ga0075365_10015754
859 Ga0075365_10062835
860 Ga0075365_10085419
861 Ga0075365_10348333
862 Ga0075365_10372319
863 Ga0075365_10898473
864 Ga0075368_10007136
865 Ga0075368_10206675
866 Ga0075363_100126371
867 Ga0075363_100207153
868 Ga0075364_10093296
869 Ga0075364_10099383
870 Ga0075364_10834607
871 Ga0070715_10000347
872 Ga0070716_100130371
873 Ga0070712_100003016
874 Ga0070712_100026231
875 Ga0070712_100049430
876 Ga0070712_100152448
877 Ga0070712_100771182
878 Ga0075362_10525645
879 Ga0075367_10048184
880 Ga0075367_10088746
881 Ga0075367_10381039
882 Ga0075369_10128996
883 Ga0075369_10269167
884 Ga0075366_10120979
885 Ga0075366_10418658
886 Ga0097621_100039768
887 Ga0097621_100245332
888 Ga0075370_10097419
889 Ga0075370_10196742
890 Ga0068871_100036846
891 Ga0068871_101152587
892 Ga0075428_100018688
893 Ga0075428_100447242
894 Ga0075428_100598172
895 Ga0075430_100418142
896 Ga0075430_100631218
897 Ga0075431_100026031
898 Ga0075431_100114412
899 Ga0075431_100166212
900 Ga0075431_100187329
901 Ga0075431_100797312
902 Ga0075431_100820280
903 Ga0075433_10479191
904 Ga0075433_10608007
905 Ga0075434_100211613
906 Ga0075434_100587560
907 Ga0075434_101128435
908 Ga0075429_100060029
909 Ga0075429_100267923
910 Ga0068865_100007834
911 Ga0075436_100345290
912 Ga0075436_100610970
913 Ga0097620_100051867
914 Ga0075435_100408376
915 Ga0075435_100519269
916 Ga0075435_100646097
917 Ga0099794_10026267
918 Ga0099795_10226539
919 Ga0099795_10312214
920 Ga0105251_10182659
921 Ga0105250_10071617
922 Ga0105240_10006954
923 Ga0105240_10035911
924 Ga0111539_10087467
925 Ga0111539_10180712
926 Ga0111539_10276828
927 Ga0111539_10705305
928 Ga0105245_10006893
929 Ga0105245_10639676
930 Ga0105247_10018709
931 Ga0105247_10056074
932 Ga0114129_10001944
933 Ga0114129_10040151
934 Ga0114129_10098301
935 Ga0114129_10309335
936 Ga0114129_10311809
937 Ga0114129_10920400
938 Ga0114129_10934028
939 Ga0114129_11109634
940 Ga0114129_12047534
941 Ga0114129_12276415
942 Ga0105243_10059727
943 Ga0105243_11399801
944 Ga0105241_10070565
945 Ga0105241_10616775
946 Ga0105241_12084520
947 Ga0105242_11551883
948 Ga0105248_10039250
949 Ga0105248_10339650
950 Ga0105237_10078259
951 Ga0105237_10082355
952 Ga0105237_10890373
953 Ga0105238_10019670
954 Ga0105238_10021668
955 Ga0105238_10667567
956 Ga0105238_10843394
957 Ga0105238_10882641
958 Ga0105249_10050302
959 Ga0105249_10191404
960 Ga0105249_11007271
961 Ga0099796_10135434
962 Ga0105239_10009651
963 Ga0105239_10055003
964 Ga0105239_10359368
965 Ga0105239_10532646
966 Ga0105239_10665155
967 Ga0105246_10009628
968 Ga0105246_10100891
969 Ga0105246_10479358
970 Ga0105246_11048461
971 Ga0105246_11919459
972 Ga0157373_10842507
973 Ga0157371_10184223
974 Ga0157374_12522509
975 Ga0157378_12525043
976 Ga0163162_10303286
977 Ga0163162_10380602
978 Ga0163162_10639657
979 Ga0157375_10010362
980 Ga0157375_10907229
981 Ga0163163_10027764
982 Ga0163163_10148238
983 Ga0163163_10764763
984 Ga0157377_10036245
985 Ga0157379_10043505
986 Ga0157376_10054684
987 Ga0157376_10875488
988 Ga0182007_10074373
989 Ga0163161_10059714
990 Ga0163161_10271684
991 Ga0163161_10472499
992 Ga0213872_10085482
993 Ga0213876_10757198
994 Ga0209758_1000385
995 Ga0209758_1004265
996 Ga0207656_10240644
997 Ga0207692_10067001
998 Ga0207642_10279922
999 Ga0207710_10008488
1000 Ga0207710_10046672
1001 Ga0207688_10000130
1002 Ga0207688_10253502
1003 Ga0207647_10002995
1004 Ga0207685_10001506
1005 Ga0207699_10022832
1006 Ga0207645_10014020
1007 Ga0207643_10001746
1008 Ga0207684_10451734
1009 Ga0207654_10001364
1010 Ga0207707_10153694
1011 Ga0207695_10017258
1012 Ga0207695_10283663
1013 Ga0207671_10045011
1014 Ga0207671_10540728
1015 Ga0207693_10002125
1016 Ga0207693_10003370
1017 Ga0207693_10005879
1018 Ga0207693_10156158
1019 Ga0207693_10326082
1020 Ga0207663_10049276
1021 Ga0207663_10055204
1022 Ga0207662_10016703
1023 Ga0207662_10180055
1024 Ga0207657_10301660
1025 Ga0207657_11167377
1026 Ga0207652_10798608
1027 Ga0207646_10368961
1028 Ga0207681_10500907
1029 Ga0207694_10000504
1030 Ga0207650_10015384
1031 Ga0207650_10017455
1032 Ga0207650_11043340
1033 Ga0207659_10011589
1034 Ga0207659_10078426
1035 Ga0207687_10032174
1036 Ga0207687_10274735
1037 Ga0207700_10064281
1038 Ga0207700_10093303
1039 Ga0207700_10115523
1040 Ga0207700_10125092
1041 Ga0207700_10475692
1042 Ga0207700_11293933
1043 Ga0207664_10097999
1044 Ga0207664_11187934
1045 Ga0207644_10070322
1046 Ga0207644_10083692
1047 Ga0207644_10151584
1048 Ga0207706_10086505
1049 Ga0207709_10897398
1050 Ga0207670_10127149
1051 Ga0207670_10191560
1052 Ga0207669_10090581
1053 Ga0207669_10265902
1054 Ga0207704_10012092
1055 Ga0207665_10000889
1056 Ga0207665_10216365
1057 Ga0207691_10000921
1058 Ga0207691_10423938
1059 Ga0207711_10256251
1060 Ga0207689_10000756
1061 Ga0207661_10522995
1062 Ga0207679_10213802
1063 Ga0207679_10313273
1064 Ga0207667_10003168
1065 Ga0207667_10111596
1066 Ga0207667_10332679
1067 Ga0207667_11098230
1068 Ga0207651_10058696
1069 Ga0207712_10012542
1070 Ga0207712_10142335
1071 Ga0207712_10338272
1072 Ga0207668_10152483
1073 Ga0207640_10006934
1074 Ga0207677_10003059
1075 Ga0207703_10009970
1076 Ga0207703_10530181
1077 Ga0207639_10014458
1078 Ga0207639_10074048
1079 Ga0207639_11078408
1080 Ga0207678_10061639
1081 Ga0207678_10493028
1082 Ga0207708_10000567
1083 Ga0207702_10000093
1084 Ga0207702_10021704
1085 Ga0207702_10781685
1086 Ga0207641_10027274
1087 Ga0207648_10005442
1088 Ga0207648_11210163
1089 Ga0207676_10006676
1090 Ga0207674_10002601
1091 Ga0207674_10007742
1092 Ga0207674_10415934
1093 Ga0207675_100004334
1094 Ga0207683_10005967
1095 Ga0207683_10311426
1096 Ga0207698_10018326
1097 Ga0209813_10181121
1098 Ga0209813_10181783
1099 Ga0207428_10131921
1100 Ga0268266_10444335
1101 Ga0268266_10925088
1102 Ga0268265_10004767
1103 Ga0268264_10109846
1104 Ga0265762_1032358
1105 Ga0265763_1000350
1106 Ga0265760_10058314
1107 Ga0265332_10108740
1108 Ga0265325_10007216
1109 Ga0265325_10048161
1110 Ga0265325_10117224
1111 Ga0265340_10189811
1112 Ga0265331_10262757
1113 Ga0265331_10583387
1114 Ga0373958_0010083
1115 Ga0373926_0180952
1116 Ga0373944_0010821
1117 Ga0373944_0172290
1118 Ga0373949_0045077
1119 Ga0373923_0304996
1120 Ga0373936_0009948
1121 Ga0373936_0027118
1122 Ga0373939_0022027
1123 Ga0373939_0216835
1124 Ga0373945_0089338
1125 Ga0373957_0459526
1126 Ga0373960_0015216
1127 Ga0373943_0003811
1128 Ga0373943_0039562
1129 Ga0373943_0061670
1130 Ga0373946_0046370
1131 Ga0373946_0430229
1132 Ga0373946_0438765
1133 Ga0373946_0649064
1134 Ga0373955_0388214
1135 Ga0373955_0534036
1136 Ga0373942_0264297
1137 Ga0373961_0023086
1138 Ga0373931_0008972
1139 Ga0373931_0603333
1140 Ga0373935_0026553
1141 Ga0373935_0264869
1142 Ga0373935_0486712
1143 Ga0373927_0006272
1144 Ga0373927_0017150
1145 Ga0373927_0080673
1146 Ga0373927_0210608
1147 Ga0373927_0868201
1148 Ga0373947_0000419
1149 Ga0373947_0011663
1150 Ga0373947_0020175
1151 Ga0373947_0680399
1152 Ga0373937_0840773
1153 Ga0373937_1913999
1154 Ga0373925_0001403
1155 Ga0373925_0116397
1156 Ga0373925_0235140
1157 Ga0373925_0565249
1158 Ga0395900_0231768
1159 Ga0395905_0040581
1160 Ga0395901_1555467
1161 Ga0436365_0176812
1162 Ga0436365_0789682
1163 Ga0436361_1147554
1164 Ga0436362_0362248
1165 Ga0451798_0810439
1166 Ga0451851_0085469
1167 Ga0450905_068443
1168 Ga0495627_130232
1169 Ga0495592_0026300
1170 Ga0495592_0338382
1171 Ga0495592_0619412
1172 Ga0495603_0226776
1173 Ga0495590_0035344
1174 Ga0495629_0072255
1175 Ga0495629_0350292
1176 Ga0495629_0524935
1177 Ga0495638_0013417
1178 Ga0495638_0357851
1179 Ga0495651_0065195
1180 Ga0495580_0114698
1181 Ga0495582_0022260
1182 Ga0495639_0021411
1183 Ga0495662_0022416
1184 Ga0495662_0084754
1185 Ga0495662_0188808
1186 Ga0495664_0000928
1187 Ga0495584_0046457
1188 Ga0495584_0090870
1189 Ga0495584_0342101
1190 Ga0495584_0474274
1191 Ga0495585_0459521
1192 Ga0495594_0090445
1193 Ga0495607_0176934
1194 Ga0495607_0248075
1195 Ga0495608_0567507
1196 Ga0495618_0003037
1197 Ga0495618_0012973
1198 Ga0495618_0130082
1199 Ga0495630_0007927
1200 Ga0495630_0056535
1201 Ga0495630_0117955
1202 Ga0495631_0097704
1203 Ga0495632_0160735
1204 Ga0495637_0030126
1205 Ga0495637_0267574
1206 Ga0495663_0083468
1207 Ga0495666_0021630
1208 Ga0495652_0022851
1209 Ga0495652_0113709
1210 Ga0495652_0265172
1211 Ga0495654_0411620
1212 Ga0495665_0010010
1213 Ga0495640_0004705
1214 Ga0495640_0044696
1215 Ga0495640_0141190
1216 Ga0495587_0345236
1217 Ga0495598_0000289
1218 Ga0495609_0223143
1219 Ga0495645_0750843
1220 Ga0495622_0418745
1221 Ga0495633_0052880
1222 Ga0495667_0221824
1223 Ga0495656_0051811
1224 Ga0495656_0122307
1225 Ga0495656_0687676
1226 Ga0495668_0026470
1227 Ga0495668_0141666
1228 Ga0495634_0023534
1229 Ga0495634_0085680
1230 Ga0495634_0103673
1231 Ga0495634_0115327
1232 Ga0495635_0011699
1233 Ga0495635_0016348
1234 Ga0495635_0077320
1235 Ga0495659_0058184
1236 Ga0495599_0414773
1237 Ga0495623_0409141
1238 Ga0495646_0221481
1239 Ga0495647_0016756
1240 Ga0495647_0148114
1241 Ga0495658_0054559
1242 Ga0495613_0169643
1243 Ga0495624_0002027
1244 Ga0495624_0054853
1245 Ga0495624_0384216
1246 Ga0495670_0012262
1247 Ga0495670_0375256
1248 Ga0495671_0168754
1249 Ga0495671_0199024
1250 Ga0495649_0042518
1251 Ga0495589_0279191
1252 Ga0495589_0488959
1253 Ga0495600_0057600
1254 Ga0495581_0006507
1255 Ga0495581_0129571
1256 Ga0495604_0069037
1257 Ga0495674_0015010
1258 Ga0495674_0492064
1259 Ga0495676_0031123
1260 Ga0495676_0092252
1261 Ga0495676_0131485
1262 Ga0495676_0331100
1263 Ga0495683_0403226
1264 Ga0495684_0003842
1265 Ga0495684_0017704
1266 Ga0495684_0278542
1267 Ga0495684_0396369
1268 Ga0495593_0017938
1269 Ga0495593_0378130
1270 Ga0495602_0538703
1271 Ga0495614_0613777
1272 Ga0495615_0066822
1273 Ga0495626_0260019
1274 Ga0496100_0002071
1275 Ga0496100_0010711
1276 Ga0496100_0041213
1277 Ga0496100_0510663
1278 Ga0496100_0668737
1279 Ga0496101_0008555
1280 Ga0496101_0015090
1281 Ga0496101_0065851
1282 Ga0496101_0515159
1283 Ga0496102_0001429
1284 Ga0496102_0025109
1285 Ga0496102_0276486
1286 Ga0496102_0555998
1287 Ga0496102_0893814
1288 Ga0496102_1058324
1289 Ga0496103_0007492
1290 Ga0496103_0010187
1291 Ga0496103_0136741
1292 Ga0496103_0340324
1293 Ga0496104_0001675
1294 Ga0496104_0002135
1295 Ga0496104_0005707
1296 Ga0496104_0008597
1297 Ga0496104_0018812
1298 Ga0496104_0164548
1299 Ga0496104_0826189
1300 Ga0496105_0002427
1301 Ga0496105_0009393
1302 Ga0496105_0015808
1303 Ga0496105_0017970
1304 Ga0496105_0019401
1305 Ga0496105_0268326
1306 Ga0496106_0014475
1307 Ga0496106_0018044
1308 Ga0496106_0036897
1309 Ga0496106_0257040
1310 Ga0496106_0466686
1311 Ga0496107_0002699
1312 Ga0496107_0180414
1313 Ga0496107_0271921
1314 Ga0496108_0003780
1315 Ga0496108_0018895
1316 Ga0496108_0192772
1317 Ga0496108_0987788
1318 Ga0496109_0002529
1319 Ga0496109_0006297
1320 Ga0496109_0423455
1321 Ga0496110_0018457
1322 Ga0496110_0026273
1323 Ga0496110_0131948
1324 Ga0496110_0341463
1325 Ga0496110_0454478
1326 Ga0496111_0005574
1327 Ga0496111_0218797
1328 Ga0496111_0295120
1329 Ga0496112_0001666
1330 Ga0496112_0007677
1331 Ga0496112_0151374
1332 Ga0496112_0492739
1333 Ga0496112_0650042
1334 Ga0496113_0001223
1335 Ga0496113_0003026
1336 Ga0496113_0876445
1337 Ga0496114_0001258
1338 Ga0496114_0004304
1339 Ga0496114_0077244
1340 Ga0496114_0338000
1341 Ga0496114_0870397
1342 Ga0496115_0025296
1343 Ga0496115_0032583
1344 Ga0496115_0084156
1345 Ga0496115_0401806
1346 Ga0496115_0421557
1347 Ga0496115_0791759
1348 Ga0496124_0798143
1349 Ga0501031_0563034
1350 Ga0501033_0233888
1351 Ga0501034_0060536
1352 Ga0501036_1245390
1353 Ga0501039_0245895
1354 Ga0501040_0905930
1355 Ga0501041_0566256
1356 Ga0501042_0369037
1357 Ga0501046_0151885
1358 Ga0501048_0258445
1359 Ga0501067_0588477
1360 Ga0501072_0142294
1361 Ga0501072_0261557
1362 Ga0501072_0418095
1363 Ga0501072_1165409
1364 Ga0501073_0084180
1365 Ga0501073_0277749
1366 Ga0501075_0897123
1367 Ga0501075_1382130
1368 Ga0501076_0123386
1369 Ga0501076_0543416
1370 Ga0501077_0126808
1371 Ga0501077_0281657
1372 Ga0501077_0419805
1373 Ga0501079_0412571
1374 Ga0501079_0979742
1375 Ga0501080_0013702
1376 Ga0501080_1383484
1377 Ga0501081_0959004
1378 Ga0501083_0066368
1379 Ga0501083_0211543
1380 Ga0501044_0331722
1381 nmdc:mga03n38_255287_c1
1382 nmdc:mga00v17_383335_c1
1383 nmdc:mga00v17_95964_c1
1384 nmdc:mga0yw44_15992_c1
1385 nmdc:mga0yw44_361726_c1
1386 nmdc:mga0yw44_415607_c1
1387 nmdc:mga0yw44_4458_c1
1388 nmdc:mga0yw44_7144_c1
1389 nmdc:mga0k408_412483_c1
1390 nmdc:mga0k408_739417_c1
1391 nmdc:mga0k408_82207_c1
1392 nmdc:mga06z11_167724_c1
1393 nmdc:mga06z11_756488_c1
1394 nmdc:mga04h51_129024_c1
1395 nmdc:mga04h51_208768_c1
1396 nmdc:mga07m45_145133_c1
1397 nmdc:mga07m45_238218_c1
1398 nmdc:mga05p37_1138298_c1
1399 nmdc:mga05p37_21683_c1
1400 nmdc:mga05p37_4437_c1
1401 nmdc:mga05p37_473675_c1
1402 nmdc:mga05p37_773776_c1
1403 nmdc:mga05p37_873250_c1
1404 nmdc:mga09592_202839_c1
1405 nmdc:mga09592_963584_c1
1406 nmdc:mga0qj67_172638_c1
1407 nmdc:mga0qj67_537601_c1
1408 nmdc:mga06r32_113815_c1
1409 nmdc:mga06r32_394091_c1
1410 nmdc:mga06r32_737585_c1
1411 nmdc:mga06r32_934007_c1
1412 nmdc:mga08y16_1194130_c1
1413 nmdc:mga08y16_1248479_c1
1414 nmdc:mga08y16_1527656_c1
1415 nmdc:mga08y16_195830_c1
1416 nmdc:mga08y16_202302_c1
1417 nmdc:mga0n895_1458161_c1
1418 nmdc:mga0n895_261831_c1
1419 nmdc:mga0n895_267749_c1
1420 nmdc:mga0rr50_168948_c1
1421 nmdc:mga0rr50_270368_c1
1422 nmdc:mga0rr50_623036_c1
1423 nmdc:mga08x19_310475_c1
1424 nmdc:mga0a205_120098_c1
1425 nmdc:mga0a205_470946_c1
1426 nmdc:mga0sz30_131949_c1
1427 Ga0495601_0005944
1428 Ga0495612_0000842
1429 Ga0495612_0072046
1430 Ga0495612_0363183
1431 Ga0495595_0061269
1432 Ga0495619_0001378
1433 Ga0495619_0034104
1434 Ga0495619_0052965
1435 Ga0500566_0496325
1436 Ga0500593_019045
1437 Ga0500658_0305120
1438 Ga0500568_0244108
1439 Ga0501084_0064064
1440 Ga0501082_0324303
1441 Ga0501082_0411039
1442 Ga0501082_1663250
1443 Ga0530510_0086663
1444 Ga0530510_0160064
1445 Ga0530510_0303606
1446 Ga0530510_1035324

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

1

129

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5z8o-assembly1.cif.gz_A structural of start superfamily protein msmeg_0129 from mycobacterium smegmatis 0.8408 3 147
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8375 36 72
3ov4-assembly2.cif.gz_D crystal structure of ketosteroid isomerase p39gv40gs42g from pseudomonas testosteroni (tksi) bound to equilenin 0.837 36 72
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.836 2 148
3tvr-assembly1.cif.gz_A crystal structure of streptomyces coelicolor polyketide aromatase/cyclase whie-orfvi 0.829 3 149
ID Description Score Start End Superfamily
af_P0AGL5_15_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.946 2 150 3.30.530.20
af_P0AGL5_15_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9396 2 150 3.30.530.20
af_Q556V1_54_199_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9227 4 150 3.30.530.20
af_Q556V1_54_199_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9106 4 150 3.30.530.20
af_Q8MLL3_83_228_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.906 2 144 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A5J4E2I0-F1-model_v4 Persistence and stress-resistance toxin PasT 0.9879 1 148 GO:0045333
GO:0048039
AF-J6J8C9-F1-model_v4 Putative oligoketide cyclase 0.9823 1 149 GO:0045333
GO:0048039
AF-A0A1E3VS62-F1-model_v4 Cyclase 0.9801 1 149 GO:0045333
GO:0048039
AF-A0A178YDP5-F1-model_v4 Cyclase 0.9775 1 150 GO:0045333
GO:0048039
AF-A0A524HZ38-F1-model_v4 Type II toxin-antitoxin system RatA family toxin 0.9742 1 149 GO:0045333
GO:0048039

Map