F477526

General Info

Members Datasets Scaffolds Average Seq Length
723 366 665 342

Family's Representative Sequence

Representative Sequence 3300049705|Ga0501225_0035083|Ga0501225_0035083_203_1336
Length 377
Sequence MIAKIILIVALFAITLGIAAYLTWMERKVAAWLQDRVGPDRAGKWGLLQPLADGGKMFFKEDFIPAMADRRLFILGPGIAMFTSFLTGAVIPWGPDLTLFGETVSLQVSNANIGVLFAMGIASVGVYGILIGGWASNNKFSLFGAIRASSQMISYELAMGISIITIVMMSGSLNLRDIVDQQAGFWDNGWFTWNFFKQPLCFLVFLVCALAECNRAPFDLAECESELIGGYHTEFGAMKLGFYLFAEYINMFISCAIISTVFFGGYHFPFESHFSGIWLTLLGVGAMFAKTIFFIFVFMWIRWTLPRFRYDQLMHLGWKKLIPISLVNLLITGFVIAFVSGWFTKEKPQPKMDASKPKTEQPLSLNTSNSKKTNKLH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
4 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
5 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
6 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
7 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
8 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
9 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
10 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
11 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
12 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
13 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
14 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
15 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
16 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
17 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
18 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
19 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
20 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
21 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
22 2738541283 Pedobacter sp. OK701 Isolate Unclassified
23 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
24 2738543023 Pedobacter sp. OK628 Isolate Unclassified
25 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
26 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
27 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
28 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
29 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
30 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
31 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
32 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
33 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
34 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
35 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
36 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
37 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
38 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
39 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
40 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
41 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
42 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
43 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
44 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
45 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
46 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
47 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
48 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
49 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
50 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
51 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
52 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
53 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
54 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
55 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
56 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
57 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
58 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
59 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
60 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
61 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
62 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
63 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
64 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
65 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
66 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
67 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
68 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
69 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
70 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
71 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
72 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
73 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
74 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
78 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
79 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
80 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
81 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
82 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
83 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
84 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
85 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
86 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
87 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
88 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
89 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
90 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
91 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
92 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
93 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
94 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
95 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
96 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
97 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
98 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
99 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
100 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
101 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
102 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
103 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
104 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
105 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
106 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
107 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
108 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
109 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
110 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
111 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
112 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
113 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
116 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
117 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
118 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
119 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
120 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
121 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
122 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
123 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
128 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
132 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
133 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
134 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
135 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
136 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
137 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
138 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
139 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
141 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
142 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
143 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
144 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
145 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
146 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
147 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
148 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
149 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
150 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
151 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
159 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
160 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
161 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
162 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
163 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
164 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
165 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
166 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
167 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
168 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
170 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
171 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
172 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
173 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
174 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
177 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
178 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
228 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
229 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
230 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
231 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
232 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
233 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
234 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
235 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
236 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
239 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
240 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
251 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
255 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
258 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
259 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
260 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
263 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
264 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
265 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
266 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
267 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
273 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
274 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
275 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
276 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
277 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
278 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
279 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
280 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
281 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
282 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
283 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
284 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
285 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
286 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
287 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
288 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
289 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
290 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
291 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
292 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
293 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
296 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
297 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
300 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
301 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
306 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
317 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
318 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
331 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
332 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
333 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
334 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
335 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
336 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
337 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
338 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
339 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
340 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
341 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
342 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
343 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
344 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
345 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
346 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
347 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
348 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
349 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
353 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
354 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
355 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
356 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
357 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
358 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
359 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
360 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
361 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
362 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
363 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
364 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
365 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
366 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.87
Metatranscriptomes 0.97
Isolates 8.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.7
Nodule 0.14
Rhizoplane 0.69
Rhizosphere 86.17
Stem 0
Stem Tuber 0
Unclassified 8.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3345962 2162886007 Bacteria 1208
2 JGI24736J21556_1004595 3300001904 Bacteria 2352
3 JGI24741J21665_1002374 3300001915 Bacteria 4923
4 JGI24740J21852_10016845 3300001979 Bacteria 2630
5 JGI24740J21852_10021582 3300001979 Bacteria 2231
6 JGI24740J21852_10022760 3300001979 Bacteria 2152
7 JGI24740J21852_10025207 3300001979 Bacteria 2008
8 JGI24737J22298_10015866 3300001990 Bacteria 2435
9 JGI24735J21928_10023534 3300002067 Bacteria 1867
10 JGI25162J39368_1000118 3300002737 Bacteria 87343
11 JGI25162J39368_1000562 3300002737 Bacteria 27227
12 JGI25154J39366_1000020 3300002738 Bacteria 233181
13 JGI25165J46597_1002545 3300003214 Bacteria 5692
14 rootH1_10004943 3300003316 Bacteria 35922
15 rootH1_10004943 3300003323 Bacteria 7849
16 rootH2_10005563 3300003320 Bacteria 5437
17 rootH2_10012714 3300003320 Bacteria 66260
18 rootH2_10056449 3300003320 Bacteria 2163
19 rootL2_10009362 3300003322 Bacteria 3048
20 rootL2_10088809 3300003322 Bacteria 7503
21 rootL2_10151563 3300003322 Bacteria 3704
22 rootL2_10282716 3300003322 Bacteria 2227
23 rootH1_10005447 3300003323 Bacteria 15107
24 rootH1_10012646 3300003323 Bacteria 62371
25 rootH1_10012675 3300003323 Bacteria 2281
26 rootH1_10027403 3300003323 Bacteria 72977
27 Ga0006562J51391_1024690 3300003578 Bacteria 4473
28 Ga0055536_1000006 3300003781 Bacteria 347733
29 Ga0055536_1007763 3300003781 Bacteria 4742
30 Ga0055531_10000132 3300003794 Bacteria 85251
31 Ga0055531_10000868 3300003794 Bacteria 24791
32 Ga0058863_10008894 3300004799 Bacteria 11745
33 Ga0058861_10875503 3300004800 Bacteria 1533
34 Ga0058862_10143705 3300004803 Bacteria 8181
35 Ga0065165_1000601 3300005262 Bacteria 52747
36 Ga0065714_10092478 3300005288 Bacteria 1876
37 Ga0065704_10004114 3300005289 Bacteria 5658
38 Ga0065704_10005995 3300005289 Bacteria 5046
39 Ga0065704_10088141 3300005289 Bacteria 2962
40 Ga0065712_10005831 3300005290 Bacteria 3684
41 Ga0065712_10072974 3300005290 Bacteria 4496
42 Ga0065712_10088061 3300005290 Bacteria 2540
43 Ga0065712_10095713 3300005290 Bacteria 2203
44 Ga0070658_10158374 3300005327 Unclassified 1899
45 Ga0070676_10000113 3300005328 Bacteria 29666
46 Ga0070683_100000553 3300005329 Bacteria 26515
47 Ga0070683_100004195 3300005329 Bacteria 11821
48 Ga0070683_100148647 3300005329 Bacteria 2221
49 Ga0070683_100164739 3300005329 Bacteria 2103
50 Ga0070670_100035680 3300005331 Bacteria 4280
51 Ga0068869_100012829 3300005334 Bacteria 5545
52 Ga0068869_100020182 3300005334 Bacteria 4566
53 Ga0068869_100032055 3300005334 Bacteria 3701
54 Ga0068869_100032192 3300005334 Bacteria 3693
55 Ga0068869_100042888 3300005334 Bacteria 3246
56 Ga0068869_100044765 3300005334 Bacteria 3183
57 Ga0068869_100064432 3300005334 Bacteria 2696
58 Ga0068869_100122259 3300005334 Bacteria 1992
59 Ga0070666_10000019 3300005335 Bacteria 185877
60 Ga0070666_10038276 3300005335 Bacteria 3190
61 Ga0070680_100005673 3300005336 Bacteria 9465
62 Ga0070682_100000095 3300005337 Bacteria 80688
63 Ga0068868_100006083 3300005338 Bacteria 8522
64 Ga0068868_100006616 3300005338 Bacteria 8217
65 Ga0068868_100025162 3300005338 Bacteria 4522
66 Ga0068868_100094324 3300005338 Bacteria 2414
67 Ga0070689_100002494 3300005340 Bacteria 12028
68 Ga0070689_100021302 3300005340 Bacteria 4823
69 Ga0070689_100218782 3300005340 Bacteria 1561
70 Ga0070687_100174905 3300005343 Bacteria 1281
71 Ga0070661_100000179 3300005344 Bacteria 52306
72 Ga0070661_100044057 3300005344 Bacteria 3259
73 Ga0070661_100076574 3300005344 Bacteria 2465
74 Ga0070668_100088574 3300005347 Bacteria 2437
75 Ga0070668_100320212 3300005347 Bacteria 1305
76 Ga0070675_100041897 3300005354 Bacteria 3740
77 Ga0070675_100118016 3300005354 Bacteria 2252
78 Ga0070671_100163158 3300005355 Bacteria 1883
79 Ga0070671_100244093 3300005355 Bacteria 1525
80 Ga0070674_100004529 3300005356 Bacteria 7935
81 Ga0070674_100063980 3300005356 Bacteria 2576
82 Ga0070673_100031160 3300005364 Bacteria 3999
83 Ga0070673_100109466 3300005364 Bacteria 2289
84 Ga0070673_100139309 3300005364 Bacteria 2045
85 Ga0070688_100011134 3300005365 Bacteria 4993
86 Ga0070688_100015669 3300005365 Bacteria 4319
87 Ga0070688_100038106 3300005365 Bacteria 2934
88 Ga0070688_100098046 3300005365 Bacteria 1927
89 Ga0070659_100000868 3300005366 Bacteria 22078
90 Ga0070659_100010826 3300005366 Bacteria 6725
91 Ga0070659_100025291 3300005366 Bacteria 4557
92 Ga0070659_100131931 3300005366 Bacteria 2029
93 Ga0070667_100095701 3300005367 Unclassified 2561
94 Ga0070667_100131921 3300005367 Bacteria 2181
95 Ga0070667_100142934 3300005367 Bacteria 2097
96 Ga0070663_100140558 3300005455 Bacteria 1843
97 Ga0070678_100021468 3300005456 Bacteria 4257
98 Ga0070678_100023305 3300005456 Bacteria 4123
99 Ga0070678_100067946 3300005456 Bacteria 2655
100 Ga0070662_100012586 3300005457 Bacteria 5611
101 Ga0070662_100013751 3300005457 Bacteria 5390
102 Ga0070662_100021047 3300005457 Bacteria 4449
103 Ga0070662_100330288 3300005457 Bacteria 1245
104 Ga0070681_10019337 3300005458 Bacteria 6817
105 Ga0068867_100003787 3300005459 Bacteria 10644
106 Ga0068867_100023969 3300005459 Bacteria 4372
107 Ga0068867_100065084 3300005459 Unclassified 2712
108 Ga0068867_100195453 3300005459 Bacteria 1617
109 Ga0070685_10027123 3300005466 Bacteria 3163
110 Ga0070685_10123650 3300005466 Bacteria 1610
111 Ga0070698_100003913 3300005471 Bacteria 16377
112 Ga0070679_100137891 3300005530 Bacteria 2420
113 Ga0070684_100001469 3300005535 Bacteria 17002
114 Ga0070684_100065293 3300005535 Bacteria 3194
115 Ga0068853_100024340 3300005539 Bacteria 5075
116 Ga0068853_100129114 3300005539 Bacteria 2261
117 Ga0068853_100182403 3300005539 Bacteria 1904
118 Ga0070672_100050257 3300005543 Bacteria 3247
119 Ga0070672_100141682 3300005543 Bacteria 1983
120 Ga0070686_100053016 3300005544 Bacteria 2588
121 Ga0070693_100078210 3300005547 Bacteria 1965
122 Ga0070665_100000118 3300005548 Bacteria 149830
123 Ga0068855_100000049 3300005563 Bacteria 145321
124 Ga0068855_100024523 3300005563 Bacteria 7217
125 Ga0068855_100054484 3300005563 Bacteria 4700
126 Ga0070664_100001077 3300005564 Bacteria 21494
127 Ga0070664_100004250 3300005564 Bacteria 11518
128 Ga0070664_100139753 3300005564 Bacteria 2132
129 Ga0070664_100349367 3300005564 Bacteria 1345
130 Ga0068857_100046270 3300005577 Bacteria 3861
131 Ga0068857_100112367 3300005577 Bacteria 2449
132 Ga0068857_100122124 3300005577 Bacteria 2346
133 Ga0068856_100007533 3300005614 Bacteria 10623
134 Ga0068856_100016616 3300005614 Bacteria 7125
135 Ga0068856_100021650 3300005614 Bacteria 6248
136 Ga0068856_100592044 3300005614 Bacteria 1130
137 Ga0068852_100004192 3300005616 Bacteria 10161
138 Ga0068852_100026093 3300005616 Bacteria 4744
139 Ga0068852_100029170 3300005616 Bacteria 4528
140 Ga0068852_100079569 3300005616 Bacteria 2903
141 Ga0068859_100000013 3300005617 Bacteria 291126
142 Ga0068859_100014773 3300005617 Bacteria 7844
143 Ga0068859_100167794 3300005617 Bacteria 2275
144 Ga0068859_100171588 3300005617 Bacteria 2250
145 Ga0068864_100030528 3300005618 Bacteria 4568
146 Ga0068864_100077517 3300005618 Bacteria 2906
147 Ga0068864_100443316 3300005618 Bacteria 1240
148 Ga0068864_100505402 3300005618 Bacteria 1163
149 Ga0068866_10016357 3300005718 Bacteria 3316
150 Ga0068851_10000057 3300005834 Bacteria 66791
151 Ga0068851_10030248 3300005834 Bacteria 2685
152 Ga0068851_10065723 3300005834 Bacteria 1867
153 Ga0068863_100010161 3300005841 Bacteria 9153
154 Ga0068863_100014098 3300005841 Bacteria 7700
155 Ga0068863_100273684 3300005841 Bacteria 1635
156 Ga0068858_100001874 3300005842 Bacteria 21456
157 Ga0068858_100146620 3300005842 Bacteria 2217
158 Ga0068858_100169281 3300005842 Bacteria 2060
159 Ga0068858_100252025 3300005842 Bacteria 1677
160 Ga0068858_100363142 3300005842 Bacteria 1388
161 Ga0068860_100001911 3300005843 Bacteria 22115
162 Ga0068860_100013335 3300005843 Bacteria 8058
163 Ga0068860_100089002 3300005843 Bacteria 2939
164 Ga0068860_100123196 3300005843 Bacteria 2484
165 Ga0068862_100122192 3300005844 Bacteria 2296
166 Ga0068862_100137308 3300005844 Bacteria 2168
167 Ga0068862_100187919 3300005844 Bacteria 1857
168 Ga0068862_100242902 3300005844 Bacteria 1638
169 Ga0081539_10013758 3300005985 Bacteria 6065
170 Ga0081539_10124610 3300005985 Bacteria 1274
171 Ga0075366_10000556 3300006195 Bacteria 17427
172 Ga0097621_100000015 3300006237 Bacteria 92182
173 Ga0097621_100074955 3300006237 Bacteria 2803
174 Ga0068871_100000051 3300006358 Bacteria 64844
175 Ga0068871_100102960 3300006358 Bacteria 2393
176 Ga0068871_100276159 3300006358 Bacteria 1469
177 Ga0068871_100318227 3300006358 Bacteria 1369
178 Ga0075428_100071519 3300006844 Bacteria 3791
179 Ga0075428_100086344 3300006844 Bacteria 3422
180 Ga0075428_100295416 3300006844 Bacteria 1742
181 Ga0075430_100034421 3300006846 Bacteria 4299
182 Ga0075430_100287046 3300006846 Bacteria 1361
183 Ga0075431_100069264 3300006847 Bacteria 3640
184 Ga0075429_100252160 3300006880 Bacteria 1545
185 Ga0068865_100002736 3300006881 Bacteria 10472
186 Ga0068865_100080837 3300006881 Bacteria 2332
187 Ga0068865_100109836 3300006881 Bacteria 2033
188 Ga0068865_100148045 3300006881 Bacteria 1778
189 Ga0097620_100000013 3300006931 Bacteria 291126
190 Ga0097620_100014774 3300006931 Bacteria 7844
191 Ga0097620_100167788 3300006931 Bacteria 2275
192 Ga0097620_100171599 3300006931 Bacteria 2250
193 Ga0105240_10017563 3300009093 Bacteria 9638
194 Ga0105240_10037888 3300009093 Bacteria 6192
195 Ga0105240_10060549 3300009093 Bacteria 4720
196 Ga0105240_10188688 3300009093 Bacteria 2425
197 Ga0105240_10262897 3300009093 Bacteria 1990
198 Ga0111539_10121157 3300009094 Bacteria 3065
199 Ga0105247_10002997 3300009101 Bacteria 11192
200 Ga0105247_10013814 3300009101 Bacteria 4841
201 Ga0105243_10000003 3300009148 Bacteria 712931
202 Ga0105243_10000089 3300009148 Bacteria 103761
203 Ga0105243_10056016 3300009148 Bacteria 3133
204 Ga0105243_10267417 3300009148 Bacteria 1534
205 Ga0105241_10001659 3300009174 Bacteria 16968
206 Ga0105241_10005937 3300009174 Bacteria 9003
207 Ga0105242_10023597 3300009176 Bacteria 4848
208 Ga0105242_10027714 3300009176 Bacteria 4503
209 Ga0105242_10040197 3300009176 Bacteria 3768
210 Ga0105242_10093693 3300009176 Bacteria 2533
211 Ga0105237_10001504 3300009545 Bacteria 30678
212 Ga0105237_10001895 3300009545 Bacteria 26705
213 Ga0105237_10023370 3300009545 Bacteria 6335
214 Ga0105237_10026749 3300009545 Bacteria 5896
215 Ga0105237_10072090 3300009545 Bacteria 3448
216 Ga0105237_10088785 3300009545 Bacteria 3080
217 Ga0105238_10059144 3300009551 Bacteria 3840
218 Ga0105249_10007529 3300009553 Bacteria 9498
219 Ga0105249_10008471 3300009553 Bacteria 8960
220 Ga0105249_10018555 3300009553 Bacteria 6193
221 Ga0105249_10026565 3300009553 Bacteria 5219
222 Ga0105249_10056562 3300009553 Bacteria 3591
223 Ga0105249_10059302 3300009553 Bacteria 3510
224 Ga0105239_10000166 3300010375 Bacteria 94743
225 Ga0105239_10017420 3300010375 Bacteria 7945
226 Ga0105239_10023061 3300010375 Bacteria 6862
227 Ga0105239_10200999 3300010375 Bacteria 2233
228 Ga0105239_10345862 3300010375 Bacteria 1679
229 Ga0105246_10092551 3300011119 Bacteria 2182
230 Ga0157373_10000006 3300013100 Bacteria 261768
231 Ga0157373_10001842 3300013100 Bacteria 16117
232 Ga0157373_10009487 3300013100 Bacteria 7190
233 Ga0157373_10025296 3300013100 Bacteria 4296
234 Ga0157373_10053330 3300013100 Bacteria 2875
235 Ga0157373_10314564 3300013100 Bacteria 1113
236 Ga0157371_10000107 3300013102 Bacteria 126477
237 Ga0157371_10001199 3300013102 Bacteria 27770
238 Ga0157371_10011057 3300013102 Bacteria 6991
239 Ga0157371_10038939 3300013102 Bacteria 3401
240 Ga0157371_10042314 3300013102 Bacteria 3247
241 Ga0157370_10005025 3300013104 Bacteria 14939
242 Ga0157370_10010241 3300013104 Bacteria 9900
243 Ga0157369_10003605 3300013105 Bacteria 18401
244 Ga0157369_10030384 3300013105 Bacteria 5958
245 Ga0157374_10001665 3300013296 Bacteria 18606
246 Ga0157374_10002410 3300013296 Bacteria 15774
247 Ga0157374_10033689 3300013296 Bacteria 4675
248 Ga0157374_10035226 3300013296 Bacteria 4578
249 Ga0157374_10560652 3300013296 Unclassified 1150
250 Ga0157378_10026892 3300013297 Bacteria 5074
251 Ga0163162_10000595 3300013306 Bacteria 33576
252 Ga0163162_10001704 3300013306 Bacteria 20605
253 Ga0163162_10002066 3300013306 Bacteria 18872
254 Ga0163162_10039941 3300013306 Bacteria 4690
255 Ga0163162_10126140 3300013306 Bacteria 2666
256 Ga0163162_10191838 3300013306 Bacteria 2171
257 Ga0157372_10000039 3300013307 Bacteria 165839
258 Ga0157372_10000238 3300013307 Bacteria 60988
259 Ga0157372_10033521 3300013307 Bacteria 5642
260 Ga0157372_10038960 3300013307 Bacteria 5246
261 Ga0157372_10041830 3300013307 Bacteria 5067
262 Ga0157372_10128863 3300013307 Bacteria 2910
263 Ga0157372_10155743 3300013307 Bacteria 2639
264 Ga0157372_10355418 3300013307 Bacteria 1707
265 Ga0157372_10385494 3300013307 Bacteria 1633
266 Ga0157372_10534894 3300013307 Bacteria 1366
267 Ga0157372_10614255 3300013307 Bacteria 1267
268 Ga0157375_10056899 3300013308 Bacteria 3864
269 Ga0157375_10060974 3300013308 Bacteria 3743
270 Ga0157375_10069271 3300013308 Bacteria 3533
271 Ga0157375_10070243 3300013308 Bacteria 3511
272 Ga0157375_10083268 3300013308 Bacteria 3244
273 Ga0157375_10093696 3300013308 Bacteria 3070
274 Ga0157375_10173258 3300013308 Bacteria 2306
275 Ga0157375_10231830 3300013308 Bacteria 2005
276 Ga0163163_10000088 3300014325 Bacteria 101126
277 Ga0163163_10203143 3300014325 Bacteria 2030
278 Ga0163163_10219127 3300014325 Bacteria 1951
279 Ga0163163_10235113 3300014325 Bacteria 1882
280 Ga0157380_10033408 3300014326 Bacteria 3961
281 Ga0157380_10353017 3300014326 Bacteria 1377
282 Ga0182008_10000003 3300014497 Bacteria 456880
283 Ga0182008_10045280 3300014497 Bacteria 2188
284 Ga0157377_10002113 3300014745 Bacteria 8736
285 Ga0157377_10023161 3300014745 Bacteria 3289
286 Ga0157377_10063195 3300014745 Bacteria 2120
287 Ga0157377_10096723 3300014745 Bacteria 1752
288 Ga0157379_10078807 3300014968 Bacteria 2951
289 Ga0157379_10151332 3300014968 Bacteria 2093
290 Ga0157379_10531207 3300014968 Bacteria 1093
291 Ga0157376_10208429 3300014969 Bacteria 1803
292 Ga0182006_1000079 3300015261 Bacteria 122553
293 Ga0182007_10016964 3300015262 Bacteria 2672
294 Ga0163161_10012415 3300017792 Bacteria 5916
295 Ga0163161_10014389 3300017792 Bacteria 5508
296 Ga0163161_10044867 3300017792 Unclassified 3185
297 Ga0163161_10075077 3300017792 Bacteria 2480
298 Ga0213872_10025003 3300021361 Bacteria 2746
299 Ga0207427_100122 3300025231 Bacteria 99064
300 Ga0209437_100048 3300025233 Bacteria 405107
301 Ga0209437_100102 3300025233 Bacteria 224216
302 Ga0209646_1000005 3300025246 Bacteria 717627
303 Ga0209026_1000149 3300025250 Bacteria 111200
304 Ga0209026_1005112 3300025250 Bacteria 3630
305 Ga0209129_1007350 3300025258 Bacteria 3303
306 Ga0209233_1000029 3300025261 Bacteria 641642
307 Ga0209233_1001271 3300025261 Bacteria 10114
308 Ga0209455_1008606 3300025272 Bacteria 2759
309 Ga0209675_1000159 3300025291 Bacteria 87316
310 Ga0209676_1000485 3300025292 Bacteria 64653
311 Ga0207426_1000059 3300025302 Bacteria 363842
312 Ga0207426_1000262 3300025302 Bacteria 111889
313 Ga0209257_1000006 3300025304 Bacteria 1570111
314 Ga0207656_10000048 3300025321 Bacteria 46689
315 Ga0207656_10017235 3300025321 Bacteria 2826
316 Ga0207656_10098938 3300025321 Bacteria 1335
317 Ga0207642_10012112 3300025899 Bacteria 3102
318 Ga0207642_10026071 3300025899 Bacteria 2375
319 Ga0207710_10001252 3300025900 Bacteria 12863
320 Ga0207688_10014315 3300025901 Bacteria 4316
321 Ga0207680_10000586 3300025903 Bacteria 17176
322 Ga0207680_10095130 3300025903 Bacteria 1903
323 Ga0207647_10000071 3300025904 Bacteria 79170
324 Ga0207645_10000229 3300025907 Bacteria 46502
325 Ga0207643_10056090 3300025908 Bacteria 2240
326 Ga0207654_10006962 3300025911 Bacteria 5699
327 Ga0207707_10013779 3300025912 Bacteria 7051
328 Ga0207695_10014909 3300025913 Bacteria 9174
329 Ga0207695_10046352 3300025913 Bacteria 4608
330 Ga0207695_10046838 3300025913 Bacteria 4581
331 Ga0207671_10006548 3300025914 Bacteria 10350
332 Ga0207671_10007623 3300025914 Bacteria 9357
333 Ga0207671_10012946 3300025914 Bacteria 6676
334 Ga0207671_10026732 3300025914 Bacteria 4320
335 Ga0207671_10057163 3300025914 Bacteria 2891
336 Ga0207662_10097041 3300025918 Bacteria 1822
337 Ga0207657_10334650 3300025919 Bacteria 1195
338 Ga0207649_10005271 3300025920 Bacteria 6994
339 Ga0207649_10304353 3300025920 Bacteria 1166
340 Ga0207652_10003461 3300025921 Bacteria 13016
341 Ga0207694_10035816 3300025924 Bacteria 3807
342 Ga0207650_10192912 3300025925 Bacteria 1628
343 Ga0207659_10007464 3300025926 Bacteria 6725
344 Ga0207659_10010641 3300025926 Bacteria 5784
345 Ga0207644_10148372 3300025931 Bacteria 1813
346 Ga0207690_10001688 3300025932 Bacteria 13606
347 Ga0207690_10004290 3300025932 Bacteria 8416
348 Ga0207690_10007668 3300025932 Bacteria 6402
349 Ga0207690_10017044 3300025932 Bacteria 4430
350 Ga0207706_10010295 3300025933 Bacteria 8551
351 Ga0207706_10019515 3300025933 Bacteria 6099
352 Ga0207706_10039441 3300025933 Bacteria 4187
353 Ga0207706_10057952 3300025933 Bacteria 3412
354 Ga0207686_10004707 3300025934 Bacteria 7317
355 Ga0207686_10073256 3300025934 Bacteria 2209
356 Ga0207686_10092089 3300025934 Bacteria 2004
357 Ga0207709_10000008 3300025935 Bacteria 713099
358 Ga0207709_10000136 3300025935 Bacteria 106728
359 Ga0207709_10138315 3300025935 Bacteria 1671
360 Ga0207670_10011472 3300025936 Bacteria 5148
361 Ga0207670_10028297 3300025936 Bacteria 3556
362 Ga0207704_10000047 3300025938 Bacteria 84386
363 Ga0207704_10152129 3300025938 Bacteria 1634
364 Ga0207691_10011157 3300025940 Bacteria 8624
365 Ga0207691_10014922 3300025940 Bacteria 7402
366 Ga0207689_10025266 3300025942 Bacteria 4977
367 Ga0207689_10029603 3300025942 Bacteria 4570
368 Ga0207689_10031652 3300025942 Bacteria 4402
369 Ga0207689_10073320 3300025942 Bacteria 2812
370 Ga0207689_10104438 3300025942 Bacteria 2328
371 Ga0207689_10118628 3300025942 Bacteria 2176
372 Ga0207689_10260325 3300025942 Bacteria 1435
373 Ga0207661_10018216 3300025944 Bacteria 5215
374 Ga0207661_10022846 3300025944 Bacteria 4716
375 Ga0207661_10143564 3300025944 Bacteria 2057
376 Ga0207661_10369109 3300025944 Bacteria 1297
377 Ga0207679_10001674 3300025945 Bacteria 13809
378 Ga0207679_10003082 3300025945 Bacteria 10326
379 Ga0207679_10061526 3300025945 Bacteria 2795
380 Ga0207679_10082428 3300025945 Bacteria 2462
381 Ga0207679_10082863 3300025945 Bacteria 2456
382 Ga0207679_10212983 3300025945 Bacteria 1621
383 Ga0207667_10000015 3300025949 Bacteria 417534
384 Ga0207667_10012457 3300025949 Bacteria 9795
385 Ga0207651_10080207 3300025960 Bacteria 2348
386 Ga0207651_10128335 3300025960 Bacteria 1936
387 Ga0207712_10003737 3300025961 Bacteria 9606
388 Ga0207712_10010819 3300025961 Bacteria 5805
389 Ga0207712_10015720 3300025961 Bacteria 4888
390 Ga0207712_10018274 3300025961 Bacteria 4565
391 Ga0207712_10042455 3300025961 Bacteria 3131
392 Ga0207658_10076781 3300025986 Unclassified 2546
393 Ga0207658_10118779 3300025986 Bacteria 2104
394 Ga0207658_10141422 3300025986 Bacteria 1948
395 Ga0207677_10008316 3300026023 Bacteria 5787
396 Ga0207677_10009458 3300026023 Bacteria 5485
397 Ga0207677_10130409 3300026023 Bacteria 1907
398 Ga0207703_10016677 3300026035 Bacteria 5730
399 Ga0207703_10019532 3300026035 Bacteria 5295
400 Ga0207703_10082239 3300026035 Bacteria 2687
401 Ga0207703_10096803 3300026035 Bacteria 2492
402 Ga0207639_10009275 3300026041 Bacteria 6786
403 Ga0207639_10074306 3300026041 Bacteria 2669
404 Ga0207702_10048496 3300026078 Bacteria 3582
405 Ga0207702_10049475 3300026078 Bacteria 3547
406 Ga0207702_10131149 3300026078 Bacteria 2256
407 Ga0207641_10000448 3300026088 Bacteria 47082
408 Ga0207641_10001077 3300026088 Bacteria 27465
409 Ga0207641_10202813 3300026088 Bacteria 1830
410 Ga0207641_10261081 3300026088 Bacteria 1622
411 Ga0207648_10007503 3300026089 Bacteria 10713
412 Ga0207648_10007532 3300026089 Bacteria 10685
413 Ga0207648_10037679 3300026089 Bacteria 4260
414 Ga0207648_10116190 3300026089 Bacteria 2351
415 Ga0207648_10241290 3300026089 Bacteria 1609
416 Ga0207648_10431147 3300026089 Bacteria 1198
417 Ga0207676_10054277 3300026095 Bacteria 3140
418 Ga0207674_10000894 3300026116 Bacteria 38957
419 Ga0207674_10065548 3300026116 Bacteria 3660
420 Ga0207674_10271207 3300026116 Bacteria 1644
421 Ga0207675_100113338 3300026118 Bacteria 2560
422 Ga0207675_100322644 3300026118 Bacteria 1508
423 Ga0207683_10026793 3300026121 Bacteria 4979
424 Ga0207698_10003879 3300026142 Bacteria 9049
425 Ga0207698_10010495 3300026142 Bacteria 5959
426 Ga0207698_10024975 3300026142 Bacteria 4201
427 Ga0268266_10000121 3300028379 Bacteria 154995
428 Ga0268265_10059888 3300028380 Bacteria 2916
429 Ga0268265_10087769 3300028380 Bacteria 2476
430 Ga0268264_10002805 3300028381 Bacteria 15217
431 Ga0268264_10039477 3300028381 Bacteria 3901
432 Ga0268264_10086260 3300028381 Bacteria 2697
433 Ga0268264_10161729 3300028381 Bacteria 2018
434 Ga0268264_10371264 3300028381 Bacteria 1367
435 Ga0265334_10052976 3300028573 Bacteria 1551
436 Ga0307515_10000003 3300028794 Bacteria 891317
437 Ga0265338_10035459 3300028800 Bacteria 4795
438 Ga0316177_1209362 3300030731 Bacteria 5435
439 Ga0316176_1026201 3300030732 Bacteria 12822
440 Ga0316183_1106482 3300030742 Bacteria 31361
441 Ga0316181_1039179 3300030744 Bacteria 5421
442 Ga0316181_1249451 3300030744 Bacteria 1650
443 Ga0265327_10000073 3300031251 Bacteria 214772
444 Ga0265327_10000256 3300031251 Bacteria 105748
445 Ga0265327_10006644 3300031251 Bacteria 9186
446 Ga0265327_10022548 3300031251 Bacteria 3758
447 Ga0307513_10116236 3300031456 Bacteria 2655
448 Ga0307509_10033604 3300031507 Bacteria 5645
449 Ga0307408_100000396 3300031548 Bacteria 39439
450 Ga0307408_100000464 3300031548 Bacteria 35518
451 Ga0307408_100000560 3300031548 Bacteria 32128
452 Ga0307408_100001326 3300031548 Bacteria 18558
453 Ga0307408_100043965 3300031548 Bacteria 3181
454 Ga0307514_10095802 3300031649 Bacteria 2146
455 Ga0307405_10049721 3300031731 Bacteria 2593
456 Ga0307405_10194158 3300031731 Bacteria 1469
457 Ga0307410_10162893 3300031852 Bacteria 1673
458 Ga0307412_10000140 3300031911 Bacteria 52924
459 Ga0307412_10000292 3300031911 Bacteria 31826
460 Ga0307412_10009485 3300031911 Bacteria 5587
461 Ga0307412_10016208 3300031911 Bacteria 4433
462 Ga0307409_100143078 3300031995 Bacteria 2064
463 Ga0307416_100000020 3300032002 Bacteria 192862
464 Ga0307416_100000457 3300032002 Bacteria 20948
465 Ga0307416_100151244 3300032002 Bacteria 2129
466 Ga0307414_10000470 3300032004 Bacteria 21107
467 Ga0307414_10020454 3300032004 Bacteria 4126
468 Ga0307414_10032626 3300032004 Bacteria 3431
469 Ga0307414_10110557 3300032004 Bacteria 2091
470 Ga0307414_10201575 3300032004 Bacteria 1619
471 Ga0307414_10232414 3300032004 Bacteria 1521
472 Ga0307415_100015535 3300032126 Bacteria 4512
473 Ga0373955_0043317 3300035172 Bacteria 2421
474 Ga0373935_0054280 3300035692 Bacteria 2551
475 Ga0373947_0092909 3300035725 Bacteria 1885
476 Ga0373937_0031794 3300036401 Bacteria 4784
477 Ga0395899_0000024 3300037312 Bacteria 357402
478 Ga0395899_0000027 3300037312 Bacteria 337387
479 Ga0395899_0000064 3300037312 Bacteria 207082
480 Ga0395899_0019564 3300037312 Bacteria 5141
481 Ga0395900_0001518 3300037418 Bacteria 27559
482 Ga0395900_0006443 3300037418 Bacteria 12236
483 Ga0395900_0012681 3300037418 Bacteria 8618
484 Ga0395900_0504437 3300037418 Bacteria 1160
485 Ga0395898_0257836 3300037466 Bacteria 1663
486 Ga0395905_0000001 3300037471 Bacteria 2037079
487 Ga0395905_0000051 3300037471 Bacteria 223416
488 Ga0395905_0000327 3300037471 Bacteria 68334
489 Ga0395905_0126828 3300037471 Bacteria 2400
490 Ga0395901_0000921 3300038443 Bacteria 32043
491 Ga0395901_0008911 3300038443 Bacteria 10162
492 Ga0395901_0094508 3300038443 Bacteria 3132
493 Ga0436361_0906526 3300039447 Bacteria 5206
494 Ga0439465_0000035 3300041413 Bacteria 27339
495 Ga0439441_005762 3300042001 Bacteria 1938
496 Ga0439445_0003032 3300042004 Bacteria 3760
497 Ga0439445_0004249 3300042004 Bacteria 3241
498 Ga0439457_005817 3300042014 Bacteria 3061
499 Ga0450893_0005472 3300042532 Bacteria 2040
500 Ga0451577_0006314 3300042876 Bacteria 11859
501 Ga0451577_0021459 3300042876 Bacteria 5911
502 Ga0451577_0073662 3300042876 Bacteria 3047
503 Ga0466972_0000010 3300044658 Bacteria 256339
504 Ga0453683_0204503 3300044673 Bacteria 1254
505 Ga0466964_0018561 3300044706 Bacteria 2670
506 Ga0453684_0001733 3300044712 Bacteria 58391
507 Ga0453684_0079509 3300044712 Bacteria 4099
508 Ga0453684_0086754 3300044712 Bacteria 3882
509 Ga0453684_0342350 3300044712 Bacteria 1688
510 Ga0453684_0548830 3300044712 Bacteria 1273
511 Ga0466968_0033528 3300044735 Bacteria 2140
512 Ga0466970_0000471 3300044765 Bacteria 19964
513 Ga0466959_0130951 3300045049 Bacteria 1778
514 Ga0451576_0000002 3300045051 Bacteria 1670975
515 Ga0451576_0049378 3300045051 Bacteria 4415
516 Ga0495627_000029 3300046453 Bacteria 232349
517 Ga0495627_009281 3300046453 Bacteria 3628
518 Ga0495592_0045217 3300046454 Bacteria 3286
519 Ga0495638_0000026 3300046460 Bacteria 347061
520 Ga0495650_0000231 3300046471 Bacteria 113969
521 Ga0495585_0000037 3300046492 Bacteria 133335
522 Ga0495594_0124003 3300046499 Bacteria 1461
523 Ga0495596_0000410 3300046500 Bacteria 27433
524 Ga0495596_0011130 3300046500 Bacteria 3890
525 Ga0495606_0019314 3300046507 Bacteria 5076
526 Ga0495606_0053202 3300046507 Bacteria 2628
527 Ga0495610_0000001 3300046512 Bacteria 1620061
528 Ga0495610_0000129 3300046512 Bacteria 83051
529 Ga0495610_0001948 3300046512 Bacteria 17744
530 Ga0495628_0018695 3300046516 Bacteria 5735
531 Ga0495630_0086572 3300046517 Bacteria 2366
532 Ga0495631_0001037 3300046518 Bacteria 17230
533 Ga0495643_0032131 3300046522 Bacteria 2916
534 Ga0495663_0000021 3300046525 Bacteria 114041
535 Ga0495640_0128613 3300046533 Bacteria 1641
536 Ga0495609_0021448 3300046538 Bacteria 2980
537 Ga0495621_0043702 3300046539 Bacteria 1581
538 Ga0495622_0042631 3300046557 Bacteria 2110
539 Ga0495633_0000048 3300046558 Bacteria 158166
540 Ga0495633_0005148 3300046558 Bacteria 8102
541 Ga0495633_0009165 3300046558 Bacteria 5494
542 Ga0495625_0000191 3300046660 Bacteria 97363
543 Ga0495625_0058566 3300046660 Bacteria 2737
544 Ga0495625_0078383 3300046660 Bacteria 2306
545 Ga0495661_0026655 3300046665 Bacteria 3720
546 Ga0495647_0177445 3300046681 Bacteria 925
547 Ga0495658_0295566 3300046683 Bacteria 1024
548 Ga0495649_0000061 3300046694 Bacteria 97338
549 Ga0495649_0027895 3300046694 Bacteria 3131
550 Ga0495604_0039706 3300047317 Bacteria 3698
551 Ga0495674_0405508 3300047319 Bacteria 1100
552 Ga0495683_0081586 3300047323 Bacteria 1577
553 Ga0495687_022613 3300047443 Bacteria 3014
554 Ga0495686_0000153 3300047472 Bacteria 133256
555 Ga0495686_0000679 3300047472 Bacteria 46024
556 Ga0495686_0005442 3300047472 Bacteria 10043
557 Ga0495686_0012095 3300047472 Bacteria 6058
558 Ga0495686_0045737 3300047472 Bacteria 2769
559 Ga0495686_0074784 3300047472 Bacteria 2078
560 Ga0495614_0007507 3300048089 Bacteria 4854
561 Ga0496100_0359845 3300048903 Bacteria 1101
562 Ga0496102_0014102 3300048905 Bacteria 6944
563 Ga0496105_0175109 3300048908 Bacteria 1758
564 Ga0496113_0232315 3300048916 Bacteria 1471
565 Ga0496114_0001046 3300048917 Bacteria 20795
566 Ga0496116_0000037 3300048919 Bacteria 374675
567 Ga0496116_0003271 3300048919 Bacteria 16146
568 Ga0496117_0000086 3300048920 Bacteria 212331
569 Ga0496117_0006620 3300048920 Bacteria 11642
570 Ga0496118_0000284 3300048921 Bacteria 88966
571 Ga0496119_0000037 3300048922 Bacteria 210912
572 Ga0496121_0000010 3300048924 Bacteria 793488
573 Ga0496122_0000510 3300048925 Bacteria 80239
574 Ga0496122_0000602 3300048925 Bacteria 73995
575 Ga0496122_0003771 3300048925 Bacteria 19539
576 Ga0496122_0007262 3300048925 Bacteria 12391
577 Ga0496122_0051431 3300048925 Bacteria 3130
578 Ga0496122_0177638 3300048925 Bacteria 1274
579 Ga0496123_0013079 3300048926 Bacteria 7003
580 Ga0496123_0014595 3300048926 Bacteria 6497
581 Ga0496123_0051104 3300048926 Bacteria 2756
582 Ga0496124_0000555 3300048927 Bacteria 63173
583 Ga0496125_0012093 3300048928 Bacteria 8587
584 Ga0496125_0031801 3300048928 Bacteria 4697
585 Ga0496125_0049890 3300048928 Bacteria 3471
586 Ga0496126_0008259 3300048929 Bacteria 11243
587 Ga0501309_001077 3300049129 Bacteria 2543
588 Ga0501290_001153 3300049513 Bacteria 3710
589 Ga0501300_003387 3300049523 Bacteria 2383
590 Ga0501323_000515 3300049539 Bacteria 2903
591 Ga0501323_002692 3300049539 Bacteria 1748
592 Ga0501031_0015383 3300049568 Bacteria 4967
593 Ga0501032_0008235 3300049569 Bacteria 7601
594 Ga0501032_0042193 3300049569 Bacteria 3095
595 Ga0501033_0000085 3300049570 Bacteria 88350
596 Ga0501033_0014934 3300049570 Bacteria 5895
597 Ga0501034_0000308 3300049571 Bacteria 86738
598 Ga0501034_0061795 3300049571 Bacteria 3761
599 Ga0501034_0265365 3300049571 Bacteria 1659
600 Ga0501036_0033163 3300049572 Bacteria 4367
601 Ga0501036_0119218 3300049572 Bacteria 2228
602 Ga0501037_0013826 3300049573 Bacteria 5947
603 Ga0501037_0083489 3300049573 Bacteria 2314
604 Ga0501038_0002849 3300049574 Bacteria 16100
605 Ga0501038_0048753 3300049574 Bacteria 3664
606 Ga0501038_0069021 3300049574 Bacteria 3004
607 Ga0501043_0005704 3300049579 Bacteria 10029
608 Ga0501046_0033435 3300049580 Bacteria 4154
609 Ga0501047_0023531 3300049581 Bacteria 5912
610 Ga0501047_0117300 3300049581 Bacteria 2543
611 Ga0501067_0054349 3300049583 Unclassified 2219
612 Ga0501070_0006179 3300049586 Bacteria 10205
613 Ga0501073_0008853 3300049589 Bacteria 7443
614 Ga0501074_0018342 3300049590 Bacteria 5082
615 Ga0501201_000735 3300049651 Bacteria 3063
616 Ga0501202_001225 3300049652 Bacteria 4052
617 Ga0501217_006197 3300049661 Bacteria 2531
618 Ga0501217_039098 3300049661 Bacteria 1201
619 Ga0501222_000205 3300049662 Bacteria 10436
620 Ga0501223_000153 3300049663 Bacteria 18205
621 Ga0501223_000488 3300049663 Bacteria 9591
622 Ga0501223_001264 3300049663 Bacteria 5887
623 Ga0501235_000089 3300049669 Bacteria 14364
624 Ga0501236_000154 3300049670 Bacteria 7110
625 Ga0501243_000687 3300049675 Bacteria 4662
626 Ga0501257_004933 3300049686 Bacteria 2923
627 Ga0501257_008043 3300049686 Bacteria 2365
628 Ga0501259_000111 3300049688 Bacteria 11954
629 Ga0501221_000942 3300049704 Bacteria 4771
630 Ga0501225_0003289 3300049705 Bacteria 4924
631 Ga0501225_0013373 3300049705 Bacteria 2297
632 Ga0501225_0035083 3300049705 Bacteria 1381
633 Ga0501245_002236 3300049708 Bacteria 2578
634 Ga0501080_0046204 3300049742 Unclassified 4055
635 Ga0501080_0157282 3300049742 Bacteria 2099
636 Ga0501080_0393496 3300049742 Bacteria 1247
637 Ga0501083_0107045 3300049744 Bacteria 1840
638 Ga0501241_000009 3300049758 Bacteria 128695
639 Ga0501241_002609 3300049758 Bacteria 3473
640 Ga0501241_008479 3300049758 Bacteria 1876
641 Ga0501269_000025 3300049766 Bacteria 51990
642 Ga0501035_0011027 3300049822 Bacteria 8367
643 Ga0501044_0001663 3300049823 Bacteria 26095
644 Ga0501044_0048151 3300049823 Bacteria 4405
645 Ga0501045_0000206 3300049824 Bacteria 33751
646 nmdc:mga0k408_1014_c1 3300050493 Bacteria 15426
647 nmdc:mga09592_48708_c1 3300050508 Bacteria 3573
648 nmdc:mga09592_487723_c1 3300050508 Bacteria 1061
649 nmdc:mga0qj67_35982_c1 3300050509 Bacteria 3872
650 nmdc:mga06r32_43289_c1 3300050510 Bacteria 4284
651 nmdc:mga08y16_118091_c1 3300050511 Bacteria 2760
652 nmdc:mga08y16_224727_c1 3300050511 Bacteria 1943
653 nmdc:mga08y16_260820_c1 3300050511 Bacteria 1790
654 Ga0500646_0070179 3300053090 Bacteria 1049
655 Ga0500608_000440 3300053122 Bacteria 15676
656 Ga0500652_015113 3300053131 Bacteria 2778
657 Ga0500603_018625 3300053150 Bacteria 1675
658 Ga0500604_0002355 3300053151 Bacteria 5173
659 Ga0500616_0000043 3300053153 Bacteria 342930
660 Ga0500616_0092155 3300053153 Bacteria 1499
661 Ga0500622_0000163 3300053156 Bacteria 70679
662 Ga0500622_0000568 3300053156 Bacteria 33817
663 Ga0500622_0000895 3300053156 Bacteria 25374
664 Ga0500622_0002531 3300053156 Bacteria 13125
665 Ga0500622_0003011 3300053156 Bacteria 11645

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046557 Ga0495622_0042631 Ga0495622_0042631_59_904 257
2 3300046681 Ga0495647_0177445 Ga0495647_0177445_54_902 258
3 3300050508 nmdc:mga09592_487723_c1 nmdc:mga09592_487723_c1_35_904 263
4 3300050511 nmdc:mga08y16_260820_c1 nmdc:mga08y16_260820_c1_871_1740 263
5 3300049129 Ga0501309_001077 Ga0501309_001077_1655_2521 264
6 3300049539 Ga0501323_000515 Ga0501323_000515_36_902 264
7 3300025919 Ga0207657_10334650 Ga0207657_103346502 280
8 3300001915 JGI24741J21665_1002374 JGI24741J21665_10023743 288
9 3300003322 rootL2_10088809 rootL2_100888091 288
10 3300003323 rootH1_10005447 rootH1_1000544710 288
11 3300003578 Ga0006562J51391_1024690 Ga0006562J51391_10246904 288
12 3300005289 Ga0065704_10088141 Ga0065704_100881412 288
13 3300005337 Ga0070682_100000095 Ga0070682_10000009567 288
14 3300009148 Ga0105243_10000089 Ga0105243_100000895 288
15 3300009148 Ga0105243_10056016 Ga0105243_100560164 288
16 3300013100 Ga0157373_10000006 Ga0157373_10000006174 288
17 3300013104 Ga0157370_10005025 Ga0157370_1000502513 288
18 3300013308 Ga0157375_10083268 Ga0157375_100832683 288
19 3300014497 Ga0182008_10000003 Ga0182008_10000003350 288
20 3300015261 Ga0182006_1000079 Ga0182006_100007961 288
21 3300015262 Ga0182007_10016964 Ga0182007_100169642 288
22 3300025291 Ga0209675_1000159 Ga0209675_10001596 288
23 3300025935 Ga0207709_10000136 Ga0207709_100001369 288
24 3300025935 Ga0207709_10138315 Ga0207709_101383151 288
25 3300031911 Ga0307412_10000140 Ga0307412_1000014026 288
26 3300031911 Ga0307412_10016208 Ga0307412_100162084 288
27 3300032002 Ga0307416_100000020 Ga0307416_100000020131 288
28 3300042004 Ga0439445_0003032 Ga0439445_0003032_608_1672 288
29 3300046453 Ga0495627_000029 Ga0495627_000029_80094_81158 288
30 3300046453 Ga0495627_009281 Ga0495627_009281_1283_2347 288
31 3300046500 Ga0495596_0000410 Ga0495596_0000410_20208_21272 288
32 3300046512 Ga0495610_0000001 Ga0495610_0000001_65009_66073 288
33 3300046522 Ga0495643_0032131 Ga0495643_0032131_51_1115 288
34 3300046558 Ga0495633_0000048 Ga0495633_0000048_152107_153171 288
35 3300046558 Ga0495633_0009165 Ga0495633_0009165_594_1658 288
36 3300047472 Ga0495686_0000153 Ga0495686_0000153_71413_72477 288
37 3300047472 Ga0495686_0012095 Ga0495686_0012095_4900_5964 288
38 3300048905 Ga0496102_0014102 Ga0496102_0014102_5205_6269 288
39 3300048916 Ga0496113_0232315 Ga0496113_0232315_178_1242 288
40 3300048919 Ga0496116_0000037 Ga0496116_0000037_67823_68887 288
41 3300048920 Ga0496117_0000086 Ga0496117_0000086_67709_68773 288
42 3300048921 Ga0496118_0000284 Ga0496118_0000284_20195_21259 288
43 3300048922 Ga0496119_0000037 Ga0496119_0000037_67758_68822 288
44 3300048925 Ga0496122_0000510 Ga0496122_0000510_75836_76900 288
45 3300048925 Ga0496122_0000602 Ga0496122_0000602_32406_33470 288
46 3300048925 Ga0496122_0003771 Ga0496122_0003771_18433_19497 288
47 3300048925 Ga0496122_0051431 Ga0496122_0051431_1296_2360 288
48 3300048926 Ga0496123_0013079 Ga0496123_0013079_1407_2471 288
49 3300048926 Ga0496123_0014595 Ga0496123_0014595_1514_2578 288
50 3300048927 Ga0496124_0000555 Ga0496124_0000555_26387_27451 288
51 3300048928 Ga0496125_0012093 Ga0496125_0012093_6083_7147 288
52 3300048928 Ga0496125_0049890 Ga0496125_0049890_1174_2238 288
53 3300048929 Ga0496126_0008259 Ga0496126_0008259_3632_4696 288
54 3300031731 Ga0307405_10194158 Ga0307405_101941582 291
55 3300031911 Ga0307412_10000292 Ga0307412_1000029228 291
56 3300041413 Ga0439465_0000035 Ga0439465_0000035_15720_16784 291
57 3300048928 Ga0496125_0031801 Ga0496125_0031801_3737_4669 291
58 3300049758 Ga0501241_000009 Ga0501241_000009_62838_63902 291
59 3300049766 Ga0501269_000025 Ga0501269_000025_5984_7048 291
60 3300053090 Ga0500646_0070179 Ga0500646_0070179_73_1035 296
61 3300046683 Ga0495658_0295566 Ga0495658_0295566_22_981 297
62 3300013102 Ga0157371_10042314 Ga0157371_100423144 300
63 3300046525 Ga0495663_0000021 Ga0495663_0000021_107020_108084 300
64 3300026089 Ga0207648_10431147 Ga0207648_104311472 301
65 3300053150 Ga0500603_018625 Ga0500603_018625_535_1608 301
66 3300009545 Ga0105237_10026749 Ga0105237_100267492 303
67 3300025914 Ga0207671_10057163 Ga0207671_100571632 303
68 3300042001 Ga0439441_005762 Ga0439441_005762_656_1690 303
69 3300047323 Ga0495683_0081586 Ga0495683_0081586_39_1010 303
70 3300049513 Ga0501290_001153 Ga0501290_001153_1808_2857 303
71 3300049651 Ga0501201_000735 Ga0501201_000735_655_1704 303
72 3300049652 Ga0501202_001225 Ga0501202_001225_1342_2391 303
73 3300049661 Ga0501217_006197 Ga0501217_006197_1374_2423 303
74 3300049661 Ga0501217_039098 Ga0501217_039098_37_1044 303
75 3300049662 Ga0501222_000205 Ga0501222_000205_8084_9133 303
76 3300049663 Ga0501223_001264 Ga0501223_001264_3282_4331 303
77 3300049669 Ga0501235_000089 Ga0501235_000089_11449_12498 303
78 3300049675 Ga0501243_000687 Ga0501243_000687_1264_2313 303
79 3300049686 Ga0501257_008043 Ga0501257_008043_160_1209 303
80 3300049688 Ga0501259_000111 Ga0501259_000111_2827_3876 303
81 3300049704 Ga0501221_000942 Ga0501221_000942_3621_4670 303
82 3300049705 Ga0501225_0003289 Ga0501225_0003289_1258_2307 303
83 3300049708 Ga0501245_002236 Ga0501245_002236_219_1283 303
84 3300049758 Ga0501241_008479 Ga0501241_008479_698_1747 303
85 3300053156 Ga0500622_0000568 Ga0500622_0000568_28453_29496 303
86 3300038443 Ga0395901_0000921 Ga0395901_0000921_28931_29989 304
87 3300005356 Ga0070674_100004529 Ga0070674_1000045295 305
88 3300025945 Ga0207679_10061526 Ga0207679_100615263 305
89 3300026118 Ga0207675_100113338 Ga0207675_1001133382 305
90 3300046500 Ga0495596_0011130 Ga0495596_0011130_1651_2679 305
91 3300046518 Ga0495631_0001037 Ga0495631_0001037_9892_10920 305
92 3300037418 Ga0395900_0001518 Ga0395900_0001518_20002_21045 306
93 3300046694 Ga0495649_0027895 Ga0495649_0027895_796_1827 306
94 3300047319 Ga0495674_0405508 Ga0495674_0405508_88_1074 306
95 3300005539 Ga0068853_100129114 Ga0068853_1001291142 307
96 3300025908 Ga0207643_10056090 Ga0207643_100560901 307
97 3300026041 Ga0207639_10074306 Ga0207639_100743062 307
98 3300005290 Ga0065712_10088061 Ga0065712_100880612 308
99 3300005548 Ga0070665_100000118 Ga0070665_100000118112 308
100 3300009093 Ga0105240_10017563 Ga0105240_100175633 308
101 3300009093 Ga0105240_10262897 Ga0105240_102628972 308
102 3300025272 Ga0209455_1008606 Ga0209455_10086062 308
103 3300025913 Ga0207695_10014909 Ga0207695_100149095 308
104 3300025913 Ga0207695_10046838 Ga0207695_100468385 308
105 3300028379 Ga0268266_10000121 Ga0268266_1000012144 308
106 3300050511 nmdc:mga08y16_118091_c1 nmdc:mga08y16_118091_c1_1447_2487 308
107 3300048089 Ga0495614_0007507 Ga0495614_0007507_1137_2195 309
108 3300003323 rootH1_10027403 rootH1_1002740318 310
109 3300005328 Ga0070676_10000113 Ga0070676_1000011327 310
110 3300005338 Ga0068868_100094324 Ga0068868_1000943242 310
111 3300005364 Ga0070673_100031160 Ga0070673_1000311601 310
112 3300005456 Ga0070678_100023305 Ga0070678_1000233053 310
113 3300005459 Ga0068867_100003787 Ga0068867_10000378713 310
114 3300005616 Ga0068852_100026093 Ga0068852_1000260932 310
115 3300005718 Ga0068866_10016357 Ga0068866_100163573 310
116 3300006237 Ga0097621_100000015 Ga0097621_10000001581 310
117 3300006358 Ga0068871_100000051 Ga0068871_10000005164 310
118 3300006881 Ga0068865_100002736 Ga0068865_1000027367 310
119 3300006881 Ga0068865_100109836 Ga0068865_1001098362 310
120 3300009174 Ga0105241_10005937 Ga0105241_100059373 310
121 3300009545 Ga0105237_10001895 Ga0105237_1000189522 310
122 3300009551 Ga0105238_10059144 Ga0105238_100591445 310
123 3300011119 Ga0105246_10092551 Ga0105246_100925512 310
124 3300013296 Ga0157374_10001665 Ga0157374_1000166511 310
125 3300013297 Ga0157378_10026892 Ga0157378_100268923 310
126 3300021361 Ga0213872_10025003 Ga0213872_100250033 310
127 3300025907 Ga0207645_10000229 Ga0207645_1000022934 310
128 3300025911 Ga0207654_10006962 Ga0207654_100069625 310
129 3300025914 Ga0207671_10012946 Ga0207671_100129463 310
130 3300025924 Ga0207694_10035816 Ga0207694_100358162 310
131 3300025938 Ga0207704_10000047 Ga0207704_1000004740 310
132 3300026023 Ga0207677_10130409 Ga0207677_101304093 310
133 3300026041 Ga0207639_10009275 Ga0207639_100092753 310
134 3300026089 Ga0207648_10007503 Ga0207648_1000750313 310
135 3300026142 Ga0207698_10010495 Ga0207698_100104957 310
136 3300039447 Ga0436361_0906526 Ga0436361_0906526_2779_3810 310
137 3300003320 rootH2_10012714 rootH2_1001271444 311
138 3300005547 Ga0070693_100078210 Ga0070693_1000782102 311
139 3300025250 Ga0209026_1005112 Ga0209026_10051124 311
140 3300049742 Ga0501080_0157282 Ga0501080_0157282_374_1420 311
141 3300005334 Ga0068869_100064432 Ga0068869_1000644322 312
142 3300005344 Ga0070661_100076574 Ga0070661_1000765743 312
143 3300005354 Ga0070675_100118016 Ga0070675_1001180162 312
144 3300005564 Ga0070664_100004250 Ga0070664_1000042506 312
145 3300005617 Ga0068859_100171588 Ga0068859_1001715882 312
146 3300006931 Ga0097620_100171599 Ga0097620_1001715992 312
147 3300014745 Ga0157377_10023161 Ga0157377_100231613 312
148 3300025901 Ga0207688_10014315 Ga0207688_100143155 312
149 3300025942 Ga0207689_10073320 Ga0207689_100733202 312
150 3300025945 Ga0207679_10082428 Ga0207679_100824282 312
151 3300049568 Ga0501031_0015383 Ga0501031_0015383_2036_3058 312
152 3300049569 Ga0501032_0008235 Ga0501032_0008235_3568_4590 312
153 3300049570 Ga0501033_0000085 Ga0501033_0000085_12825_13847 312
154 3300049571 Ga0501034_0000308 Ga0501034_0000308_5617_6639 312
155 3300049572 Ga0501036_0119218 Ga0501036_0119218_1028_2050 312
156 3300049573 Ga0501037_0013826 Ga0501037_0013826_552_1574 312
157 3300049574 Ga0501038_0002849 Ga0501038_0002849_14223_15245 312
158 3300049574 Ga0501038_0048753 Ga0501038_0048753_165_1187 312
159 3300049579 Ga0501043_0005704 Ga0501043_0005704_2129_3151 312
160 3300049822 Ga0501035_0011027 Ga0501035_0011027_5234_6256 312
161 3300049823 Ga0501044_0048151 Ga0501044_0048151_1674_2696 312
162 3300049824 Ga0501045_0000206 Ga0501045_0000206_27470_28492 312
163 3300053122 Ga0500608_000440 Ga0500608_000440_11945_12979 312
164 3300049569 Ga0501032_0042193 Ga0501032_0042193_1877_2929 313
165 3300049571 Ga0501034_0061795 Ga0501034_0061795_2153_3205 313
166 3300049572 Ga0501036_0033163 Ga0501036_0033163_1928_2980 313
167 3300049573 Ga0501037_0083489 Ga0501037_0083489_146_1198 313
168 3300049574 Ga0501038_0069021 Ga0501038_0069021_1771_2823 313
169 3300049580 Ga0501046_0033435 Ga0501046_0033435_1105_2157 313
170 3300049581 Ga0501047_0117300 Ga0501047_0117300_1139_2191 313
171 3300049583 Ga0501067_0054349 Ga0501067_0054349_648_1700 313
172 3300049586 Ga0501070_0006179 Ga0501070_0006179_1461_2513 313
173 3300049589 Ga0501073_0008853 Ga0501073_0008853_4091_5143 313
174 3300049590 Ga0501074_0018342 Ga0501074_0018342_2164_3216 313
175 3300049742 Ga0501080_0046204 Ga0501080_0046204_1362_2414 313
176 3300049744 Ga0501083_0107045 Ga0501083_0107045_483_1535 313
177 3300049823 Ga0501044_0001663 Ga0501044_0001663_11452_12504 313
178 3300003323 rootH1_10012675 rootH1_100126752 314
179 3300048908 Ga0496105_0175109 Ga0496105_0175109_692_1723 314
180 iso_pu_bacteria 2511231000 2511233952 314
181 iso_pu_bacteria 2582581278 2585142430 314
182 iso_pu_bacteria 2582581281 2585156962 314
183 iso_pu_bacteria 2582581282 2585161481 314
184 iso_pu_bacteria 2585428045 2587681185 314
185 iso_pu_bacteria 2585428060 2587748901 314
186 iso_pu_bacteria 2585428061 2587753624 314
187 iso_pu_bacteria 2585428115 2587942513 314
188 iso_pu_bacteria 2585428182 2588211770 314
189 iso_pu_bacteria 2585428183 2588216567 314
190 iso_pu_bacteria 2585428184 2588220643 314
191 iso_pu_bacteria 2585428185 2588225932 314
192 iso_pu_bacteria 2585428187 2588230991 314
193 iso_pu_bacteria 2588253712 2588447837 314
194 iso_pu_bacteria 2588254255 2590603603 314
195 iso_pu_bacteria 2588254257 2590610481 314
196 iso_pu_bacteria 2728369107 2729202481 314
197 iso_pu_bacteria 2738541273 2738699962 314
198 iso_pu_bacteria 2738543014 2739253711 314
199 iso_pu_bacteria 2751185877 2753674967 314
200 iso_pu_bacteria 2765235839 2765575974 314
201 iso_pu_bacteria 2772190705 2772607398 314
202 iso_pu_bacteria 2775506739 2775674081 314
203 iso_pu_bacteria 2816332188 2816875676 314
204 iso_pu_bacteria 2842083920 2842087833 314
205 iso_pu_bacteria 2871720351 2871724772 314
206 iso_pu_bacteria 2889290771 2889293534 314
207 iso_pu_bacteria 2905999023 2906002077 314
208 iso_pu_bacteria 2919097161 2919099963 314
209 iso_pu_bacteria 2919399522 2919403494 314
210 iso_pu_bacteria 2929921140 2929927686 314
211 iso_pu_bacteria 2945924605 2945928657 314
212 iso_pu_bacteria 2946019816 2946019902 314
213 iso_pu_bacteria 2977243572 2977247494 314
214 iso_pu_bacteria 2993372514 2993374822 314
215 iso_pu_bacteria 2993480792 2993481678 314
216 iso_pu_bacteria 8003151029 8003151533 314
217 iso_pu_bacteria 2929177148 2929183301 315
218 iso_pu_bacteria 2929239360 2929245419 315
219 iso_pu_bacteria 2945977869 2945979261 315
220 iso_pu_bacteria 2946013367 2946014868 315
221 3300001979 JGI24740J21852_10016845 JGI24740J21852_100168452 316
222 3300002738 JGI25154J39366_1000020 JGI25154J39366_100002072 316
223 3300005834 Ga0068851_10000057 Ga0068851_1000005710 316
224 3300006844 Ga0075428_100086344 Ga0075428_1000863444 316
225 3300010375 Ga0105239_10200999 Ga0105239_102009993 316
226 3300025246 Ga0209646_1000005 Ga0209646_1000005489 316
227 3300025250 Ga0209026_1000149 Ga0209026_100014918 316
228 3300025258 Ga0209129_1007350 Ga0209129_10073505 316
229 3300025302 Ga0207426_1000262 Ga0207426_100026241 316
230 3300025321 Ga0207656_10000048 Ga0207656_1000004839 316
231 3300032004 Ga0307414_10020454 Ga0307414_100204543 316
232 3300032004 Ga0307414_10032626 Ga0307414_100326263 316
233 3300032004 Ga0307414_10232414 Ga0307414_102324142 316
234 3300042876 Ga0451577_0021459 Ga0451577_0021459_1608_2636 316
235 3300048924 Ga0496121_0000010 Ga0496121_0000010_187357_188391 316
236 3300049571 Ga0501034_0265365 Ga0501034_0265365_329_1381 316
237 3300049742 Ga0501080_0393496 Ga0501080_0393496_98_1150 316
238 3300053131 Ga0500652_015113 Ga0500652_015113_1644_2678 316
239 3300053156 Ga0500622_0003011 Ga0500622_0003011_6365_7417 316
240 iso_pu_bacteria 2929154850 2929158423 316
241 3300003322 rootL2_10009362 rootL2_100093622 317
242 3300003794 Ga0055531_10000132 Ga0055531_1000013266 317
243 3300005340 Ga0070689_100218782 Ga0070689_1002187822 317
244 3300005354 Ga0070675_100041897 Ga0070675_1000418973 317
245 3300005365 Ga0070688_100015669 Ga0070688_1000156692 317
246 3300005471 Ga0070698_100003913 Ga0070698_1000039134 317
247 3300005543 Ga0070672_100141682 Ga0070672_1001416822 317
248 3300005616 Ga0068852_100079569 Ga0068852_1000795692 317
249 3300005618 Ga0068864_100505402 Ga0068864_1005054021 317
250 3300005841 Ga0068863_100014098 Ga0068863_1000140988 317
251 3300005842 Ga0068858_100146620 Ga0068858_1001466202 317
252 3300005844 Ga0068862_100187919 Ga0068862_1001879192 317
253 3300006358 Ga0068871_100318227 Ga0068871_1003182271 317
254 3300006844 Ga0075428_100071519 Ga0075428_1000715194 317
255 3300006846 Ga0075430_100034421 Ga0075430_1000344215 317
256 3300006847 Ga0075431_100069264 Ga0075431_1000692642 317
257 3300006880 Ga0075429_100252160 Ga0075429_1002521601 317
258 3300006881 Ga0068865_100080837 Ga0068865_1000808373 317
259 3300009176 Ga0105242_10040197 Ga0105242_100401972 317
260 3300013296 Ga0157374_10560652 Ga0157374_105606521 317
261 3300014325 Ga0163163_10219127 Ga0163163_102191272 317
262 3300014745 Ga0157377_10096723 Ga0157377_100967232 317
263 3300014969 Ga0157376_10208429 Ga0157376_102084292 317
264 3300025918 Ga0207662_10097041 Ga0207662_100970412 317
265 3300025926 Ga0207659_10007464 Ga0207659_100074644 317
266 3300025934 Ga0207686_10004707 Ga0207686_100047074 317
267 3300025936 Ga0207670_10028297 Ga0207670_100282974 317
268 3300025940 Ga0207691_10014922 Ga0207691_100149229 317
269 3300026035 Ga0207703_10019532 Ga0207703_100195325 317
270 3300026088 Ga0207641_10000448 Ga0207641_1000044838 317
271 3300046499 Ga0495594_0124003 Ga0495594_0124003_208_1245 317
272 3300046539 Ga0495621_0043702 Ga0495621_0043702_129_1166 317
273 3300050508 nmdc:mga09592_48708_c1 nmdc:mga09592_48708_c1_233_1270 317
274 3300050509 nmdc:mga0qj67_35982_c1 nmdc:mga0qj67_35982_c1_1530_2567 317
275 3300050510 nmdc:mga06r32_43289_c1 nmdc:mga06r32_43289_c1_1736_2773 317
276 3300003320 rootH2_10005563 rootH2_100055636 318
277 3300005290 Ga0065712_10005831 Ga0065712_100058313 318
278 3300005290 Ga0065712_10072974 Ga0065712_100729745 318
279 3300005334 Ga0068869_100032192 Ga0068869_1000321924 318
280 3300005365 Ga0070688_100011134 Ga0070688_1000111342 318
281 3300005466 Ga0070685_10027123 Ga0070685_100271232 318
282 3300005466 Ga0070685_10123650 Ga0070685_101236502 318
283 3300005577 Ga0068857_100112367 Ga0068857_1001123672 318
284 3300006237 Ga0097621_100074955 Ga0097621_1000749553 318
285 3300009553 Ga0105249_10007529 Ga0105249_100075294 318
286 3300009553 Ga0105249_10059302 Ga0105249_100593023 318
287 3300013100 Ga0157373_10025296 Ga0157373_100252965 318
288 3300013308 Ga0157375_10093696 Ga0157375_100936963 318
289 3300017792 Ga0163161_10014389 Ga0163161_100143892 318
290 3300025961 Ga0207712_10010819 Ga0207712_100108192 318
291 3300025961 Ga0207712_10018274 Ga0207712_100182742 318
292 3300026078 Ga0207702_10049475 Ga0207702_100494754 318
293 3300026089 Ga0207648_10116190 Ga0207648_101161901 318
294 3300026116 Ga0207674_10271207 Ga0207674_102712072 318
295 3300044658 Ga0466972_0000010 Ga0466972_0000010_92992_94035 318
296 3300044673 Ga0453683_0204503 Ga0453683_0204503_65_1105 318
297 3300044735 Ga0466968_0033528 Ga0466968_0033528_211_1254 318
298 3300044765 Ga0466970_0000471 Ga0466970_0000471_13598_14641 318
299 3300046538 Ga0495609_0021448 Ga0495609_0021448_84_1121 318
300 3300048903 Ga0496100_0359845 Ga0496100_0359845_13_1047 318
301 3300042876 Ga0451577_0006314 Ga0451577_0006314_7587_8657 319
302 iso_pu_bacteria 2852623160 2852627064 319
303 iso_pu_bacteria 2884933994 2884935202 319
304 iso_pu_bacteria 2928078545 2928083285 319
305 3300005334 Ga0068869_100044765 Ga0068869_1000447653 320
306 3300005844 Ga0068862_100122192 Ga0068862_1001221922 320
307 3300006844 Ga0075428_100295416 Ga0075428_1002954162 320
308 3300009094 Ga0111539_10121157 Ga0111539_101211572 320
309 3300009148 Ga0105243_10267417 Ga0105243_102674172 320
310 3300009176 Ga0105242_10023597 Ga0105242_100235975 320
311 3300009545 Ga0105237_10001504 Ga0105237_100015047 320
312 3300009553 Ga0105249_10056562 Ga0105249_100565622 320
313 3300010375 Ga0105239_10000166 Ga0105239_1000016640 320
314 3300013102 Ga0157371_10038939 Ga0157371_100389392 320
315 3300013307 Ga0157372_10033521 Ga0157372_100335213 320
316 3300013307 Ga0157372_10355418 Ga0157372_103554182 320
317 3300013307 Ga0157372_10385494 Ga0157372_103854941 320
318 3300013307 Ga0157372_10614255 Ga0157372_106142551 320
319 3300013308 Ga0157375_10070243 Ga0157375_100702435 320
320 3300014326 Ga0157380_10033408 Ga0157380_100334082 320
321 3300025914 Ga0207671_10007623 Ga0207671_100076233 320
322 3300025942 Ga0207689_10031652 Ga0207689_100316523 320
323 3300026089 Ga0207648_10037679 Ga0207648_100376792 320
324 3300031548 Ga0307408_100000396 Ga0307408_10000039622 320
325 3300037418 Ga0395900_0504437 Ga0395900_0504437_53_1114 320
326 3300044712 Ga0453684_0086754 Ga0453684_0086754_2434_3465 320
327 3300044712 Ga0453684_0342350 Ga0453684_0342350_424_1467 320
328 3300047472 Ga0495686_0074784 Ga0495686_0074784_752_1783 320
329 3300001979 JGI24740J21852_10025207 JGI24740J21852_100252072 321
330 3300005289 Ga0065704_10005995 Ga0065704_100059953 321
331 3300005290 Ga0065712_10095713 Ga0065712_100957131 321
332 3300005329 Ga0070683_100000553 Ga0070683_10000055316 321
333 3300005329 Ga0070683_100004195 Ga0070683_1000041956 321
334 3300005329 Ga0070683_100148647 Ga0070683_1001486471 321
335 3300005329 Ga0070683_100164739 Ga0070683_1001647392 321
336 3300005334 Ga0068869_100020182 Ga0068869_1000201822 321
337 3300005334 Ga0068869_100032055 Ga0068869_1000320552 321
338 3300005334 Ga0068869_100042888 Ga0068869_1000428882 321
339 3300005335 Ga0070666_10038276 Ga0070666_100382761 321
340 3300005338 Ga0068868_100006083 Ga0068868_1000060837 321
341 3300005338 Ga0068868_100006616 Ga0068868_10000661610 321
342 3300005338 Ga0068868_100025162 Ga0068868_1000251621 321
343 3300005340 Ga0070689_100002494 Ga0070689_1000024942 321
344 3300005340 Ga0070689_100021302 Ga0070689_1000213022 321
345 3300005343 Ga0070687_100174905 Ga0070687_1001749051 321
346 3300005344 Ga0070661_100000179 Ga0070661_1000001799 321
347 3300005344 Ga0070661_100044057 Ga0070661_1000440574 321
348 3300005355 Ga0070671_100163158 Ga0070671_1001631581 321
349 3300005364 Ga0070673_100109466 Ga0070673_1001094662 321
350 3300005365 Ga0070688_100038106 Ga0070688_1000381061 321
351 3300005365 Ga0070688_100098046 Ga0070688_1000980463 321
352 3300005366 Ga0070659_100025291 Ga0070659_1000252915 321
353 3300005366 Ga0070659_100131931 Ga0070659_1001319312 321
354 3300005367 Ga0070667_100095701 Ga0070667_1000957013 321
355 3300005455 Ga0070663_100140558 Ga0070663_1001405581 321
356 3300005456 Ga0070678_100021468 Ga0070678_1000214685 321
357 3300005457 Ga0070662_100012586 Ga0070662_1000125865 321
358 3300005457 Ga0070662_100013751 Ga0070662_1000137512 321
359 3300005457 Ga0070662_100021047 Ga0070662_1000210475 321
360 3300005457 Ga0070662_100330288 Ga0070662_1003302881 321
361 3300005459 Ga0068867_100065084 Ga0068867_1000650843 321
362 3300005459 Ga0068867_100195453 Ga0068867_1001954532 321
363 3300005535 Ga0070684_100001469 Ga0070684_1000014697 321
364 3300005535 Ga0070684_100065293 Ga0070684_1000652934 321
365 3300005539 Ga0068853_100024340 Ga0068853_1000243403 321
366 3300005539 Ga0068853_100182403 Ga0068853_1001824031 321
367 3300005543 Ga0070672_100050257 Ga0070672_1000502574 321
368 3300005544 Ga0070686_100053016 Ga0070686_1000530162 321
369 3300005564 Ga0070664_100001077 Ga0070664_1000010773 321
370 3300005564 Ga0070664_100139753 Ga0070664_1001397532 321
371 3300005577 Ga0068857_100046270 Ga0068857_1000462704 321
372 3300005618 Ga0068864_100077517 Ga0068864_1000775174 321
373 3300005618 Ga0068864_100443316 Ga0068864_1004433161 321
374 3300005834 Ga0068851_10065723 Ga0068851_100657232 321
375 3300005841 Ga0068863_100273684 Ga0068863_1002736842 321
376 3300005842 Ga0068858_100169281 Ga0068858_1001692812 321
377 3300005842 Ga0068858_100252025 Ga0068858_1002520251 321
378 3300005844 Ga0068862_100242902 Ga0068862_1002429022 321
379 3300005985 Ga0081539_10013758 Ga0081539_100137585 321
380 3300006358 Ga0068871_100102960 Ga0068871_1001029603 321
381 3300006881 Ga0068865_100148045 Ga0068865_1001480452 321
382 3300009545 Ga0105237_10023370 Ga0105237_100233703 321
383 3300010375 Ga0105239_10023061 Ga0105239_100230612 321
384 3300013100 Ga0157373_10053330 Ga0157373_100533302 321
385 3300013102 Ga0157371_10001199 Ga0157371_1000119925 321
386 3300013102 Ga0157371_10011057 Ga0157371_100110576 321
387 3300013104 Ga0157370_10010241 Ga0157370_100102417 321
388 3300013105 Ga0157369_10003605 Ga0157369_100036059 321
389 3300013105 Ga0157369_10030384 Ga0157369_100303845 321
390 3300013296 Ga0157374_10002410 Ga0157374_1000241017 321
391 3300013296 Ga0157374_10033689 Ga0157374_100336892 321
392 3300013296 Ga0157374_10035226 Ga0157374_100352262 321
393 3300013306 Ga0163162_10002066 Ga0163162_1000206617 321
394 3300013306 Ga0163162_10126140 Ga0163162_101261402 321
395 3300013306 Ga0163162_10191838 Ga0163162_101918381 321
396 3300013307 Ga0157372_10000039 Ga0157372_1000003935 321
397 3300013307 Ga0157372_10155743 Ga0157372_101557433 321
398 3300013307 Ga0157372_10534894 Ga0157372_105348941 321
399 3300013308 Ga0157375_10056899 Ga0157375_100568994 321
400 3300013308 Ga0157375_10060974 Ga0157375_100609743 321
401 3300013308 Ga0157375_10173258 Ga0157375_101732582 321
402 3300014325 Ga0163163_10000088 Ga0163163_1000008816 321
403 3300014745 Ga0157377_10002113 Ga0157377_100021131 321
404 3300014968 Ga0157379_10078807 Ga0157379_100788072 321
405 3300017792 Ga0163161_10012415 Ga0163161_100124152 321
406 3300017792 Ga0163161_10044867 Ga0163161_100448674 321
407 3300017792 Ga0163161_10075077 Ga0163161_100750772 321
408 3300025302 Ga0207426_1000059 Ga0207426_1000059300 321
409 3300025321 Ga0207656_10098938 Ga0207656_100989381 321
410 3300025899 Ga0207642_10026071 Ga0207642_100260711 321
411 3300025903 Ga0207680_10095130 Ga0207680_100951301 321
412 3300025920 Ga0207649_10005271 Ga0207649_100052714 321
413 3300025920 Ga0207649_10304353 Ga0207649_103043531 321
414 3300025925 Ga0207650_10192912 Ga0207650_101929122 321
415 3300025926 Ga0207659_10010641 Ga0207659_100106413 321
416 3300025932 Ga0207690_10004290 Ga0207690_100042908 321
417 3300025933 Ga0207706_10010295 Ga0207706_1001029511 321
418 3300025933 Ga0207706_10019515 Ga0207706_100195152 321
419 3300025933 Ga0207706_10039441 Ga0207706_100394413 321
420 3300025933 Ga0207706_10057952 Ga0207706_100579525 321
421 3300025934 Ga0207686_10073256 Ga0207686_100732561 321
422 3300025936 Ga0207670_10011472 Ga0207670_100114725 321
423 3300025938 Ga0207704_10152129 Ga0207704_101521292 321
424 3300025940 Ga0207691_10011157 Ga0207691_100111574 321
425 3300025942 Ga0207689_10025266 Ga0207689_100252661 321
426 3300025942 Ga0207689_10029603 Ga0207689_100296032 321
427 3300025942 Ga0207689_10118628 Ga0207689_101186283 321
428 3300025944 Ga0207661_10018216 Ga0207661_100182162 321
429 3300025944 Ga0207661_10022846 Ga0207661_100228463 321
430 3300025944 Ga0207661_10143564 Ga0207661_101435641 321
431 3300025944 Ga0207661_10369109 Ga0207661_103691091 321
432 3300025945 Ga0207679_10001674 Ga0207679_100016748 321
433 3300025945 Ga0207679_10003082 Ga0207679_1000308210 321
434 3300025945 Ga0207679_10082863 Ga0207679_100828632 321
435 3300025960 Ga0207651_10080207 Ga0207651_100802073 321
436 3300025960 Ga0207651_10128335 Ga0207651_101283352 321
437 3300025986 Ga0207658_10076781 Ga0207658_100767811 321
438 3300025986 Ga0207658_10118779 Ga0207658_101187792 321
439 3300026023 Ga0207677_10008316 Ga0207677_100083162 321
440 3300026023 Ga0207677_10009458 Ga0207677_100094583 321
441 3300026035 Ga0207703_10096803 Ga0207703_100968032 321
442 3300026089 Ga0207648_10241290 Ga0207648_102412901 321
443 3300026116 Ga0207674_10000894 Ga0207674_1000089424 321
444 3300026116 Ga0207674_10065548 Ga0207674_100655484 321
445 3300026121 Ga0207683_10026793 Ga0207683_100267936 321
446 3300028380 Ga0268265_10087769 Ga0268265_100877691 321
447 3300028381 Ga0268264_10161729 Ga0268264_101617292 321
448 3300028381 Ga0268264_10371264 Ga0268264_103712642 321
449 3300028573 Ga0265334_10052976 Ga0265334_100529762 321
450 3300031251 Ga0265327_10000073 Ga0265327_1000007349 321
451 3300031548 Ga0307408_100043965 Ga0307408_1000439653 321
452 3300031731 Ga0307405_10049721 Ga0307405_100497212 321
453 3300031852 Ga0307410_10162893 Ga0307410_101628932 321
454 3300031995 Ga0307409_100143078 Ga0307409_1001430782 321
455 3300032002 Ga0307416_100000457 Ga0307416_10000045710 321
456 3300032126 Ga0307415_100015535 Ga0307415_1000155353 321
457 3300035172 Ga0373955_0043317 Ga0373955_0043317_1122_2171 321
458 3300035692 Ga0373935_0054280 Ga0373935_0054280_869_1918 321
459 3300035725 Ga0373947_0092909 Ga0373947_0092909_652_1701 321
460 3300036401 Ga0373937_0031794 Ga0373937_0031794_3014_4063 321
461 3300037312 Ga0395899_0000024 Ga0395899_0000024_325317_326354 321
462 3300037312 Ga0395899_0000064 Ga0395899_0000064_61131_62177 321
463 3300037418 Ga0395900_0012681 Ga0395900_0012681_3683_4729 321
464 3300042004 Ga0439445_0004249 Ga0439445_0004249_25_1080 321
465 3300044712 Ga0453684_0079509 Ga0453684_0079509_2157_3179 321
466 3300044712 Ga0453684_0548830 Ga0453684_0548830_137_1186 321
467 3300046454 Ga0495592_0045217 Ga0495592_0045217_1736_2785 321
468 3300046516 Ga0495628_0018695 Ga0495628_0018695_605_1654 321
469 3300046517 Ga0495630_0086572 Ga0495630_0086572_130_1179 321
470 3300046533 Ga0495640_0128613 Ga0495640_0128613_302_1423 321
471 3300046660 Ga0495625_0078383 Ga0495625_0078383_734_1795 321
472 3300047317 Ga0495604_0039706 Ga0495604_0039706_2045_3094 321
473 3300049570 Ga0501033_0014934 Ga0501033_0014934_2907_3965 321
474 3300049663 Ga0501223_000153 Ga0501223_000153_5371_6501 321
475 3300049705 Ga0501225_0035083 Ga0501225_0035083_203_1336 321
476 3300053156 Ga0500622_0002531 Ga0500622_0002531_10943_12004 321
477 iso_pu_bacteria 2738541283 2738756039 321
478 iso_pu_bacteria 2738543023 2739304131 321
479 3300003316 rootH1_10004943 rootH1_100049432 322
480 3300003322 rootL2_10151563 rootL2_101515632 322
481 3300005327 Ga0070658_10158374 Ga0070658_101583742 322
482 3300005331 Ga0070670_100035680 Ga0070670_1000356802 322
483 3300005334 Ga0068869_100012829 Ga0068869_1000128294 322
484 3300005334 Ga0068869_100122259 Ga0068869_1001222592 322
485 3300005356 Ga0070674_100063980 Ga0070674_1000639802 322
486 3300005367 Ga0070667_100142934 Ga0070667_1001429342 322
487 3300005564 Ga0070664_100349367 Ga0070664_1003493671 322
488 3300005577 Ga0068857_100122124 Ga0068857_1001221242 322
489 3300005617 Ga0068859_100014773 Ga0068859_1000147738 322
490 3300005618 Ga0068864_100030528 Ga0068864_1000305283 322
491 3300005842 Ga0068858_100363142 Ga0068858_1003631422 322
492 3300005843 Ga0068860_100123196 Ga0068860_1001231962 322
493 3300005844 Ga0068862_100137308 Ga0068862_1001373081 322
494 3300006846 Ga0075430_100287046 Ga0075430_1002870462 322
495 3300006931 Ga0097620_100014774 Ga0097620_1000147748 322
496 3300009093 Ga0105240_10188688 Ga0105240_101886882 322
497 3300009101 Ga0105247_10002997 Ga0105247_1000299710 322
498 3300009553 Ga0105249_10018555 Ga0105249_100185554 322
499 3300009553 Ga0105249_10026565 Ga0105249_100265656 322
500 3300013100 Ga0157373_10001842 Ga0157373_100018422 322
501 3300013100 Ga0157373_10009487 Ga0157373_100094872 322
502 3300013307 Ga0157372_10041830 Ga0157372_100418301 322
503 3300013308 Ga0157375_10231830 Ga0157375_102318302 322
504 3300014325 Ga0163163_10235113 Ga0163163_102351132 322
505 3300014968 Ga0157379_10531207 Ga0157379_105312071 322
506 3300025900 Ga0207710_10001252 Ga0207710_100012527 322
507 3300025945 Ga0207679_10212983 Ga0207679_102129831 322
508 3300025961 Ga0207712_10015720 Ga0207712_100157202 322
509 3300025961 Ga0207712_10042455 Ga0207712_100424553 322
510 3300026088 Ga0207641_10202813 Ga0207641_102028133 322
511 3300026095 Ga0207676_10054277 Ga0207676_100542773 322
512 3300026118 Ga0207675_100322644 Ga0207675_1003226442 322
513 3300028380 Ga0268265_10059888 Ga0268265_100598884 322
514 3300028381 Ga0268264_10086260 Ga0268264_100862603 322
515 3300028800 Ga0265338_10035459 Ga0265338_100354595 322
516 3300032004 Ga0307414_10201575 Ga0307414_102015752 322
517 3300042532 Ga0450893_0005472 Ga0450893_0005472_494_1534 322
518 3300047472 Ga0495686_0005442 Ga0495686_0005442_7735_8769 322
519 3300049670 Ga0501236_000154 Ga0501236_000154_4578_5618 322
520 3300049686 Ga0501257_004933 Ga0501257_004933_708_1748 322
521 3300049705 Ga0501225_0013373 Ga0501225_0013373_619_1659 322
522 iso_pu_bacteria 2849281842 2849284226 322
523 3300001904 JGI24736J21556_1004595 JGI24736J21556_10045952 323
524 3300001979 JGI24740J21852_10021582 JGI24740J21852_100215823 323
525 3300001990 JGI24737J22298_10015866 JGI24737J22298_100158662 323
526 3300002067 JGI24735J21928_10023534 JGI24735J21928_100235342 323
527 3300002737 JGI25162J39368_1000562 JGI25162J39368_100056225 323
528 3300003214 JGI25165J46597_1002545 JGI25165J46597_10025455 323
529 3300003320 rootH2_10056449 rootH2_100564492 323
530 3300003323 rootH1_10012646 rootH1_1001264655 323
531 3300003794 Ga0055531_10000868 Ga0055531_1000086814 323
532 3300004799 Ga0058863_10008894 Ga0058863_100088948 323
533 3300004800 Ga0058861_10875503 Ga0058861_108755032 323
534 3300004803 Ga0058862_10143705 Ga0058862_101437059 323
535 3300005336 Ga0070680_100005673 Ga0070680_1000056736 323
536 3300005366 Ga0070659_100000868 Ga0070659_10000086824 323
537 3300005458 Ga0070681_10019337 Ga0070681_100193375 323
538 3300005530 Ga0070679_100137891 Ga0070679_1001378914 323
539 3300005563 Ga0068855_100000049 Ga0068855_100000049131 323
540 3300005614 Ga0068856_100007533 Ga0068856_10000753312 323
541 3300005614 Ga0068856_100016616 Ga0068856_1000166163 323
542 3300005617 Ga0068859_100167794 Ga0068859_1001677942 323
543 3300006195 Ga0075366_10000556 Ga0075366_100005566 323
544 3300006931 Ga0097620_100167788 Ga0097620_1001677883 323
545 3300013100 Ga0157373_10314564 Ga0157373_103145641 323
546 3300013102 Ga0157371_10000107 Ga0157371_1000010732 323
547 3300013307 Ga0157372_10000238 Ga0157372_1000023820 323
548 3300013307 Ga0157372_10038960 Ga0157372_100389605 323
549 3300014326 Ga0157380_10353017 Ga0157380_103530172 323
550 3300025231 Ga0207427_100122 Ga0207427_10012237 323
551 3300025233 Ga0209437_100048 Ga0209437_100048259 323
552 3300025261 Ga0209233_1000029 Ga0209233_1000029117 323
553 3300025261 Ga0209233_1001271 Ga0209233_10012717 323
554 3300025304 Ga0209257_1000006 Ga0209257_1000006717 323
555 3300025904 Ga0207647_10000071 Ga0207647_1000007151 323
556 3300025912 Ga0207707_10013779 Ga0207707_100137796 323
557 3300025921 Ga0207652_10003461 Ga0207652_100034618 323
558 3300025932 Ga0207690_10001688 Ga0207690_1000168813 323
559 3300025932 Ga0207690_10017044 Ga0207690_100170444 323
560 3300025949 Ga0207667_10000015 Ga0207667_10000015381 323
561 3300026035 Ga0207703_10082239 Ga0207703_100822394 323
562 3300026078 Ga0207702_10048496 Ga0207702_100484962 323
563 3300026088 Ga0207641_10261081 Ga0207641_102610812 323
564 3300028794 Ga0307515_10000003 Ga0307515_10000003711 323
565 3300031507 Ga0307509_10033604 Ga0307509_100336045 323
566 3300031649 Ga0307514_10095802 Ga0307514_100958022 323
567 3300037312 Ga0395899_0000027 Ga0395899_0000027_121936_122967 323
568 3300037312 Ga0395899_0019564 Ga0395899_0019564_3047_4102 323
569 3300037418 Ga0395900_0006443 Ga0395900_0006443_8653_9708 323
570 3300037466 Ga0395898_0257836 Ga0395898_0257836_11_1066 323
571 3300037471 Ga0395905_0000327 Ga0395905_0000327_24770_25825 323
572 3300038443 Ga0395901_0008911 Ga0395901_0008911_112_1167 323
573 3300044706 Ga0466964_0018561 Ga0466964_0018561_843_1886 323
574 3300046507 Ga0495606_0053202 Ga0495606_0053202_1568_2611 323
575 3300046660 Ga0495625_0058566 Ga0495625_0058566_1581_2624 323
576 3300047472 Ga0495686_0000679 Ga0495686_0000679_41374_42417 323
577 3300048917 Ga0496114_0001046 Ga0496114_0001046_18524_19597 323
578 3300050493 nmdc:mga0k408_1014_c1 nmdc:mga0k408_1014_c1_3067_4098 323
579 3300050511 nmdc:mga08y16_224727_c1 nmdc:mga08y16_224727_c1_638_1681 323
580 iso_pu_bacteria 2522125168 2522549153 323
581 iso_pu_bacteria 2842903701 2842904794 323
582 iso_pu_bacteria 2890737413 2890738862 323
583 iso_pu_bacteria 2896317667 2896320619 323
584 iso_pu_bacteria 2898713307 2898714492 323
585 iso_pu_bacteria 8055588893 8055592073 323
586 3300005347 Ga0070668_100320212 Ga0070668_1003202121 324
587 3300005459 Ga0068867_100023969 Ga0068867_1000239695 324
588 3300005614 Ga0068856_100592044 Ga0068856_1005920441 324
589 3300005843 Ga0068860_100089002 Ga0068860_1000890023 324
590 3300009176 Ga0105242_10093693 Ga0105242_100936932 324
591 3300025899 Ga0207642_10012112 Ga0207642_100121122 324
592 3300025934 Ga0207686_10092089 Ga0207686_100920892 324
593 3300025942 Ga0207689_10260325 Ga0207689_102603252 324
594 3300026089 Ga0207648_10007532 Ga0207648_1000753210 324
595 3300028381 Ga0268264_10039477 Ga0268264_100394773 324
596 3300031251 Ga0265327_10000256 Ga0265327_1000025612 324
597 3300031251 Ga0265327_10006644 Ga0265327_1000664410 324
598 3300037471 Ga0395905_0000001 Ga0395905_0000001_1591917_1592963 324
599 3300042876 Ga0451577_0073662 Ga0451577_0073662_930_1961 324
600 3300045049 Ga0466959_0130951 Ga0466959_0130951_315_1361 324
601 3300049523 Ga0501300_003387 Ga0501300_003387_434_1480 324
602 3300049539 Ga0501323_002692 Ga0501323_002692_403_1449 324
603 3300053153 Ga0500616_0000043 Ga0500616_0000043_269510_270556 324
604 3300053153 Ga0500616_0092155 Ga0500616_0092155_46_1092 324
605 iso_pu_bacteria 2721755487 2722731092 324
606 iso_pu_bacteria 2896344016 2896345420 324
607 iso_pu_bacteria 2904780799 2904783378 324
608 iso_pu_bacteria 2919177583 2919181244 324
609 iso_pu_bacteria 3003233435 3003235838 324
610 3300003322 rootL2_10282716 rootL2_102827162 325
611 3300003781 Ga0055536_1000006 Ga0055536_100000674 325
612 3300003781 Ga0055536_1007763 Ga0055536_10077634 325
613 3300005262 Ga0065165_1000601 Ga0065165_100060153 325
614 3300005288 Ga0065714_10092478 Ga0065714_100924782 325
615 3300014497 Ga0182008_10045280 Ga0182008_100452802 325
616 3300014745 Ga0157377_10063195 Ga0157377_100631952 325
617 3300025292 Ga0209676_1000485 Ga0209676_100048556 325
618 3300032004 Ga0307414_10000470 Ga0307414_1000047014 325
619 3300032004 Ga0307414_10110557 Ga0307414_101105572 325
620 3300037471 Ga0395905_0000051 Ga0395905_0000051_165035_166093 325
621 3300037471 Ga0395905_0126828 Ga0395905_0126828_80_1159 325
622 3300038443 Ga0395901_0094508 Ga0395901_0094508_1489_2547 325
623 3300044712 Ga0453684_0001733 Ga0453684_0001733_28843_29874 325
624 3300045051 Ga0451576_0049378 Ga0451576_0049378_152_1183 325
625 3300046460 Ga0495638_0000026 Ga0495638_0000026_154644_155693 325
626 3300005335 Ga0070666_10000019 Ga0070666_10000019169 326
627 3300005347 Ga0070668_100088574 Ga0070668_1000885742 326
628 3300005355 Ga0070671_100244093 Ga0070671_1002440932 326
629 3300005364 Ga0070673_100139309 Ga0070673_1001393092 326
630 3300005366 Ga0070659_100010826 Ga0070659_10001082610 326
631 3300005456 Ga0070678_100067946 Ga0070678_1000679462 326
632 3300005563 Ga0068855_100024523 Ga0068855_1000245233 326
633 3300005614 Ga0068856_100021650 Ga0068856_1000216502 326
634 3300005616 Ga0068852_100004192 Ga0068852_1000041928 326
635 3300005617 Ga0068859_100000013 Ga0068859_100000013203 326
636 3300005834 Ga0068851_10030248 Ga0068851_100302483 326
637 3300005841 Ga0068863_100010161 Ga0068863_1000101616 326
638 3300005842 Ga0068858_100001874 Ga0068858_10000187418 326
639 3300005843 Ga0068860_100001911 Ga0068860_1000019114 326
640 3300006358 Ga0068871_100276159 Ga0068871_1002761592 326
641 3300006931 Ga0097620_100000013 Ga0097620_100000013203 326
642 3300009101 Ga0105247_10013814 Ga0105247_100138142 326
643 3300009174 Ga0105241_10001659 Ga0105241_100016598 326
644 3300009176 Ga0105242_10027714 Ga0105242_100277145 326
645 3300009545 Ga0105237_10088785 Ga0105237_100887852 326
646 3300009553 Ga0105249_10008471 Ga0105249_100084718 326
647 3300013306 Ga0163162_10000595 Ga0163162_1000059519 326
648 3300013307 Ga0157372_10128863 Ga0157372_101288633 326
649 3300013308 Ga0157375_10069271 Ga0157375_100692712 326
650 3300014325 Ga0163163_10203143 Ga0163163_102031431 326
651 3300014968 Ga0157379_10151332 Ga0157379_101513322 326
652 3300025321 Ga0207656_10017235 Ga0207656_100172352 326
653 3300025903 Ga0207680_10000586 Ga0207680_1000058614 326
654 3300025931 Ga0207644_10148372 Ga0207644_101483722 326
655 3300025932 Ga0207690_10007668 Ga0207690_100076681 326
656 3300025942 Ga0207689_10104438 Ga0207689_101044382 326
657 3300025949 Ga0207667_10012457 Ga0207667_100124573 326
658 3300025961 Ga0207712_10003737 Ga0207712_100037378 326
659 3300026035 Ga0207703_10016677 Ga0207703_100166773 326
660 3300026078 Ga0207702_10131149 Ga0207702_101311492 326
661 3300026088 Ga0207641_10001077 Ga0207641_1000107715 326
662 3300026142 Ga0207698_10003879 Ga0207698_100038797 326
663 3300028381 Ga0268264_10002805 Ga0268264_100028056 326
664 3300031251 Ga0265327_10022548 Ga0265327_100225482 326
665 3300031456 Ga0307513_10116236 Ga0307513_101162362 326
666 3300031548 Ga0307408_100000464 Ga0307408_10000046413 326
667 3300031548 Ga0307408_100000560 Ga0307408_1000005605 326
668 3300031548 Ga0307408_100001326 Ga0307408_10000132613 326
669 3300031911 Ga0307412_10009485 Ga0307412_100094853 326
670 3300032002 Ga0307416_100151244 Ga0307416_1001512442 326
671 3300042014 Ga0439457_005817 Ga0439457_005817_1450_2508 326
672 3300046512 Ga0495610_0000129 Ga0495610_0000129_72939_73994 326
673 3300049758 Ga0501241_002609 Ga0501241_002609_1425_2555 326
674 3300053151 Ga0500604_0002355 Ga0500604_0002355_3325_4380 326
675 3300053156 Ga0500622_0000163 Ga0500622_0000163_17209_18261 326
676 3300053156 Ga0500622_0000895 Ga0500622_0000895_7299_8351 326
677 3300001979 JGI24740J21852_10022760 JGI24740J21852_100227602 327
678 3300002737 JGI25162J39368_1000118 JGI25162J39368_10001184 327
679 3300005367 Ga0070667_100131921 Ga0070667_1001319212 327
680 3300005563 Ga0068855_100054484 Ga0068855_1000544842 327
681 3300005616 Ga0068852_100029170 Ga0068852_1000291704 327
682 3300005843 Ga0068860_100013335 Ga0068860_1000133357 327
683 3300005985 Ga0081539_10124610 Ga0081539_101246101 327
684 3300009093 Ga0105240_10037888 Ga0105240_100378885 327
685 3300009093 Ga0105240_10060549 Ga0105240_100605495 327
686 3300009545 Ga0105237_10072090 Ga0105237_100720904 327
687 3300010375 Ga0105239_10017420 Ga0105239_100174205 327
688 3300010375 Ga0105239_10345862 Ga0105239_103458622 327
689 3300013306 Ga0163162_10001704 Ga0163162_1000170410 327
690 3300013306 Ga0163162_10039941 Ga0163162_100399414 327
691 3300025233 Ga0209437_100102 Ga0209437_100102146 327
692 3300025913 Ga0207695_10046352 Ga0207695_100463523 327
693 3300025914 Ga0207671_10006548 Ga0207671_100065482 327
694 3300025914 Ga0207671_10026732 Ga0207671_100267321 327
695 3300025986 Ga0207658_10141422 Ga0207658_101414222 327
696 3300026142 Ga0207698_10024975 Ga0207698_100249756 327
697 3300030731 Ga0316177_1209362 Ga0316177_12093623 327
698 3300030732 Ga0316176_1026201 Ga0316176_10262016 327
699 3300030742 Ga0316183_1106482 Ga0316183_110648224 327
700 3300030744 Ga0316181_1039179 Ga0316181_10391794 327
701 3300030744 Ga0316181_1249451 Ga0316181_12494512 327
702 3300045051 Ga0451576_0000002 Ga0451576_0000002_77355_78410 327
703 3300046471 Ga0495650_0000231 Ga0495650_0000231_36779_37822 327
704 3300046492 Ga0495585_0000037 Ga0495585_0000037_41251_42294 327
705 3300046507 Ga0495606_0019314 Ga0495606_0019314_2458_3501 327
706 3300046512 Ga0495610_0001948 Ga0495610_0001948_585_1628 327
707 3300046558 Ga0495633_0005148 Ga0495633_0005148_6570_7613 327
708 3300046660 Ga0495625_0000191 Ga0495625_0000191_56700_57743 327
709 3300046665 Ga0495661_0026655 Ga0495661_0026655_1643_2686 327
710 3300046694 Ga0495649_0000061 Ga0495649_0000061_39621_40664 327
711 3300047443 Ga0495687_022613 Ga0495687_022613_1067_2110 327
712 3300047472 Ga0495686_0045737 Ga0495686_0045737_636_1679 327
713 3300048919 Ga0496116_0003271 Ga0496116_0003271_12669_13709 328
714 3300048920 Ga0496117_0006620 Ga0496117_0006620_468_1508 328
715 3300048925 Ga0496122_0007262 Ga0496122_0007262_1565_2605 328
716 3300048925 Ga0496122_0177638 Ga0496122_0177638_27_1070 328
717 3300048926 Ga0496123_0051104 Ga0496123_0051104_1551_2594 328
718 3300049581 Ga0501047_0023531 Ga0501047_0023531_4113_5168 328
719 3300049663 Ga0501223_000488 Ga0501223_000488_2027_3076 328
720 2162886007 SwRhRL2b_contig_3345962 SwRhRL2b_0557.00004740 329
721 3300005289 Ga0065704_10004114 Ga0065704_100041146 329
722 3300009148 Ga0105243_10000003 Ga0105243_1000000360 329
723 3300025935 Ga0207709_10000008 Ga0207709_10000008514 329

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00146

NADHdh

NADH dehydrogenase

5

333

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e9h-assembly1.cif.gz_H mycobacterial respiratory complex i, fully-inserted quinone 0.8298 9 326
6l7o-assembly1.cif.gz_A cryo-em structure of cyanobacteria fd-ndh-1l complex 0.8118 15 321
8e9h-assembly1.cif.gz_H mycobacterial respiratory complex i, fully-inserted quinone 0.8017 9 326
7f9o-assembly1.cif.gz_G psi-ndh supercomplex of barley 0.8015 15 321
5xtc-assembly1.cif.gz_s cryo-em structure of human respiratory complex i transmembrane arm 0.793 13 325
ID Description Score Start End Superfamily
5ic0A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4432 76 164 1.20.120.230
2x0cA02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4393 73 171 1.20.120.230
af_A0A0R4ICV1_14_295_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3692 53 329 1.20.1070.10
af_Q9BPV8_31_335_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3691 53 328 1.20.1070.10
af_K7LDZ9_70_274_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3372 76 246 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A538STI4-F1-model_v4 NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) 0.9823 78 207 GO:0003954
GO:0005886
GO:0008137
GO:0009060
GO:0048038
AF-A0A2V8A2L9-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.9418 57 165 GO:0003954
GO:0005886
GO:0009060
AF-A0A6N9C8V2-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.911 5 182 GO:0003954
GO:0005886
GO:0009060
AF-A0A661IBR2-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.9091 1 182 GO:0003954
GO:0005886
GO:0009060
AF-A0A382CZ91-F1-model_v4 NADH-quinone oxidoreductase subunit H 0.9077 6 202 GO:0003954
GO:0009060
GO:0016020

Feature Viewer

pLDDT pTM Quality
72.76 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map