F477526
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 723 | 366 | 665 | 342 |
Family's Representative Sequence
| Representative Sequence | 3300049705|Ga0501225_0035083|Ga0501225_0035083_203_1336 |
| Length | 377 |
| Sequence | MIAKIILIVALFAITLGIAAYLTWMERKVAAWLQDRVGPDRAGKWGLLQPLADGGKMFFKEDFIPAMADRRLFILGPGIAMFTSFLTGAVIPWGPDLTLFGETVSLQVSNANIGVLFAMGIASVGVYGILIGGWASNNKFSLFGAIRASSQMISYELAMGISIITIVMMSGSLNLRDIVDQQAGFWDNGWFTWNFFKQPLCFLVFLVCALAECNRAPFDLAECESELIGGYHTEFGAMKLGFYLFAEYINMFISCAIISTVFFGGYHFPFESHFSGIWLTLLGVGAMFAKTIFFIFVFMWIRWTLPRFRYDQLMHLGWKKLIPISLVNLLITGFVIAFVSGWFTKEKPQPKMDASKPKTEQPLSLNTSNSKKTNKLH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231000 | Chryseobacterium populi CF314 | Isolate | Rhizosphere |
| 3 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 4 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 5 | 2582581281 | Chryseobacterium sp. CF284 | Isolate | Rhizosphere |
| 6 | 2582581282 | Chryseobacterium sp. CF299 | Isolate | Rhizosphere |
| 7 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 8 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 9 | 2585428061 | Chryseobacterium sp. CF356 | Isolate | Rhizosphere |
| 10 | 2585428115 | Chryseobacterium sp. YR561 | Isolate | Rhizosphere |
| 11 | 2585428182 | Chryseobacterium sp. YR477 | Isolate | Rhizosphere |
| 12 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 13 | 2585428184 | Chryseobacterium sp. YR480 | Isolate | Rhizosphere |
| 14 | 2585428185 | Chryseobacterium sp. YR459 | Isolate | Rhizosphere |
| 15 | 2585428187 | Chryseobacterium sp. YR460 | Isolate | Rhizosphere |
| 16 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 17 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 18 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 19 | 2721755487 | Sphingobacterium sp. B29 | Isolate | Rhizosphere |
| 20 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 21 | 2738541273 | Elizabethkingia sp. YR214 | Isolate | Unclassified |
| 22 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 23 | 2738543014 | Elizabethkingia sp. YR191 | Isolate | Unclassified |
| 24 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 25 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 26 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 27 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 28 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 29 | 2816332188 | Chryseobacterium aquifrigidense 110 (version 2) | Isolate | Unclassified |
| 30 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 31 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 32 | 2849281842 | Pedobacter sp. AK013 | Isolate | Rhizosphere |
| 33 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 34 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 35 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 36 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 37 | 2890737413 | Parapedobacter sp. SGR-10 | Isolate | Rhizosphere |
| 38 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 39 | 2896344016 | Sphingobacterium sp. SGL-16 | Isolate | Rhizosphere |
| 40 | 2898713307 | Sphingobacterium sp. SGG-5 | Isolate | Rhizosphere |
| 41 | 2904780799 | Sphingobacterium sp. 1304 | Isolate | Rhizosphere |
| 42 | 2905999023 | Chryseobacterium elymi KCTC 22547 | Isolate | Rhizosphere |
| 43 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 44 | 2919177583 | Sphingobacterium sp. 2149 | Isolate | Rhizosphere |
| 45 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 46 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 47 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 48 | 2929177148 | Chitinophaga sp. R-72269 Hybrid assembly | Isolate | Unclassified |
| 49 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 50 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 51 | 2945924605 | Chryseobacterium ginsenosidimutans W1I9 | Isolate | Rhizosphere |
| 52 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 53 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 54 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 55 | 2977243572 | Chryseobacterium sp. SORGH_AS 447 | Isolate | Unclassified |
| 56 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 57 | 2993480792 | Chryseobacterium nepalense SLBN-92 | Isolate | Rhizosphere |
| 58 | 3003233435 | Sphingobacterium shayense CrR18 | Isolate | Unclassified |
| 59 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 60 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 61 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 62 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 63 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 64 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 65 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 66 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 67 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 68 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 69 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 70 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 71 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 72 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 73 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 75 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 76 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 77 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 78 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 79 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 81 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 86 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 88 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 89 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 90 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 92 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 99 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 105 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 106 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 107 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 111 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 113 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 116 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 118 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 119 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 120 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 121 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 122 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 123 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 124 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 125 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 126 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 127 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 128 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 129 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 130 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 132 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 133 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 134 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 135 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 136 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 137 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 161 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 165 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 166 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 168 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 171 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 172 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 173 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 176 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 177 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 228 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 229 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 230 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 231 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 232 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 233 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 234 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 235 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 236 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 239 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 240 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 246 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 251 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 254 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 255 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 256 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 257 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 258 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 259 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 260 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 263 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 264 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 265 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 266 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 267 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 268 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 269 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 270 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 301 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 304 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 305 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 306 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 307 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 308 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 311 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 317 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 318 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 324 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 331 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 334 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 335 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 336 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 337 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 338 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 339 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 340 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 341 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 342 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 343 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 344 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 345 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 346 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 349 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 350 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 354 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 355 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 356 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 357 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 358 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 359 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 360 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 361 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 362 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 363 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 364 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 365 | 8003151029 | Chitinophaga sp. GbtcB8 | Isolate | Unclassified |
| 366 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.87 |
| Metatranscriptomes | 0.97 |
| Isolates | 8.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.7 |
| Nodule | 0.14 |
| Rhizoplane | 0.69 |
| Rhizosphere | 86.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3345962 | 2162886007 | Bacteria | 1208 |
| 2 | JGI24736J21556_1004595 | 3300001904 | Bacteria | 2352 |
| 3 | JGI24741J21665_1002374 | 3300001915 | Bacteria | 4923 |
| 4 | JGI24740J21852_10016845 | 3300001979 | Bacteria | 2630 |
| 5 | JGI24740J21852_10021582 | 3300001979 | Bacteria | 2231 |
| 6 | JGI24740J21852_10022760 | 3300001979 | Bacteria | 2152 |
| 7 | JGI24740J21852_10025207 | 3300001979 | Bacteria | 2008 |
| 8 | JGI24737J22298_10015866 | 3300001990 | Bacteria | 2435 |
| 9 | JGI24735J21928_10023534 | 3300002067 | Bacteria | 1867 |
| 10 | JGI25162J39368_1000118 | 3300002737 | Bacteria | 87343 |
| 11 | JGI25162J39368_1000562 | 3300002737 | Bacteria | 27227 |
| 12 | JGI25154J39366_1000020 | 3300002738 | Bacteria | 233181 |
| 13 | JGI25165J46597_1002545 | 3300003214 | Bacteria | 5692 |
| 14 | rootH1_10004943 | 3300003316 | Bacteria | 35922 |
| 15 | rootH1_10004943 | 3300003323 | Bacteria | 7849 |
| 16 | rootH2_10005563 | 3300003320 | Bacteria | 5437 |
| 17 | rootH2_10012714 | 3300003320 | Bacteria | 66260 |
| 18 | rootH2_10056449 | 3300003320 | Bacteria | 2163 |
| 19 | rootL2_10009362 | 3300003322 | Bacteria | 3048 |
| 20 | rootL2_10088809 | 3300003322 | Bacteria | 7503 |
| 21 | rootL2_10151563 | 3300003322 | Bacteria | 3704 |
| 22 | rootL2_10282716 | 3300003322 | Bacteria | 2227 |
| 23 | rootH1_10005447 | 3300003323 | Bacteria | 15107 |
| 24 | rootH1_10012646 | 3300003323 | Bacteria | 62371 |
| 25 | rootH1_10012675 | 3300003323 | Bacteria | 2281 |
| 26 | rootH1_10027403 | 3300003323 | Bacteria | 72977 |
| 27 | Ga0006562J51391_1024690 | 3300003578 | Bacteria | 4473 |
| 28 | Ga0055536_1000006 | 3300003781 | Bacteria | 347733 |
| 29 | Ga0055536_1007763 | 3300003781 | Bacteria | 4742 |
| 30 | Ga0055531_10000132 | 3300003794 | Bacteria | 85251 |
| 31 | Ga0055531_10000868 | 3300003794 | Bacteria | 24791 |
| 32 | Ga0058863_10008894 | 3300004799 | Bacteria | 11745 |
| 33 | Ga0058861_10875503 | 3300004800 | Bacteria | 1533 |
| 34 | Ga0058862_10143705 | 3300004803 | Bacteria | 8181 |
| 35 | Ga0065165_1000601 | 3300005262 | Bacteria | 52747 |
| 36 | Ga0065714_10092478 | 3300005288 | Bacteria | 1876 |
| 37 | Ga0065704_10004114 | 3300005289 | Bacteria | 5658 |
| 38 | Ga0065704_10005995 | 3300005289 | Bacteria | 5046 |
| 39 | Ga0065704_10088141 | 3300005289 | Bacteria | 2962 |
| 40 | Ga0065712_10005831 | 3300005290 | Bacteria | 3684 |
| 41 | Ga0065712_10072974 | 3300005290 | Bacteria | 4496 |
| 42 | Ga0065712_10088061 | 3300005290 | Bacteria | 2540 |
| 43 | Ga0065712_10095713 | 3300005290 | Bacteria | 2203 |
| 44 | Ga0070658_10158374 | 3300005327 | Unclassified | 1899 |
| 45 | Ga0070676_10000113 | 3300005328 | Bacteria | 29666 |
| 46 | Ga0070683_100000553 | 3300005329 | Bacteria | 26515 |
| 47 | Ga0070683_100004195 | 3300005329 | Bacteria | 11821 |
| 48 | Ga0070683_100148647 | 3300005329 | Bacteria | 2221 |
| 49 | Ga0070683_100164739 | 3300005329 | Bacteria | 2103 |
| 50 | Ga0070670_100035680 | 3300005331 | Bacteria | 4280 |
| 51 | Ga0068869_100012829 | 3300005334 | Bacteria | 5545 |
| 52 | Ga0068869_100020182 | 3300005334 | Bacteria | 4566 |
| 53 | Ga0068869_100032055 | 3300005334 | Bacteria | 3701 |
| 54 | Ga0068869_100032192 | 3300005334 | Bacteria | 3693 |
| 55 | Ga0068869_100042888 | 3300005334 | Bacteria | 3246 |
| 56 | Ga0068869_100044765 | 3300005334 | Bacteria | 3183 |
| 57 | Ga0068869_100064432 | 3300005334 | Bacteria | 2696 |
| 58 | Ga0068869_100122259 | 3300005334 | Bacteria | 1992 |
| 59 | Ga0070666_10000019 | 3300005335 | Bacteria | 185877 |
| 60 | Ga0070666_10038276 | 3300005335 | Bacteria | 3190 |
| 61 | Ga0070680_100005673 | 3300005336 | Bacteria | 9465 |
| 62 | Ga0070682_100000095 | 3300005337 | Bacteria | 80688 |
| 63 | Ga0068868_100006083 | 3300005338 | Bacteria | 8522 |
| 64 | Ga0068868_100006616 | 3300005338 | Bacteria | 8217 |
| 65 | Ga0068868_100025162 | 3300005338 | Bacteria | 4522 |
| 66 | Ga0068868_100094324 | 3300005338 | Bacteria | 2414 |
| 67 | Ga0070689_100002494 | 3300005340 | Bacteria | 12028 |
| 68 | Ga0070689_100021302 | 3300005340 | Bacteria | 4823 |
| 69 | Ga0070689_100218782 | 3300005340 | Bacteria | 1561 |
| 70 | Ga0070687_100174905 | 3300005343 | Bacteria | 1281 |
| 71 | Ga0070661_100000179 | 3300005344 | Bacteria | 52306 |
| 72 | Ga0070661_100044057 | 3300005344 | Bacteria | 3259 |
| 73 | Ga0070661_100076574 | 3300005344 | Bacteria | 2465 |
| 74 | Ga0070668_100088574 | 3300005347 | Bacteria | 2437 |
| 75 | Ga0070668_100320212 | 3300005347 | Bacteria | 1305 |
| 76 | Ga0070675_100041897 | 3300005354 | Bacteria | 3740 |
| 77 | Ga0070675_100118016 | 3300005354 | Bacteria | 2252 |
| 78 | Ga0070671_100163158 | 3300005355 | Bacteria | 1883 |
| 79 | Ga0070671_100244093 | 3300005355 | Bacteria | 1525 |
| 80 | Ga0070674_100004529 | 3300005356 | Bacteria | 7935 |
| 81 | Ga0070674_100063980 | 3300005356 | Bacteria | 2576 |
| 82 | Ga0070673_100031160 | 3300005364 | Bacteria | 3999 |
| 83 | Ga0070673_100109466 | 3300005364 | Bacteria | 2289 |
| 84 | Ga0070673_100139309 | 3300005364 | Bacteria | 2045 |
| 85 | Ga0070688_100011134 | 3300005365 | Bacteria | 4993 |
| 86 | Ga0070688_100015669 | 3300005365 | Bacteria | 4319 |
| 87 | Ga0070688_100038106 | 3300005365 | Bacteria | 2934 |
| 88 | Ga0070688_100098046 | 3300005365 | Bacteria | 1927 |
| 89 | Ga0070659_100000868 | 3300005366 | Bacteria | 22078 |
| 90 | Ga0070659_100010826 | 3300005366 | Bacteria | 6725 |
| 91 | Ga0070659_100025291 | 3300005366 | Bacteria | 4557 |
| 92 | Ga0070659_100131931 | 3300005366 | Bacteria | 2029 |
| 93 | Ga0070667_100095701 | 3300005367 | Unclassified | 2561 |
| 94 | Ga0070667_100131921 | 3300005367 | Bacteria | 2181 |
| 95 | Ga0070667_100142934 | 3300005367 | Bacteria | 2097 |
| 96 | Ga0070663_100140558 | 3300005455 | Bacteria | 1843 |
| 97 | Ga0070678_100021468 | 3300005456 | Bacteria | 4257 |
| 98 | Ga0070678_100023305 | 3300005456 | Bacteria | 4123 |
| 99 | Ga0070678_100067946 | 3300005456 | Bacteria | 2655 |
| 100 | Ga0070662_100012586 | 3300005457 | Bacteria | 5611 |
| 101 | Ga0070662_100013751 | 3300005457 | Bacteria | 5390 |
| 102 | Ga0070662_100021047 | 3300005457 | Bacteria | 4449 |
| 103 | Ga0070662_100330288 | 3300005457 | Bacteria | 1245 |
| 104 | Ga0070681_10019337 | 3300005458 | Bacteria | 6817 |
| 105 | Ga0068867_100003787 | 3300005459 | Bacteria | 10644 |
| 106 | Ga0068867_100023969 | 3300005459 | Bacteria | 4372 |
| 107 | Ga0068867_100065084 | 3300005459 | Unclassified | 2712 |
| 108 | Ga0068867_100195453 | 3300005459 | Bacteria | 1617 |
| 109 | Ga0070685_10027123 | 3300005466 | Bacteria | 3163 |
| 110 | Ga0070685_10123650 | 3300005466 | Bacteria | 1610 |
| 111 | Ga0070698_100003913 | 3300005471 | Bacteria | 16377 |
| 112 | Ga0070679_100137891 | 3300005530 | Bacteria | 2420 |
| 113 | Ga0070684_100001469 | 3300005535 | Bacteria | 17002 |
| 114 | Ga0070684_100065293 | 3300005535 | Bacteria | 3194 |
| 115 | Ga0068853_100024340 | 3300005539 | Bacteria | 5075 |
| 116 | Ga0068853_100129114 | 3300005539 | Bacteria | 2261 |
| 117 | Ga0068853_100182403 | 3300005539 | Bacteria | 1904 |
| 118 | Ga0070672_100050257 | 3300005543 | Bacteria | 3247 |
| 119 | Ga0070672_100141682 | 3300005543 | Bacteria | 1983 |
| 120 | Ga0070686_100053016 | 3300005544 | Bacteria | 2588 |
| 121 | Ga0070693_100078210 | 3300005547 | Bacteria | 1965 |
| 122 | Ga0070665_100000118 | 3300005548 | Bacteria | 149830 |
| 123 | Ga0068855_100000049 | 3300005563 | Bacteria | 145321 |
| 124 | Ga0068855_100024523 | 3300005563 | Bacteria | 7217 |
| 125 | Ga0068855_100054484 | 3300005563 | Bacteria | 4700 |
| 126 | Ga0070664_100001077 | 3300005564 | Bacteria | 21494 |
| 127 | Ga0070664_100004250 | 3300005564 | Bacteria | 11518 |
| 128 | Ga0070664_100139753 | 3300005564 | Bacteria | 2132 |
| 129 | Ga0070664_100349367 | 3300005564 | Bacteria | 1345 |
| 130 | Ga0068857_100046270 | 3300005577 | Bacteria | 3861 |
| 131 | Ga0068857_100112367 | 3300005577 | Bacteria | 2449 |
| 132 | Ga0068857_100122124 | 3300005577 | Bacteria | 2346 |
| 133 | Ga0068856_100007533 | 3300005614 | Bacteria | 10623 |
| 134 | Ga0068856_100016616 | 3300005614 | Bacteria | 7125 |
| 135 | Ga0068856_100021650 | 3300005614 | Bacteria | 6248 |
| 136 | Ga0068856_100592044 | 3300005614 | Bacteria | 1130 |
| 137 | Ga0068852_100004192 | 3300005616 | Bacteria | 10161 |
| 138 | Ga0068852_100026093 | 3300005616 | Bacteria | 4744 |
| 139 | Ga0068852_100029170 | 3300005616 | Bacteria | 4528 |
| 140 | Ga0068852_100079569 | 3300005616 | Bacteria | 2903 |
| 141 | Ga0068859_100000013 | 3300005617 | Bacteria | 291126 |
| 142 | Ga0068859_100014773 | 3300005617 | Bacteria | 7844 |
| 143 | Ga0068859_100167794 | 3300005617 | Bacteria | 2275 |
| 144 | Ga0068859_100171588 | 3300005617 | Bacteria | 2250 |
| 145 | Ga0068864_100030528 | 3300005618 | Bacteria | 4568 |
| 146 | Ga0068864_100077517 | 3300005618 | Bacteria | 2906 |
| 147 | Ga0068864_100443316 | 3300005618 | Bacteria | 1240 |
| 148 | Ga0068864_100505402 | 3300005618 | Bacteria | 1163 |
| 149 | Ga0068866_10016357 | 3300005718 | Bacteria | 3316 |
| 150 | Ga0068851_10000057 | 3300005834 | Bacteria | 66791 |
| 151 | Ga0068851_10030248 | 3300005834 | Bacteria | 2685 |
| 152 | Ga0068851_10065723 | 3300005834 | Bacteria | 1867 |
| 153 | Ga0068863_100010161 | 3300005841 | Bacteria | 9153 |
| 154 | Ga0068863_100014098 | 3300005841 | Bacteria | 7700 |
| 155 | Ga0068863_100273684 | 3300005841 | Bacteria | 1635 |
| 156 | Ga0068858_100001874 | 3300005842 | Bacteria | 21456 |
| 157 | Ga0068858_100146620 | 3300005842 | Bacteria | 2217 |
| 158 | Ga0068858_100169281 | 3300005842 | Bacteria | 2060 |
| 159 | Ga0068858_100252025 | 3300005842 | Bacteria | 1677 |
| 160 | Ga0068858_100363142 | 3300005842 | Bacteria | 1388 |
| 161 | Ga0068860_100001911 | 3300005843 | Bacteria | 22115 |
| 162 | Ga0068860_100013335 | 3300005843 | Bacteria | 8058 |
| 163 | Ga0068860_100089002 | 3300005843 | Bacteria | 2939 |
| 164 | Ga0068860_100123196 | 3300005843 | Bacteria | 2484 |
| 165 | Ga0068862_100122192 | 3300005844 | Bacteria | 2296 |
| 166 | Ga0068862_100137308 | 3300005844 | Bacteria | 2168 |
| 167 | Ga0068862_100187919 | 3300005844 | Bacteria | 1857 |
| 168 | Ga0068862_100242902 | 3300005844 | Bacteria | 1638 |
| 169 | Ga0081539_10013758 | 3300005985 | Bacteria | 6065 |
| 170 | Ga0081539_10124610 | 3300005985 | Bacteria | 1274 |
| 171 | Ga0075366_10000556 | 3300006195 | Bacteria | 17427 |
| 172 | Ga0097621_100000015 | 3300006237 | Bacteria | 92182 |
| 173 | Ga0097621_100074955 | 3300006237 | Bacteria | 2803 |
| 174 | Ga0068871_100000051 | 3300006358 | Bacteria | 64844 |
| 175 | Ga0068871_100102960 | 3300006358 | Bacteria | 2393 |
| 176 | Ga0068871_100276159 | 3300006358 | Bacteria | 1469 |
| 177 | Ga0068871_100318227 | 3300006358 | Bacteria | 1369 |
| 178 | Ga0075428_100071519 | 3300006844 | Bacteria | 3791 |
| 179 | Ga0075428_100086344 | 3300006844 | Bacteria | 3422 |
| 180 | Ga0075428_100295416 | 3300006844 | Bacteria | 1742 |
| 181 | Ga0075430_100034421 | 3300006846 | Bacteria | 4299 |
| 182 | Ga0075430_100287046 | 3300006846 | Bacteria | 1361 |
| 183 | Ga0075431_100069264 | 3300006847 | Bacteria | 3640 |
| 184 | Ga0075429_100252160 | 3300006880 | Bacteria | 1545 |
| 185 | Ga0068865_100002736 | 3300006881 | Bacteria | 10472 |
| 186 | Ga0068865_100080837 | 3300006881 | Bacteria | 2332 |
| 187 | Ga0068865_100109836 | 3300006881 | Bacteria | 2033 |
| 188 | Ga0068865_100148045 | 3300006881 | Bacteria | 1778 |
| 189 | Ga0097620_100000013 | 3300006931 | Bacteria | 291126 |
| 190 | Ga0097620_100014774 | 3300006931 | Bacteria | 7844 |
| 191 | Ga0097620_100167788 | 3300006931 | Bacteria | 2275 |
| 192 | Ga0097620_100171599 | 3300006931 | Bacteria | 2250 |
| 193 | Ga0105240_10017563 | 3300009093 | Bacteria | 9638 |
| 194 | Ga0105240_10037888 | 3300009093 | Bacteria | 6192 |
| 195 | Ga0105240_10060549 | 3300009093 | Bacteria | 4720 |
| 196 | Ga0105240_10188688 | 3300009093 | Bacteria | 2425 |
| 197 | Ga0105240_10262897 | 3300009093 | Bacteria | 1990 |
| 198 | Ga0111539_10121157 | 3300009094 | Bacteria | 3065 |
| 199 | Ga0105247_10002997 | 3300009101 | Bacteria | 11192 |
| 200 | Ga0105247_10013814 | 3300009101 | Bacteria | 4841 |
| 201 | Ga0105243_10000003 | 3300009148 | Bacteria | 712931 |
| 202 | Ga0105243_10000089 | 3300009148 | Bacteria | 103761 |
| 203 | Ga0105243_10056016 | 3300009148 | Bacteria | 3133 |
| 204 | Ga0105243_10267417 | 3300009148 | Bacteria | 1534 |
| 205 | Ga0105241_10001659 | 3300009174 | Bacteria | 16968 |
| 206 | Ga0105241_10005937 | 3300009174 | Bacteria | 9003 |
| 207 | Ga0105242_10023597 | 3300009176 | Bacteria | 4848 |
| 208 | Ga0105242_10027714 | 3300009176 | Bacteria | 4503 |
| 209 | Ga0105242_10040197 | 3300009176 | Bacteria | 3768 |
| 210 | Ga0105242_10093693 | 3300009176 | Bacteria | 2533 |
| 211 | Ga0105237_10001504 | 3300009545 | Bacteria | 30678 |
| 212 | Ga0105237_10001895 | 3300009545 | Bacteria | 26705 |
| 213 | Ga0105237_10023370 | 3300009545 | Bacteria | 6335 |
| 214 | Ga0105237_10026749 | 3300009545 | Bacteria | 5896 |
| 215 | Ga0105237_10072090 | 3300009545 | Bacteria | 3448 |
| 216 | Ga0105237_10088785 | 3300009545 | Bacteria | 3080 |
| 217 | Ga0105238_10059144 | 3300009551 | Bacteria | 3840 |
| 218 | Ga0105249_10007529 | 3300009553 | Bacteria | 9498 |
| 219 | Ga0105249_10008471 | 3300009553 | Bacteria | 8960 |
| 220 | Ga0105249_10018555 | 3300009553 | Bacteria | 6193 |
| 221 | Ga0105249_10026565 | 3300009553 | Bacteria | 5219 |
| 222 | Ga0105249_10056562 | 3300009553 | Bacteria | 3591 |
| 223 | Ga0105249_10059302 | 3300009553 | Bacteria | 3510 |
| 224 | Ga0105239_10000166 | 3300010375 | Bacteria | 94743 |
| 225 | Ga0105239_10017420 | 3300010375 | Bacteria | 7945 |
| 226 | Ga0105239_10023061 | 3300010375 | Bacteria | 6862 |
| 227 | Ga0105239_10200999 | 3300010375 | Bacteria | 2233 |
| 228 | Ga0105239_10345862 | 3300010375 | Bacteria | 1679 |
| 229 | Ga0105246_10092551 | 3300011119 | Bacteria | 2182 |
| 230 | Ga0157373_10000006 | 3300013100 | Bacteria | 261768 |
| 231 | Ga0157373_10001842 | 3300013100 | Bacteria | 16117 |
| 232 | Ga0157373_10009487 | 3300013100 | Bacteria | 7190 |
| 233 | Ga0157373_10025296 | 3300013100 | Bacteria | 4296 |
| 234 | Ga0157373_10053330 | 3300013100 | Bacteria | 2875 |
| 235 | Ga0157373_10314564 | 3300013100 | Bacteria | 1113 |
| 236 | Ga0157371_10000107 | 3300013102 | Bacteria | 126477 |
| 237 | Ga0157371_10001199 | 3300013102 | Bacteria | 27770 |
| 238 | Ga0157371_10011057 | 3300013102 | Bacteria | 6991 |
| 239 | Ga0157371_10038939 | 3300013102 | Bacteria | 3401 |
| 240 | Ga0157371_10042314 | 3300013102 | Bacteria | 3247 |
| 241 | Ga0157370_10005025 | 3300013104 | Bacteria | 14939 |
| 242 | Ga0157370_10010241 | 3300013104 | Bacteria | 9900 |
| 243 | Ga0157369_10003605 | 3300013105 | Bacteria | 18401 |
| 244 | Ga0157369_10030384 | 3300013105 | Bacteria | 5958 |
| 245 | Ga0157374_10001665 | 3300013296 | Bacteria | 18606 |
| 246 | Ga0157374_10002410 | 3300013296 | Bacteria | 15774 |
| 247 | Ga0157374_10033689 | 3300013296 | Bacteria | 4675 |
| 248 | Ga0157374_10035226 | 3300013296 | Bacteria | 4578 |
| 249 | Ga0157374_10560652 | 3300013296 | Unclassified | 1150 |
| 250 | Ga0157378_10026892 | 3300013297 | Bacteria | 5074 |
| 251 | Ga0163162_10000595 | 3300013306 | Bacteria | 33576 |
| 252 | Ga0163162_10001704 | 3300013306 | Bacteria | 20605 |
| 253 | Ga0163162_10002066 | 3300013306 | Bacteria | 18872 |
| 254 | Ga0163162_10039941 | 3300013306 | Bacteria | 4690 |
| 255 | Ga0163162_10126140 | 3300013306 | Bacteria | 2666 |
| 256 | Ga0163162_10191838 | 3300013306 | Bacteria | 2171 |
| 257 | Ga0157372_10000039 | 3300013307 | Bacteria | 165839 |
| 258 | Ga0157372_10000238 | 3300013307 | Bacteria | 60988 |
| 259 | Ga0157372_10033521 | 3300013307 | Bacteria | 5642 |
| 260 | Ga0157372_10038960 | 3300013307 | Bacteria | 5246 |
| 261 | Ga0157372_10041830 | 3300013307 | Bacteria | 5067 |
| 262 | Ga0157372_10128863 | 3300013307 | Bacteria | 2910 |
| 263 | Ga0157372_10155743 | 3300013307 | Bacteria | 2639 |
| 264 | Ga0157372_10355418 | 3300013307 | Bacteria | 1707 |
| 265 | Ga0157372_10385494 | 3300013307 | Bacteria | 1633 |
| 266 | Ga0157372_10534894 | 3300013307 | Bacteria | 1366 |
| 267 | Ga0157372_10614255 | 3300013307 | Bacteria | 1267 |
| 268 | Ga0157375_10056899 | 3300013308 | Bacteria | 3864 |
| 269 | Ga0157375_10060974 | 3300013308 | Bacteria | 3743 |
| 270 | Ga0157375_10069271 | 3300013308 | Bacteria | 3533 |
| 271 | Ga0157375_10070243 | 3300013308 | Bacteria | 3511 |
| 272 | Ga0157375_10083268 | 3300013308 | Bacteria | 3244 |
| 273 | Ga0157375_10093696 | 3300013308 | Bacteria | 3070 |
| 274 | Ga0157375_10173258 | 3300013308 | Bacteria | 2306 |
| 275 | Ga0157375_10231830 | 3300013308 | Bacteria | 2005 |
| 276 | Ga0163163_10000088 | 3300014325 | Bacteria | 101126 |
| 277 | Ga0163163_10203143 | 3300014325 | Bacteria | 2030 |
| 278 | Ga0163163_10219127 | 3300014325 | Bacteria | 1951 |
| 279 | Ga0163163_10235113 | 3300014325 | Bacteria | 1882 |
| 280 | Ga0157380_10033408 | 3300014326 | Bacteria | 3961 |
| 281 | Ga0157380_10353017 | 3300014326 | Bacteria | 1377 |
| 282 | Ga0182008_10000003 | 3300014497 | Bacteria | 456880 |
| 283 | Ga0182008_10045280 | 3300014497 | Bacteria | 2188 |
| 284 | Ga0157377_10002113 | 3300014745 | Bacteria | 8736 |
| 285 | Ga0157377_10023161 | 3300014745 | Bacteria | 3289 |
| 286 | Ga0157377_10063195 | 3300014745 | Bacteria | 2120 |
| 287 | Ga0157377_10096723 | 3300014745 | Bacteria | 1752 |
| 288 | Ga0157379_10078807 | 3300014968 | Bacteria | 2951 |
| 289 | Ga0157379_10151332 | 3300014968 | Bacteria | 2093 |
| 290 | Ga0157379_10531207 | 3300014968 | Bacteria | 1093 |
| 291 | Ga0157376_10208429 | 3300014969 | Bacteria | 1803 |
| 292 | Ga0182006_1000079 | 3300015261 | Bacteria | 122553 |
| 293 | Ga0182007_10016964 | 3300015262 | Bacteria | 2672 |
| 294 | Ga0163161_10012415 | 3300017792 | Bacteria | 5916 |
| 295 | Ga0163161_10014389 | 3300017792 | Bacteria | 5508 |
| 296 | Ga0163161_10044867 | 3300017792 | Unclassified | 3185 |
| 297 | Ga0163161_10075077 | 3300017792 | Bacteria | 2480 |
| 298 | Ga0213872_10025003 | 3300021361 | Bacteria | 2746 |
| 299 | Ga0207427_100122 | 3300025231 | Bacteria | 99064 |
| 300 | Ga0209437_100048 | 3300025233 | Bacteria | 405107 |
| 301 | Ga0209437_100102 | 3300025233 | Bacteria | 224216 |
| 302 | Ga0209646_1000005 | 3300025246 | Bacteria | 717627 |
| 303 | Ga0209026_1000149 | 3300025250 | Bacteria | 111200 |
| 304 | Ga0209026_1005112 | 3300025250 | Bacteria | 3630 |
| 305 | Ga0209129_1007350 | 3300025258 | Bacteria | 3303 |
| 306 | Ga0209233_1000029 | 3300025261 | Bacteria | 641642 |
| 307 | Ga0209233_1001271 | 3300025261 | Bacteria | 10114 |
| 308 | Ga0209455_1008606 | 3300025272 | Bacteria | 2759 |
| 309 | Ga0209675_1000159 | 3300025291 | Bacteria | 87316 |
| 310 | Ga0209676_1000485 | 3300025292 | Bacteria | 64653 |
| 311 | Ga0207426_1000059 | 3300025302 | Bacteria | 363842 |
| 312 | Ga0207426_1000262 | 3300025302 | Bacteria | 111889 |
| 313 | Ga0209257_1000006 | 3300025304 | Bacteria | 1570111 |
| 314 | Ga0207656_10000048 | 3300025321 | Bacteria | 46689 |
| 315 | Ga0207656_10017235 | 3300025321 | Bacteria | 2826 |
| 316 | Ga0207656_10098938 | 3300025321 | Bacteria | 1335 |
| 317 | Ga0207642_10012112 | 3300025899 | Bacteria | 3102 |
| 318 | Ga0207642_10026071 | 3300025899 | Bacteria | 2375 |
| 319 | Ga0207710_10001252 | 3300025900 | Bacteria | 12863 |
| 320 | Ga0207688_10014315 | 3300025901 | Bacteria | 4316 |
| 321 | Ga0207680_10000586 | 3300025903 | Bacteria | 17176 |
| 322 | Ga0207680_10095130 | 3300025903 | Bacteria | 1903 |
| 323 | Ga0207647_10000071 | 3300025904 | Bacteria | 79170 |
| 324 | Ga0207645_10000229 | 3300025907 | Bacteria | 46502 |
| 325 | Ga0207643_10056090 | 3300025908 | Bacteria | 2240 |
| 326 | Ga0207654_10006962 | 3300025911 | Bacteria | 5699 |
| 327 | Ga0207707_10013779 | 3300025912 | Bacteria | 7051 |
| 328 | Ga0207695_10014909 | 3300025913 | Bacteria | 9174 |
| 329 | Ga0207695_10046352 | 3300025913 | Bacteria | 4608 |
| 330 | Ga0207695_10046838 | 3300025913 | Bacteria | 4581 |
| 331 | Ga0207671_10006548 | 3300025914 | Bacteria | 10350 |
| 332 | Ga0207671_10007623 | 3300025914 | Bacteria | 9357 |
| 333 | Ga0207671_10012946 | 3300025914 | Bacteria | 6676 |
| 334 | Ga0207671_10026732 | 3300025914 | Bacteria | 4320 |
| 335 | Ga0207671_10057163 | 3300025914 | Bacteria | 2891 |
| 336 | Ga0207662_10097041 | 3300025918 | Bacteria | 1822 |
| 337 | Ga0207657_10334650 | 3300025919 | Bacteria | 1195 |
| 338 | Ga0207649_10005271 | 3300025920 | Bacteria | 6994 |
| 339 | Ga0207649_10304353 | 3300025920 | Bacteria | 1166 |
| 340 | Ga0207652_10003461 | 3300025921 | Bacteria | 13016 |
| 341 | Ga0207694_10035816 | 3300025924 | Bacteria | 3807 |
| 342 | Ga0207650_10192912 | 3300025925 | Bacteria | 1628 |
| 343 | Ga0207659_10007464 | 3300025926 | Bacteria | 6725 |
| 344 | Ga0207659_10010641 | 3300025926 | Bacteria | 5784 |
| 345 | Ga0207644_10148372 | 3300025931 | Bacteria | 1813 |
| 346 | Ga0207690_10001688 | 3300025932 | Bacteria | 13606 |
| 347 | Ga0207690_10004290 | 3300025932 | Bacteria | 8416 |
| 348 | Ga0207690_10007668 | 3300025932 | Bacteria | 6402 |
| 349 | Ga0207690_10017044 | 3300025932 | Bacteria | 4430 |
| 350 | Ga0207706_10010295 | 3300025933 | Bacteria | 8551 |
| 351 | Ga0207706_10019515 | 3300025933 | Bacteria | 6099 |
| 352 | Ga0207706_10039441 | 3300025933 | Bacteria | 4187 |
| 353 | Ga0207706_10057952 | 3300025933 | Bacteria | 3412 |
| 354 | Ga0207686_10004707 | 3300025934 | Bacteria | 7317 |
| 355 | Ga0207686_10073256 | 3300025934 | Bacteria | 2209 |
| 356 | Ga0207686_10092089 | 3300025934 | Bacteria | 2004 |
| 357 | Ga0207709_10000008 | 3300025935 | Bacteria | 713099 |
| 358 | Ga0207709_10000136 | 3300025935 | Bacteria | 106728 |
| 359 | Ga0207709_10138315 | 3300025935 | Bacteria | 1671 |
| 360 | Ga0207670_10011472 | 3300025936 | Bacteria | 5148 |
| 361 | Ga0207670_10028297 | 3300025936 | Bacteria | 3556 |
| 362 | Ga0207704_10000047 | 3300025938 | Bacteria | 84386 |
| 363 | Ga0207704_10152129 | 3300025938 | Bacteria | 1634 |
| 364 | Ga0207691_10011157 | 3300025940 | Bacteria | 8624 |
| 365 | Ga0207691_10014922 | 3300025940 | Bacteria | 7402 |
| 366 | Ga0207689_10025266 | 3300025942 | Bacteria | 4977 |
| 367 | Ga0207689_10029603 | 3300025942 | Bacteria | 4570 |
| 368 | Ga0207689_10031652 | 3300025942 | Bacteria | 4402 |
| 369 | Ga0207689_10073320 | 3300025942 | Bacteria | 2812 |
| 370 | Ga0207689_10104438 | 3300025942 | Bacteria | 2328 |
| 371 | Ga0207689_10118628 | 3300025942 | Bacteria | 2176 |
| 372 | Ga0207689_10260325 | 3300025942 | Bacteria | 1435 |
| 373 | Ga0207661_10018216 | 3300025944 | Bacteria | 5215 |
| 374 | Ga0207661_10022846 | 3300025944 | Bacteria | 4716 |
| 375 | Ga0207661_10143564 | 3300025944 | Bacteria | 2057 |
| 376 | Ga0207661_10369109 | 3300025944 | Bacteria | 1297 |
| 377 | Ga0207679_10001674 | 3300025945 | Bacteria | 13809 |
| 378 | Ga0207679_10003082 | 3300025945 | Bacteria | 10326 |
| 379 | Ga0207679_10061526 | 3300025945 | Bacteria | 2795 |
| 380 | Ga0207679_10082428 | 3300025945 | Bacteria | 2462 |
| 381 | Ga0207679_10082863 | 3300025945 | Bacteria | 2456 |
| 382 | Ga0207679_10212983 | 3300025945 | Bacteria | 1621 |
| 383 | Ga0207667_10000015 | 3300025949 | Bacteria | 417534 |
| 384 | Ga0207667_10012457 | 3300025949 | Bacteria | 9795 |
| 385 | Ga0207651_10080207 | 3300025960 | Bacteria | 2348 |
| 386 | Ga0207651_10128335 | 3300025960 | Bacteria | 1936 |
| 387 | Ga0207712_10003737 | 3300025961 | Bacteria | 9606 |
| 388 | Ga0207712_10010819 | 3300025961 | Bacteria | 5805 |
| 389 | Ga0207712_10015720 | 3300025961 | Bacteria | 4888 |
| 390 | Ga0207712_10018274 | 3300025961 | Bacteria | 4565 |
| 391 | Ga0207712_10042455 | 3300025961 | Bacteria | 3131 |
| 392 | Ga0207658_10076781 | 3300025986 | Unclassified | 2546 |
| 393 | Ga0207658_10118779 | 3300025986 | Bacteria | 2104 |
| 394 | Ga0207658_10141422 | 3300025986 | Bacteria | 1948 |
| 395 | Ga0207677_10008316 | 3300026023 | Bacteria | 5787 |
| 396 | Ga0207677_10009458 | 3300026023 | Bacteria | 5485 |
| 397 | Ga0207677_10130409 | 3300026023 | Bacteria | 1907 |
| 398 | Ga0207703_10016677 | 3300026035 | Bacteria | 5730 |
| 399 | Ga0207703_10019532 | 3300026035 | Bacteria | 5295 |
| 400 | Ga0207703_10082239 | 3300026035 | Bacteria | 2687 |
| 401 | Ga0207703_10096803 | 3300026035 | Bacteria | 2492 |
| 402 | Ga0207639_10009275 | 3300026041 | Bacteria | 6786 |
| 403 | Ga0207639_10074306 | 3300026041 | Bacteria | 2669 |
| 404 | Ga0207702_10048496 | 3300026078 | Bacteria | 3582 |
| 405 | Ga0207702_10049475 | 3300026078 | Bacteria | 3547 |
| 406 | Ga0207702_10131149 | 3300026078 | Bacteria | 2256 |
| 407 | Ga0207641_10000448 | 3300026088 | Bacteria | 47082 |
| 408 | Ga0207641_10001077 | 3300026088 | Bacteria | 27465 |
| 409 | Ga0207641_10202813 | 3300026088 | Bacteria | 1830 |
| 410 | Ga0207641_10261081 | 3300026088 | Bacteria | 1622 |
| 411 | Ga0207648_10007503 | 3300026089 | Bacteria | 10713 |
| 412 | Ga0207648_10007532 | 3300026089 | Bacteria | 10685 |
| 413 | Ga0207648_10037679 | 3300026089 | Bacteria | 4260 |
| 414 | Ga0207648_10116190 | 3300026089 | Bacteria | 2351 |
| 415 | Ga0207648_10241290 | 3300026089 | Bacteria | 1609 |
| 416 | Ga0207648_10431147 | 3300026089 | Bacteria | 1198 |
| 417 | Ga0207676_10054277 | 3300026095 | Bacteria | 3140 |
| 418 | Ga0207674_10000894 | 3300026116 | Bacteria | 38957 |
| 419 | Ga0207674_10065548 | 3300026116 | Bacteria | 3660 |
| 420 | Ga0207674_10271207 | 3300026116 | Bacteria | 1644 |
| 421 | Ga0207675_100113338 | 3300026118 | Bacteria | 2560 |
| 422 | Ga0207675_100322644 | 3300026118 | Bacteria | 1508 |
| 423 | Ga0207683_10026793 | 3300026121 | Bacteria | 4979 |
| 424 | Ga0207698_10003879 | 3300026142 | Bacteria | 9049 |
| 425 | Ga0207698_10010495 | 3300026142 | Bacteria | 5959 |
| 426 | Ga0207698_10024975 | 3300026142 | Bacteria | 4201 |
| 427 | Ga0268266_10000121 | 3300028379 | Bacteria | 154995 |
| 428 | Ga0268265_10059888 | 3300028380 | Bacteria | 2916 |
| 429 | Ga0268265_10087769 | 3300028380 | Bacteria | 2476 |
| 430 | Ga0268264_10002805 | 3300028381 | Bacteria | 15217 |
| 431 | Ga0268264_10039477 | 3300028381 | Bacteria | 3901 |
| 432 | Ga0268264_10086260 | 3300028381 | Bacteria | 2697 |
| 433 | Ga0268264_10161729 | 3300028381 | Bacteria | 2018 |
| 434 | Ga0268264_10371264 | 3300028381 | Bacteria | 1367 |
| 435 | Ga0265334_10052976 | 3300028573 | Bacteria | 1551 |
| 436 | Ga0307515_10000003 | 3300028794 | Bacteria | 891317 |
| 437 | Ga0265338_10035459 | 3300028800 | Bacteria | 4795 |
| 438 | Ga0316177_1209362 | 3300030731 | Bacteria | 5435 |
| 439 | Ga0316176_1026201 | 3300030732 | Bacteria | 12822 |
| 440 | Ga0316183_1106482 | 3300030742 | Bacteria | 31361 |
| 441 | Ga0316181_1039179 | 3300030744 | Bacteria | 5421 |
| 442 | Ga0316181_1249451 | 3300030744 | Bacteria | 1650 |
| 443 | Ga0265327_10000073 | 3300031251 | Bacteria | 214772 |
| 444 | Ga0265327_10000256 | 3300031251 | Bacteria | 105748 |
| 445 | Ga0265327_10006644 | 3300031251 | Bacteria | 9186 |
| 446 | Ga0265327_10022548 | 3300031251 | Bacteria | 3758 |
| 447 | Ga0307513_10116236 | 3300031456 | Bacteria | 2655 |
| 448 | Ga0307509_10033604 | 3300031507 | Bacteria | 5645 |
| 449 | Ga0307408_100000396 | 3300031548 | Bacteria | 39439 |
| 450 | Ga0307408_100000464 | 3300031548 | Bacteria | 35518 |
| 451 | Ga0307408_100000560 | 3300031548 | Bacteria | 32128 |
| 452 | Ga0307408_100001326 | 3300031548 | Bacteria | 18558 |
| 453 | Ga0307408_100043965 | 3300031548 | Bacteria | 3181 |
| 454 | Ga0307514_10095802 | 3300031649 | Bacteria | 2146 |
| 455 | Ga0307405_10049721 | 3300031731 | Bacteria | 2593 |
| 456 | Ga0307405_10194158 | 3300031731 | Bacteria | 1469 |
| 457 | Ga0307410_10162893 | 3300031852 | Bacteria | 1673 |
| 458 | Ga0307412_10000140 | 3300031911 | Bacteria | 52924 |
| 459 | Ga0307412_10000292 | 3300031911 | Bacteria | 31826 |
| 460 | Ga0307412_10009485 | 3300031911 | Bacteria | 5587 |
| 461 | Ga0307412_10016208 | 3300031911 | Bacteria | 4433 |
| 462 | Ga0307409_100143078 | 3300031995 | Bacteria | 2064 |
| 463 | Ga0307416_100000020 | 3300032002 | Bacteria | 192862 |
| 464 | Ga0307416_100000457 | 3300032002 | Bacteria | 20948 |
| 465 | Ga0307416_100151244 | 3300032002 | Bacteria | 2129 |
| 466 | Ga0307414_10000470 | 3300032004 | Bacteria | 21107 |
| 467 | Ga0307414_10020454 | 3300032004 | Bacteria | 4126 |
| 468 | Ga0307414_10032626 | 3300032004 | Bacteria | 3431 |
| 469 | Ga0307414_10110557 | 3300032004 | Bacteria | 2091 |
| 470 | Ga0307414_10201575 | 3300032004 | Bacteria | 1619 |
| 471 | Ga0307414_10232414 | 3300032004 | Bacteria | 1521 |
| 472 | Ga0307415_100015535 | 3300032126 | Bacteria | 4512 |
| 473 | Ga0373955_0043317 | 3300035172 | Bacteria | 2421 |
| 474 | Ga0373935_0054280 | 3300035692 | Bacteria | 2551 |
| 475 | Ga0373947_0092909 | 3300035725 | Bacteria | 1885 |
| 476 | Ga0373937_0031794 | 3300036401 | Bacteria | 4784 |
| 477 | Ga0395899_0000024 | 3300037312 | Bacteria | 357402 |
| 478 | Ga0395899_0000027 | 3300037312 | Bacteria | 337387 |
| 479 | Ga0395899_0000064 | 3300037312 | Bacteria | 207082 |
| 480 | Ga0395899_0019564 | 3300037312 | Bacteria | 5141 |
| 481 | Ga0395900_0001518 | 3300037418 | Bacteria | 27559 |
| 482 | Ga0395900_0006443 | 3300037418 | Bacteria | 12236 |
| 483 | Ga0395900_0012681 | 3300037418 | Bacteria | 8618 |
| 484 | Ga0395900_0504437 | 3300037418 | Bacteria | 1160 |
| 485 | Ga0395898_0257836 | 3300037466 | Bacteria | 1663 |
| 486 | Ga0395905_0000001 | 3300037471 | Bacteria | 2037079 |
| 487 | Ga0395905_0000051 | 3300037471 | Bacteria | 223416 |
| 488 | Ga0395905_0000327 | 3300037471 | Bacteria | 68334 |
| 489 | Ga0395905_0126828 | 3300037471 | Bacteria | 2400 |
| 490 | Ga0395901_0000921 | 3300038443 | Bacteria | 32043 |
| 491 | Ga0395901_0008911 | 3300038443 | Bacteria | 10162 |
| 492 | Ga0395901_0094508 | 3300038443 | Bacteria | 3132 |
| 493 | Ga0436361_0906526 | 3300039447 | Bacteria | 5206 |
| 494 | Ga0439465_0000035 | 3300041413 | Bacteria | 27339 |
| 495 | Ga0439441_005762 | 3300042001 | Bacteria | 1938 |
| 496 | Ga0439445_0003032 | 3300042004 | Bacteria | 3760 |
| 497 | Ga0439445_0004249 | 3300042004 | Bacteria | 3241 |
| 498 | Ga0439457_005817 | 3300042014 | Bacteria | 3061 |
| 499 | Ga0450893_0005472 | 3300042532 | Bacteria | 2040 |
| 500 | Ga0451577_0006314 | 3300042876 | Bacteria | 11859 |
| 501 | Ga0451577_0021459 | 3300042876 | Bacteria | 5911 |
| 502 | Ga0451577_0073662 | 3300042876 | Bacteria | 3047 |
| 503 | Ga0466972_0000010 | 3300044658 | Bacteria | 256339 |
| 504 | Ga0453683_0204503 | 3300044673 | Bacteria | 1254 |
| 505 | Ga0466964_0018561 | 3300044706 | Bacteria | 2670 |
| 506 | Ga0453684_0001733 | 3300044712 | Bacteria | 58391 |
| 507 | Ga0453684_0079509 | 3300044712 | Bacteria | 4099 |
| 508 | Ga0453684_0086754 | 3300044712 | Bacteria | 3882 |
| 509 | Ga0453684_0342350 | 3300044712 | Bacteria | 1688 |
| 510 | Ga0453684_0548830 | 3300044712 | Bacteria | 1273 |
| 511 | Ga0466968_0033528 | 3300044735 | Bacteria | 2140 |
| 512 | Ga0466970_0000471 | 3300044765 | Bacteria | 19964 |
| 513 | Ga0466959_0130951 | 3300045049 | Bacteria | 1778 |
| 514 | Ga0451576_0000002 | 3300045051 | Bacteria | 1670975 |
| 515 | Ga0451576_0049378 | 3300045051 | Bacteria | 4415 |
| 516 | Ga0495627_000029 | 3300046453 | Bacteria | 232349 |
| 517 | Ga0495627_009281 | 3300046453 | Bacteria | 3628 |
| 518 | Ga0495592_0045217 | 3300046454 | Bacteria | 3286 |
| 519 | Ga0495638_0000026 | 3300046460 | Bacteria | 347061 |
| 520 | Ga0495650_0000231 | 3300046471 | Bacteria | 113969 |
| 521 | Ga0495585_0000037 | 3300046492 | Bacteria | 133335 |
| 522 | Ga0495594_0124003 | 3300046499 | Bacteria | 1461 |
| 523 | Ga0495596_0000410 | 3300046500 | Bacteria | 27433 |
| 524 | Ga0495596_0011130 | 3300046500 | Bacteria | 3890 |
| 525 | Ga0495606_0019314 | 3300046507 | Bacteria | 5076 |
| 526 | Ga0495606_0053202 | 3300046507 | Bacteria | 2628 |
| 527 | Ga0495610_0000001 | 3300046512 | Bacteria | 1620061 |
| 528 | Ga0495610_0000129 | 3300046512 | Bacteria | 83051 |
| 529 | Ga0495610_0001948 | 3300046512 | Bacteria | 17744 |
| 530 | Ga0495628_0018695 | 3300046516 | Bacteria | 5735 |
| 531 | Ga0495630_0086572 | 3300046517 | Bacteria | 2366 |
| 532 | Ga0495631_0001037 | 3300046518 | Bacteria | 17230 |
| 533 | Ga0495643_0032131 | 3300046522 | Bacteria | 2916 |
| 534 | Ga0495663_0000021 | 3300046525 | Bacteria | 114041 |
| 535 | Ga0495640_0128613 | 3300046533 | Bacteria | 1641 |
| 536 | Ga0495609_0021448 | 3300046538 | Bacteria | 2980 |
| 537 | Ga0495621_0043702 | 3300046539 | Bacteria | 1581 |
| 538 | Ga0495622_0042631 | 3300046557 | Bacteria | 2110 |
| 539 | Ga0495633_0000048 | 3300046558 | Bacteria | 158166 |
| 540 | Ga0495633_0005148 | 3300046558 | Bacteria | 8102 |
| 541 | Ga0495633_0009165 | 3300046558 | Bacteria | 5494 |
| 542 | Ga0495625_0000191 | 3300046660 | Bacteria | 97363 |
| 543 | Ga0495625_0058566 | 3300046660 | Bacteria | 2737 |
| 544 | Ga0495625_0078383 | 3300046660 | Bacteria | 2306 |
| 545 | Ga0495661_0026655 | 3300046665 | Bacteria | 3720 |
| 546 | Ga0495647_0177445 | 3300046681 | Bacteria | 925 |
| 547 | Ga0495658_0295566 | 3300046683 | Bacteria | 1024 |
| 548 | Ga0495649_0000061 | 3300046694 | Bacteria | 97338 |
| 549 | Ga0495649_0027895 | 3300046694 | Bacteria | 3131 |
| 550 | Ga0495604_0039706 | 3300047317 | Bacteria | 3698 |
| 551 | Ga0495674_0405508 | 3300047319 | Bacteria | 1100 |
| 552 | Ga0495683_0081586 | 3300047323 | Bacteria | 1577 |
| 553 | Ga0495687_022613 | 3300047443 | Bacteria | 3014 |
| 554 | Ga0495686_0000153 | 3300047472 | Bacteria | 133256 |
| 555 | Ga0495686_0000679 | 3300047472 | Bacteria | 46024 |
| 556 | Ga0495686_0005442 | 3300047472 | Bacteria | 10043 |
| 557 | Ga0495686_0012095 | 3300047472 | Bacteria | 6058 |
| 558 | Ga0495686_0045737 | 3300047472 | Bacteria | 2769 |
| 559 | Ga0495686_0074784 | 3300047472 | Bacteria | 2078 |
| 560 | Ga0495614_0007507 | 3300048089 | Bacteria | 4854 |
| 561 | Ga0496100_0359845 | 3300048903 | Bacteria | 1101 |
| 562 | Ga0496102_0014102 | 3300048905 | Bacteria | 6944 |
| 563 | Ga0496105_0175109 | 3300048908 | Bacteria | 1758 |
| 564 | Ga0496113_0232315 | 3300048916 | Bacteria | 1471 |
| 565 | Ga0496114_0001046 | 3300048917 | Bacteria | 20795 |
| 566 | Ga0496116_0000037 | 3300048919 | Bacteria | 374675 |
| 567 | Ga0496116_0003271 | 3300048919 | Bacteria | 16146 |
| 568 | Ga0496117_0000086 | 3300048920 | Bacteria | 212331 |
| 569 | Ga0496117_0006620 | 3300048920 | Bacteria | 11642 |
| 570 | Ga0496118_0000284 | 3300048921 | Bacteria | 88966 |
| 571 | Ga0496119_0000037 | 3300048922 | Bacteria | 210912 |
| 572 | Ga0496121_0000010 | 3300048924 | Bacteria | 793488 |
| 573 | Ga0496122_0000510 | 3300048925 | Bacteria | 80239 |
| 574 | Ga0496122_0000602 | 3300048925 | Bacteria | 73995 |
| 575 | Ga0496122_0003771 | 3300048925 | Bacteria | 19539 |
| 576 | Ga0496122_0007262 | 3300048925 | Bacteria | 12391 |
| 577 | Ga0496122_0051431 | 3300048925 | Bacteria | 3130 |
| 578 | Ga0496122_0177638 | 3300048925 | Bacteria | 1274 |
| 579 | Ga0496123_0013079 | 3300048926 | Bacteria | 7003 |
| 580 | Ga0496123_0014595 | 3300048926 | Bacteria | 6497 |
| 581 | Ga0496123_0051104 | 3300048926 | Bacteria | 2756 |
| 582 | Ga0496124_0000555 | 3300048927 | Bacteria | 63173 |
| 583 | Ga0496125_0012093 | 3300048928 | Bacteria | 8587 |
| 584 | Ga0496125_0031801 | 3300048928 | Bacteria | 4697 |
| 585 | Ga0496125_0049890 | 3300048928 | Bacteria | 3471 |
| 586 | Ga0496126_0008259 | 3300048929 | Bacteria | 11243 |
| 587 | Ga0501309_001077 | 3300049129 | Bacteria | 2543 |
| 588 | Ga0501290_001153 | 3300049513 | Bacteria | 3710 |
| 589 | Ga0501300_003387 | 3300049523 | Bacteria | 2383 |
| 590 | Ga0501323_000515 | 3300049539 | Bacteria | 2903 |
| 591 | Ga0501323_002692 | 3300049539 | Bacteria | 1748 |
| 592 | Ga0501031_0015383 | 3300049568 | Bacteria | 4967 |
| 593 | Ga0501032_0008235 | 3300049569 | Bacteria | 7601 |
| 594 | Ga0501032_0042193 | 3300049569 | Bacteria | 3095 |
| 595 | Ga0501033_0000085 | 3300049570 | Bacteria | 88350 |
| 596 | Ga0501033_0014934 | 3300049570 | Bacteria | 5895 |
| 597 | Ga0501034_0000308 | 3300049571 | Bacteria | 86738 |
| 598 | Ga0501034_0061795 | 3300049571 | Bacteria | 3761 |
| 599 | Ga0501034_0265365 | 3300049571 | Bacteria | 1659 |
| 600 | Ga0501036_0033163 | 3300049572 | Bacteria | 4367 |
| 601 | Ga0501036_0119218 | 3300049572 | Bacteria | 2228 |
| 602 | Ga0501037_0013826 | 3300049573 | Bacteria | 5947 |
| 603 | Ga0501037_0083489 | 3300049573 | Bacteria | 2314 |
| 604 | Ga0501038_0002849 | 3300049574 | Bacteria | 16100 |
| 605 | Ga0501038_0048753 | 3300049574 | Bacteria | 3664 |
| 606 | Ga0501038_0069021 | 3300049574 | Bacteria | 3004 |
| 607 | Ga0501043_0005704 | 3300049579 | Bacteria | 10029 |
| 608 | Ga0501046_0033435 | 3300049580 | Bacteria | 4154 |
| 609 | Ga0501047_0023531 | 3300049581 | Bacteria | 5912 |
| 610 | Ga0501047_0117300 | 3300049581 | Bacteria | 2543 |
| 611 | Ga0501067_0054349 | 3300049583 | Unclassified | 2219 |
| 612 | Ga0501070_0006179 | 3300049586 | Bacteria | 10205 |
| 613 | Ga0501073_0008853 | 3300049589 | Bacteria | 7443 |
| 614 | Ga0501074_0018342 | 3300049590 | Bacteria | 5082 |
| 615 | Ga0501201_000735 | 3300049651 | Bacteria | 3063 |
| 616 | Ga0501202_001225 | 3300049652 | Bacteria | 4052 |
| 617 | Ga0501217_006197 | 3300049661 | Bacteria | 2531 |
| 618 | Ga0501217_039098 | 3300049661 | Bacteria | 1201 |
| 619 | Ga0501222_000205 | 3300049662 | Bacteria | 10436 |
| 620 | Ga0501223_000153 | 3300049663 | Bacteria | 18205 |
| 621 | Ga0501223_000488 | 3300049663 | Bacteria | 9591 |
| 622 | Ga0501223_001264 | 3300049663 | Bacteria | 5887 |
| 623 | Ga0501235_000089 | 3300049669 | Bacteria | 14364 |
| 624 | Ga0501236_000154 | 3300049670 | Bacteria | 7110 |
| 625 | Ga0501243_000687 | 3300049675 | Bacteria | 4662 |
| 626 | Ga0501257_004933 | 3300049686 | Bacteria | 2923 |
| 627 | Ga0501257_008043 | 3300049686 | Bacteria | 2365 |
| 628 | Ga0501259_000111 | 3300049688 | Bacteria | 11954 |
| 629 | Ga0501221_000942 | 3300049704 | Bacteria | 4771 |
| 630 | Ga0501225_0003289 | 3300049705 | Bacteria | 4924 |
| 631 | Ga0501225_0013373 | 3300049705 | Bacteria | 2297 |
| 632 | Ga0501225_0035083 | 3300049705 | Bacteria | 1381 |
| 633 | Ga0501245_002236 | 3300049708 | Bacteria | 2578 |
| 634 | Ga0501080_0046204 | 3300049742 | Unclassified | 4055 |
| 635 | Ga0501080_0157282 | 3300049742 | Bacteria | 2099 |
| 636 | Ga0501080_0393496 | 3300049742 | Bacteria | 1247 |
| 637 | Ga0501083_0107045 | 3300049744 | Bacteria | 1840 |
| 638 | Ga0501241_000009 | 3300049758 | Bacteria | 128695 |
| 639 | Ga0501241_002609 | 3300049758 | Bacteria | 3473 |
| 640 | Ga0501241_008479 | 3300049758 | Bacteria | 1876 |
| 641 | Ga0501269_000025 | 3300049766 | Bacteria | 51990 |
| 642 | Ga0501035_0011027 | 3300049822 | Bacteria | 8367 |
| 643 | Ga0501044_0001663 | 3300049823 | Bacteria | 26095 |
| 644 | Ga0501044_0048151 | 3300049823 | Bacteria | 4405 |
| 645 | Ga0501045_0000206 | 3300049824 | Bacteria | 33751 |
| 646 | nmdc:mga0k408_1014_c1 | 3300050493 | Bacteria | 15426 |
| 647 | nmdc:mga09592_48708_c1 | 3300050508 | Bacteria | 3573 |
| 648 | nmdc:mga09592_487723_c1 | 3300050508 | Bacteria | 1061 |
| 649 | nmdc:mga0qj67_35982_c1 | 3300050509 | Bacteria | 3872 |
| 650 | nmdc:mga06r32_43289_c1 | 3300050510 | Bacteria | 4284 |
| 651 | nmdc:mga08y16_118091_c1 | 3300050511 | Bacteria | 2760 |
| 652 | nmdc:mga08y16_224727_c1 | 3300050511 | Bacteria | 1943 |
| 653 | nmdc:mga08y16_260820_c1 | 3300050511 | Bacteria | 1790 |
| 654 | Ga0500646_0070179 | 3300053090 | Bacteria | 1049 |
| 655 | Ga0500608_000440 | 3300053122 | Bacteria | 15676 |
| 656 | Ga0500652_015113 | 3300053131 | Bacteria | 2778 |
| 657 | Ga0500603_018625 | 3300053150 | Bacteria | 1675 |
| 658 | Ga0500604_0002355 | 3300053151 | Bacteria | 5173 |
| 659 | Ga0500616_0000043 | 3300053153 | Bacteria | 342930 |
| 660 | Ga0500616_0092155 | 3300053153 | Bacteria | 1499 |
| 661 | Ga0500622_0000163 | 3300053156 | Bacteria | 70679 |
| 662 | Ga0500622_0000568 | 3300053156 | Bacteria | 33817 |
| 663 | Ga0500622_0000895 | 3300053156 | Bacteria | 25374 |
| 664 | Ga0500622_0002531 | 3300053156 | Bacteria | 13125 |
| 665 | Ga0500622_0003011 | 3300053156 | Bacteria | 11645 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046557 | Ga0495622_0042631 | Ga0495622_0042631_59_904 | 257 |
| 2 | 3300046681 | Ga0495647_0177445 | Ga0495647_0177445_54_902 | 258 |
| 3 | 3300050508 | nmdc:mga09592_487723_c1 | nmdc:mga09592_487723_c1_35_904 | 263 |
| 4 | 3300050511 | nmdc:mga08y16_260820_c1 | nmdc:mga08y16_260820_c1_871_1740 | 263 |
| 5 | 3300049129 | Ga0501309_001077 | Ga0501309_001077_1655_2521 | 264 |
| 6 | 3300049539 | Ga0501323_000515 | Ga0501323_000515_36_902 | 264 |
| 7 | 3300025919 | Ga0207657_10334650 | Ga0207657_103346502 | 280 |
| 8 | 3300001915 | JGI24741J21665_1002374 | JGI24741J21665_10023743 | 288 |
| 9 | 3300003322 | rootL2_10088809 | rootL2_100888091 | 288 |
| 10 | 3300003323 | rootH1_10005447 | rootH1_1000544710 | 288 |
| 11 | 3300003578 | Ga0006562J51391_1024690 | Ga0006562J51391_10246904 | 288 |
| 12 | 3300005289 | Ga0065704_10088141 | Ga0065704_100881412 | 288 |
| 13 | 3300005337 | Ga0070682_100000095 | Ga0070682_10000009567 | 288 |
| 14 | 3300009148 | Ga0105243_10000089 | Ga0105243_100000895 | 288 |
| 15 | 3300009148 | Ga0105243_10056016 | Ga0105243_100560164 | 288 |
| 16 | 3300013100 | Ga0157373_10000006 | Ga0157373_10000006174 | 288 |
| 17 | 3300013104 | Ga0157370_10005025 | Ga0157370_1000502513 | 288 |
| 18 | 3300013308 | Ga0157375_10083268 | Ga0157375_100832683 | 288 |
| 19 | 3300014497 | Ga0182008_10000003 | Ga0182008_10000003350 | 288 |
| 20 | 3300015261 | Ga0182006_1000079 | Ga0182006_100007961 | 288 |
| 21 | 3300015262 | Ga0182007_10016964 | Ga0182007_100169642 | 288 |
| 22 | 3300025291 | Ga0209675_1000159 | Ga0209675_10001596 | 288 |
| 23 | 3300025935 | Ga0207709_10000136 | Ga0207709_100001369 | 288 |
| 24 | 3300025935 | Ga0207709_10138315 | Ga0207709_101383151 | 288 |
| 25 | 3300031911 | Ga0307412_10000140 | Ga0307412_1000014026 | 288 |
| 26 | 3300031911 | Ga0307412_10016208 | Ga0307412_100162084 | 288 |
| 27 | 3300032002 | Ga0307416_100000020 | Ga0307416_100000020131 | 288 |
| 28 | 3300042004 | Ga0439445_0003032 | Ga0439445_0003032_608_1672 | 288 |
| 29 | 3300046453 | Ga0495627_000029 | Ga0495627_000029_80094_81158 | 288 |
| 30 | 3300046453 | Ga0495627_009281 | Ga0495627_009281_1283_2347 | 288 |
| 31 | 3300046500 | Ga0495596_0000410 | Ga0495596_0000410_20208_21272 | 288 |
| 32 | 3300046512 | Ga0495610_0000001 | Ga0495610_0000001_65009_66073 | 288 |
| 33 | 3300046522 | Ga0495643_0032131 | Ga0495643_0032131_51_1115 | 288 |
| 34 | 3300046558 | Ga0495633_0000048 | Ga0495633_0000048_152107_153171 | 288 |
| 35 | 3300046558 | Ga0495633_0009165 | Ga0495633_0009165_594_1658 | 288 |
| 36 | 3300047472 | Ga0495686_0000153 | Ga0495686_0000153_71413_72477 | 288 |
| 37 | 3300047472 | Ga0495686_0012095 | Ga0495686_0012095_4900_5964 | 288 |
| 38 | 3300048905 | Ga0496102_0014102 | Ga0496102_0014102_5205_6269 | 288 |
| 39 | 3300048916 | Ga0496113_0232315 | Ga0496113_0232315_178_1242 | 288 |
| 40 | 3300048919 | Ga0496116_0000037 | Ga0496116_0000037_67823_68887 | 288 |
| 41 | 3300048920 | Ga0496117_0000086 | Ga0496117_0000086_67709_68773 | 288 |
| 42 | 3300048921 | Ga0496118_0000284 | Ga0496118_0000284_20195_21259 | 288 |
| 43 | 3300048922 | Ga0496119_0000037 | Ga0496119_0000037_67758_68822 | 288 |
| 44 | 3300048925 | Ga0496122_0000510 | Ga0496122_0000510_75836_76900 | 288 |
| 45 | 3300048925 | Ga0496122_0000602 | Ga0496122_0000602_32406_33470 | 288 |
| 46 | 3300048925 | Ga0496122_0003771 | Ga0496122_0003771_18433_19497 | 288 |
| 47 | 3300048925 | Ga0496122_0051431 | Ga0496122_0051431_1296_2360 | 288 |
| 48 | 3300048926 | Ga0496123_0013079 | Ga0496123_0013079_1407_2471 | 288 |
| 49 | 3300048926 | Ga0496123_0014595 | Ga0496123_0014595_1514_2578 | 288 |
| 50 | 3300048927 | Ga0496124_0000555 | Ga0496124_0000555_26387_27451 | 288 |
| 51 | 3300048928 | Ga0496125_0012093 | Ga0496125_0012093_6083_7147 | 288 |
| 52 | 3300048928 | Ga0496125_0049890 | Ga0496125_0049890_1174_2238 | 288 |
| 53 | 3300048929 | Ga0496126_0008259 | Ga0496126_0008259_3632_4696 | 288 |
| 54 | 3300031731 | Ga0307405_10194158 | Ga0307405_101941582 | 291 |
| 55 | 3300031911 | Ga0307412_10000292 | Ga0307412_1000029228 | 291 |
| 56 | 3300041413 | Ga0439465_0000035 | Ga0439465_0000035_15720_16784 | 291 |
| 57 | 3300048928 | Ga0496125_0031801 | Ga0496125_0031801_3737_4669 | 291 |
| 58 | 3300049758 | Ga0501241_000009 | Ga0501241_000009_62838_63902 | 291 |
| 59 | 3300049766 | Ga0501269_000025 | Ga0501269_000025_5984_7048 | 291 |
| 60 | 3300053090 | Ga0500646_0070179 | Ga0500646_0070179_73_1035 | 296 |
| 61 | 3300046683 | Ga0495658_0295566 | Ga0495658_0295566_22_981 | 297 |
| 62 | 3300013102 | Ga0157371_10042314 | Ga0157371_100423144 | 300 |
| 63 | 3300046525 | Ga0495663_0000021 | Ga0495663_0000021_107020_108084 | 300 |
| 64 | 3300026089 | Ga0207648_10431147 | Ga0207648_104311472 | 301 |
| 65 | 3300053150 | Ga0500603_018625 | Ga0500603_018625_535_1608 | 301 |
| 66 | 3300009545 | Ga0105237_10026749 | Ga0105237_100267492 | 303 |
| 67 | 3300025914 | Ga0207671_10057163 | Ga0207671_100571632 | 303 |
| 68 | 3300042001 | Ga0439441_005762 | Ga0439441_005762_656_1690 | 303 |
| 69 | 3300047323 | Ga0495683_0081586 | Ga0495683_0081586_39_1010 | 303 |
| 70 | 3300049513 | Ga0501290_001153 | Ga0501290_001153_1808_2857 | 303 |
| 71 | 3300049651 | Ga0501201_000735 | Ga0501201_000735_655_1704 | 303 |
| 72 | 3300049652 | Ga0501202_001225 | Ga0501202_001225_1342_2391 | 303 |
| 73 | 3300049661 | Ga0501217_006197 | Ga0501217_006197_1374_2423 | 303 |
| 74 | 3300049661 | Ga0501217_039098 | Ga0501217_039098_37_1044 | 303 |
| 75 | 3300049662 | Ga0501222_000205 | Ga0501222_000205_8084_9133 | 303 |
| 76 | 3300049663 | Ga0501223_001264 | Ga0501223_001264_3282_4331 | 303 |
| 77 | 3300049669 | Ga0501235_000089 | Ga0501235_000089_11449_12498 | 303 |
| 78 | 3300049675 | Ga0501243_000687 | Ga0501243_000687_1264_2313 | 303 |
| 79 | 3300049686 | Ga0501257_008043 | Ga0501257_008043_160_1209 | 303 |
| 80 | 3300049688 | Ga0501259_000111 | Ga0501259_000111_2827_3876 | 303 |
| 81 | 3300049704 | Ga0501221_000942 | Ga0501221_000942_3621_4670 | 303 |
| 82 | 3300049705 | Ga0501225_0003289 | Ga0501225_0003289_1258_2307 | 303 |
| 83 | 3300049708 | Ga0501245_002236 | Ga0501245_002236_219_1283 | 303 |
| 84 | 3300049758 | Ga0501241_008479 | Ga0501241_008479_698_1747 | 303 |
| 85 | 3300053156 | Ga0500622_0000568 | Ga0500622_0000568_28453_29496 | 303 |
| 86 | 3300038443 | Ga0395901_0000921 | Ga0395901_0000921_28931_29989 | 304 |
| 87 | 3300005356 | Ga0070674_100004529 | Ga0070674_1000045295 | 305 |
| 88 | 3300025945 | Ga0207679_10061526 | Ga0207679_100615263 | 305 |
| 89 | 3300026118 | Ga0207675_100113338 | Ga0207675_1001133382 | 305 |
| 90 | 3300046500 | Ga0495596_0011130 | Ga0495596_0011130_1651_2679 | 305 |
| 91 | 3300046518 | Ga0495631_0001037 | Ga0495631_0001037_9892_10920 | 305 |
| 92 | 3300037418 | Ga0395900_0001518 | Ga0395900_0001518_20002_21045 | 306 |
| 93 | 3300046694 | Ga0495649_0027895 | Ga0495649_0027895_796_1827 | 306 |
| 94 | 3300047319 | Ga0495674_0405508 | Ga0495674_0405508_88_1074 | 306 |
| 95 | 3300005539 | Ga0068853_100129114 | Ga0068853_1001291142 | 307 |
| 96 | 3300025908 | Ga0207643_10056090 | Ga0207643_100560901 | 307 |
| 97 | 3300026041 | Ga0207639_10074306 | Ga0207639_100743062 | 307 |
| 98 | 3300005290 | Ga0065712_10088061 | Ga0065712_100880612 | 308 |
| 99 | 3300005548 | Ga0070665_100000118 | Ga0070665_100000118112 | 308 |
| 100 | 3300009093 | Ga0105240_10017563 | Ga0105240_100175633 | 308 |
| 101 | 3300009093 | Ga0105240_10262897 | Ga0105240_102628972 | 308 |
| 102 | 3300025272 | Ga0209455_1008606 | Ga0209455_10086062 | 308 |
| 103 | 3300025913 | Ga0207695_10014909 | Ga0207695_100149095 | 308 |
| 104 | 3300025913 | Ga0207695_10046838 | Ga0207695_100468385 | 308 |
| 105 | 3300028379 | Ga0268266_10000121 | Ga0268266_1000012144 | 308 |
| 106 | 3300050511 | nmdc:mga08y16_118091_c1 | nmdc:mga08y16_118091_c1_1447_2487 | 308 |
| 107 | 3300048089 | Ga0495614_0007507 | Ga0495614_0007507_1137_2195 | 309 |
| 108 | 3300003323 | rootH1_10027403 | rootH1_1002740318 | 310 |
| 109 | 3300005328 | Ga0070676_10000113 | Ga0070676_1000011327 | 310 |
| 110 | 3300005338 | Ga0068868_100094324 | Ga0068868_1000943242 | 310 |
| 111 | 3300005364 | Ga0070673_100031160 | Ga0070673_1000311601 | 310 |
| 112 | 3300005456 | Ga0070678_100023305 | Ga0070678_1000233053 | 310 |
| 113 | 3300005459 | Ga0068867_100003787 | Ga0068867_10000378713 | 310 |
| 114 | 3300005616 | Ga0068852_100026093 | Ga0068852_1000260932 | 310 |
| 115 | 3300005718 | Ga0068866_10016357 | Ga0068866_100163573 | 310 |
| 116 | 3300006237 | Ga0097621_100000015 | Ga0097621_10000001581 | 310 |
| 117 | 3300006358 | Ga0068871_100000051 | Ga0068871_10000005164 | 310 |
| 118 | 3300006881 | Ga0068865_100002736 | Ga0068865_1000027367 | 310 |
| 119 | 3300006881 | Ga0068865_100109836 | Ga0068865_1001098362 | 310 |
| 120 | 3300009174 | Ga0105241_10005937 | Ga0105241_100059373 | 310 |
| 121 | 3300009545 | Ga0105237_10001895 | Ga0105237_1000189522 | 310 |
| 122 | 3300009551 | Ga0105238_10059144 | Ga0105238_100591445 | 310 |
| 123 | 3300011119 | Ga0105246_10092551 | Ga0105246_100925512 | 310 |
| 124 | 3300013296 | Ga0157374_10001665 | Ga0157374_1000166511 | 310 |
| 125 | 3300013297 | Ga0157378_10026892 | Ga0157378_100268923 | 310 |
| 126 | 3300021361 | Ga0213872_10025003 | Ga0213872_100250033 | 310 |
| 127 | 3300025907 | Ga0207645_10000229 | Ga0207645_1000022934 | 310 |
| 128 | 3300025911 | Ga0207654_10006962 | Ga0207654_100069625 | 310 |
| 129 | 3300025914 | Ga0207671_10012946 | Ga0207671_100129463 | 310 |
| 130 | 3300025924 | Ga0207694_10035816 | Ga0207694_100358162 | 310 |
| 131 | 3300025938 | Ga0207704_10000047 | Ga0207704_1000004740 | 310 |
| 132 | 3300026023 | Ga0207677_10130409 | Ga0207677_101304093 | 310 |
| 133 | 3300026041 | Ga0207639_10009275 | Ga0207639_100092753 | 310 |
| 134 | 3300026089 | Ga0207648_10007503 | Ga0207648_1000750313 | 310 |
| 135 | 3300026142 | Ga0207698_10010495 | Ga0207698_100104957 | 310 |
| 136 | 3300039447 | Ga0436361_0906526 | Ga0436361_0906526_2779_3810 | 310 |
| 137 | 3300003320 | rootH2_10012714 | rootH2_1001271444 | 311 |
| 138 | 3300005547 | Ga0070693_100078210 | Ga0070693_1000782102 | 311 |
| 139 | 3300025250 | Ga0209026_1005112 | Ga0209026_10051124 | 311 |
| 140 | 3300049742 | Ga0501080_0157282 | Ga0501080_0157282_374_1420 | 311 |
| 141 | 3300005334 | Ga0068869_100064432 | Ga0068869_1000644322 | 312 |
| 142 | 3300005344 | Ga0070661_100076574 | Ga0070661_1000765743 | 312 |
| 143 | 3300005354 | Ga0070675_100118016 | Ga0070675_1001180162 | 312 |
| 144 | 3300005564 | Ga0070664_100004250 | Ga0070664_1000042506 | 312 |
| 145 | 3300005617 | Ga0068859_100171588 | Ga0068859_1001715882 | 312 |
| 146 | 3300006931 | Ga0097620_100171599 | Ga0097620_1001715992 | 312 |
| 147 | 3300014745 | Ga0157377_10023161 | Ga0157377_100231613 | 312 |
| 148 | 3300025901 | Ga0207688_10014315 | Ga0207688_100143155 | 312 |
| 149 | 3300025942 | Ga0207689_10073320 | Ga0207689_100733202 | 312 |
| 150 | 3300025945 | Ga0207679_10082428 | Ga0207679_100824282 | 312 |
| 151 | 3300049568 | Ga0501031_0015383 | Ga0501031_0015383_2036_3058 | 312 |
| 152 | 3300049569 | Ga0501032_0008235 | Ga0501032_0008235_3568_4590 | 312 |
| 153 | 3300049570 | Ga0501033_0000085 | Ga0501033_0000085_12825_13847 | 312 |
| 154 | 3300049571 | Ga0501034_0000308 | Ga0501034_0000308_5617_6639 | 312 |
| 155 | 3300049572 | Ga0501036_0119218 | Ga0501036_0119218_1028_2050 | 312 |
| 156 | 3300049573 | Ga0501037_0013826 | Ga0501037_0013826_552_1574 | 312 |
| 157 | 3300049574 | Ga0501038_0002849 | Ga0501038_0002849_14223_15245 | 312 |
| 158 | 3300049574 | Ga0501038_0048753 | Ga0501038_0048753_165_1187 | 312 |
| 159 | 3300049579 | Ga0501043_0005704 | Ga0501043_0005704_2129_3151 | 312 |
| 160 | 3300049822 | Ga0501035_0011027 | Ga0501035_0011027_5234_6256 | 312 |
| 161 | 3300049823 | Ga0501044_0048151 | Ga0501044_0048151_1674_2696 | 312 |
| 162 | 3300049824 | Ga0501045_0000206 | Ga0501045_0000206_27470_28492 | 312 |
| 163 | 3300053122 | Ga0500608_000440 | Ga0500608_000440_11945_12979 | 312 |
| 164 | 3300049569 | Ga0501032_0042193 | Ga0501032_0042193_1877_2929 | 313 |
| 165 | 3300049571 | Ga0501034_0061795 | Ga0501034_0061795_2153_3205 | 313 |
| 166 | 3300049572 | Ga0501036_0033163 | Ga0501036_0033163_1928_2980 | 313 |
| 167 | 3300049573 | Ga0501037_0083489 | Ga0501037_0083489_146_1198 | 313 |
| 168 | 3300049574 | Ga0501038_0069021 | Ga0501038_0069021_1771_2823 | 313 |
| 169 | 3300049580 | Ga0501046_0033435 | Ga0501046_0033435_1105_2157 | 313 |
| 170 | 3300049581 | Ga0501047_0117300 | Ga0501047_0117300_1139_2191 | 313 |
| 171 | 3300049583 | Ga0501067_0054349 | Ga0501067_0054349_648_1700 | 313 |
| 172 | 3300049586 | Ga0501070_0006179 | Ga0501070_0006179_1461_2513 | 313 |
| 173 | 3300049589 | Ga0501073_0008853 | Ga0501073_0008853_4091_5143 | 313 |
| 174 | 3300049590 | Ga0501074_0018342 | Ga0501074_0018342_2164_3216 | 313 |
| 175 | 3300049742 | Ga0501080_0046204 | Ga0501080_0046204_1362_2414 | 313 |
| 176 | 3300049744 | Ga0501083_0107045 | Ga0501083_0107045_483_1535 | 313 |
| 177 | 3300049823 | Ga0501044_0001663 | Ga0501044_0001663_11452_12504 | 313 |
| 178 | 3300003323 | rootH1_10012675 | rootH1_100126752 | 314 |
| 179 | 3300048908 | Ga0496105_0175109 | Ga0496105_0175109_692_1723 | 314 |
| 180 | iso_pu_bacteria | 2511231000 | 2511233952 | 314 |
| 181 | iso_pu_bacteria | 2582581278 | 2585142430 | 314 |
| 182 | iso_pu_bacteria | 2582581281 | 2585156962 | 314 |
| 183 | iso_pu_bacteria | 2582581282 | 2585161481 | 314 |
| 184 | iso_pu_bacteria | 2585428045 | 2587681185 | 314 |
| 185 | iso_pu_bacteria | 2585428060 | 2587748901 | 314 |
| 186 | iso_pu_bacteria | 2585428061 | 2587753624 | 314 |
| 187 | iso_pu_bacteria | 2585428115 | 2587942513 | 314 |
| 188 | iso_pu_bacteria | 2585428182 | 2588211770 | 314 |
| 189 | iso_pu_bacteria | 2585428183 | 2588216567 | 314 |
| 190 | iso_pu_bacteria | 2585428184 | 2588220643 | 314 |
| 191 | iso_pu_bacteria | 2585428185 | 2588225932 | 314 |
| 192 | iso_pu_bacteria | 2585428187 | 2588230991 | 314 |
| 193 | iso_pu_bacteria | 2588253712 | 2588447837 | 314 |
| 194 | iso_pu_bacteria | 2588254255 | 2590603603 | 314 |
| 195 | iso_pu_bacteria | 2588254257 | 2590610481 | 314 |
| 196 | iso_pu_bacteria | 2728369107 | 2729202481 | 314 |
| 197 | iso_pu_bacteria | 2738541273 | 2738699962 | 314 |
| 198 | iso_pu_bacteria | 2738543014 | 2739253711 | 314 |
| 199 | iso_pu_bacteria | 2751185877 | 2753674967 | 314 |
| 200 | iso_pu_bacteria | 2765235839 | 2765575974 | 314 |
| 201 | iso_pu_bacteria | 2772190705 | 2772607398 | 314 |
| 202 | iso_pu_bacteria | 2775506739 | 2775674081 | 314 |
| 203 | iso_pu_bacteria | 2816332188 | 2816875676 | 314 |
| 204 | iso_pu_bacteria | 2842083920 | 2842087833 | 314 |
| 205 | iso_pu_bacteria | 2871720351 | 2871724772 | 314 |
| 206 | iso_pu_bacteria | 2889290771 | 2889293534 | 314 |
| 207 | iso_pu_bacteria | 2905999023 | 2906002077 | 314 |
| 208 | iso_pu_bacteria | 2919097161 | 2919099963 | 314 |
| 209 | iso_pu_bacteria | 2919399522 | 2919403494 | 314 |
| 210 | iso_pu_bacteria | 2929921140 | 2929927686 | 314 |
| 211 | iso_pu_bacteria | 2945924605 | 2945928657 | 314 |
| 212 | iso_pu_bacteria | 2946019816 | 2946019902 | 314 |
| 213 | iso_pu_bacteria | 2977243572 | 2977247494 | 314 |
| 214 | iso_pu_bacteria | 2993372514 | 2993374822 | 314 |
| 215 | iso_pu_bacteria | 2993480792 | 2993481678 | 314 |
| 216 | iso_pu_bacteria | 8003151029 | 8003151533 | 314 |
| 217 | iso_pu_bacteria | 2929177148 | 2929183301 | 315 |
| 218 | iso_pu_bacteria | 2929239360 | 2929245419 | 315 |
| 219 | iso_pu_bacteria | 2945977869 | 2945979261 | 315 |
| 220 | iso_pu_bacteria | 2946013367 | 2946014868 | 315 |
| 221 | 3300001979 | JGI24740J21852_10016845 | JGI24740J21852_100168452 | 316 |
| 222 | 3300002738 | JGI25154J39366_1000020 | JGI25154J39366_100002072 | 316 |
| 223 | 3300005834 | Ga0068851_10000057 | Ga0068851_1000005710 | 316 |
| 224 | 3300006844 | Ga0075428_100086344 | Ga0075428_1000863444 | 316 |
| 225 | 3300010375 | Ga0105239_10200999 | Ga0105239_102009993 | 316 |
| 226 | 3300025246 | Ga0209646_1000005 | Ga0209646_1000005489 | 316 |
| 227 | 3300025250 | Ga0209026_1000149 | Ga0209026_100014918 | 316 |
| 228 | 3300025258 | Ga0209129_1007350 | Ga0209129_10073505 | 316 |
| 229 | 3300025302 | Ga0207426_1000262 | Ga0207426_100026241 | 316 |
| 230 | 3300025321 | Ga0207656_10000048 | Ga0207656_1000004839 | 316 |
| 231 | 3300032004 | Ga0307414_10020454 | Ga0307414_100204543 | 316 |
| 232 | 3300032004 | Ga0307414_10032626 | Ga0307414_100326263 | 316 |
| 233 | 3300032004 | Ga0307414_10232414 | Ga0307414_102324142 | 316 |
| 234 | 3300042876 | Ga0451577_0021459 | Ga0451577_0021459_1608_2636 | 316 |
| 235 | 3300048924 | Ga0496121_0000010 | Ga0496121_0000010_187357_188391 | 316 |
| 236 | 3300049571 | Ga0501034_0265365 | Ga0501034_0265365_329_1381 | 316 |
| 237 | 3300049742 | Ga0501080_0393496 | Ga0501080_0393496_98_1150 | 316 |
| 238 | 3300053131 | Ga0500652_015113 | Ga0500652_015113_1644_2678 | 316 |
| 239 | 3300053156 | Ga0500622_0003011 | Ga0500622_0003011_6365_7417 | 316 |
| 240 | iso_pu_bacteria | 2929154850 | 2929158423 | 316 |
| 241 | 3300003322 | rootL2_10009362 | rootL2_100093622 | 317 |
| 242 | 3300003794 | Ga0055531_10000132 | Ga0055531_1000013266 | 317 |
| 243 | 3300005340 | Ga0070689_100218782 | Ga0070689_1002187822 | 317 |
| 244 | 3300005354 | Ga0070675_100041897 | Ga0070675_1000418973 | 317 |
| 245 | 3300005365 | Ga0070688_100015669 | Ga0070688_1000156692 | 317 |
| 246 | 3300005471 | Ga0070698_100003913 | Ga0070698_1000039134 | 317 |
| 247 | 3300005543 | Ga0070672_100141682 | Ga0070672_1001416822 | 317 |
| 248 | 3300005616 | Ga0068852_100079569 | Ga0068852_1000795692 | 317 |
| 249 | 3300005618 | Ga0068864_100505402 | Ga0068864_1005054021 | 317 |
| 250 | 3300005841 | Ga0068863_100014098 | Ga0068863_1000140988 | 317 |
| 251 | 3300005842 | Ga0068858_100146620 | Ga0068858_1001466202 | 317 |
| 252 | 3300005844 | Ga0068862_100187919 | Ga0068862_1001879192 | 317 |
| 253 | 3300006358 | Ga0068871_100318227 | Ga0068871_1003182271 | 317 |
| 254 | 3300006844 | Ga0075428_100071519 | Ga0075428_1000715194 | 317 |
| 255 | 3300006846 | Ga0075430_100034421 | Ga0075430_1000344215 | 317 |
| 256 | 3300006847 | Ga0075431_100069264 | Ga0075431_1000692642 | 317 |
| 257 | 3300006880 | Ga0075429_100252160 | Ga0075429_1002521601 | 317 |
| 258 | 3300006881 | Ga0068865_100080837 | Ga0068865_1000808373 | 317 |
| 259 | 3300009176 | Ga0105242_10040197 | Ga0105242_100401972 | 317 |
| 260 | 3300013296 | Ga0157374_10560652 | Ga0157374_105606521 | 317 |
| 261 | 3300014325 | Ga0163163_10219127 | Ga0163163_102191272 | 317 |
| 262 | 3300014745 | Ga0157377_10096723 | Ga0157377_100967232 | 317 |
| 263 | 3300014969 | Ga0157376_10208429 | Ga0157376_102084292 | 317 |
| 264 | 3300025918 | Ga0207662_10097041 | Ga0207662_100970412 | 317 |
| 265 | 3300025926 | Ga0207659_10007464 | Ga0207659_100074644 | 317 |
| 266 | 3300025934 | Ga0207686_10004707 | Ga0207686_100047074 | 317 |
| 267 | 3300025936 | Ga0207670_10028297 | Ga0207670_100282974 | 317 |
| 268 | 3300025940 | Ga0207691_10014922 | Ga0207691_100149229 | 317 |
| 269 | 3300026035 | Ga0207703_10019532 | Ga0207703_100195325 | 317 |
| 270 | 3300026088 | Ga0207641_10000448 | Ga0207641_1000044838 | 317 |
| 271 | 3300046499 | Ga0495594_0124003 | Ga0495594_0124003_208_1245 | 317 |
| 272 | 3300046539 | Ga0495621_0043702 | Ga0495621_0043702_129_1166 | 317 |
| 273 | 3300050508 | nmdc:mga09592_48708_c1 | nmdc:mga09592_48708_c1_233_1270 | 317 |
| 274 | 3300050509 | nmdc:mga0qj67_35982_c1 | nmdc:mga0qj67_35982_c1_1530_2567 | 317 |
| 275 | 3300050510 | nmdc:mga06r32_43289_c1 | nmdc:mga06r32_43289_c1_1736_2773 | 317 |
| 276 | 3300003320 | rootH2_10005563 | rootH2_100055636 | 318 |
| 277 | 3300005290 | Ga0065712_10005831 | Ga0065712_100058313 | 318 |
| 278 | 3300005290 | Ga0065712_10072974 | Ga0065712_100729745 | 318 |
| 279 | 3300005334 | Ga0068869_100032192 | Ga0068869_1000321924 | 318 |
| 280 | 3300005365 | Ga0070688_100011134 | Ga0070688_1000111342 | 318 |
| 281 | 3300005466 | Ga0070685_10027123 | Ga0070685_100271232 | 318 |
| 282 | 3300005466 | Ga0070685_10123650 | Ga0070685_101236502 | 318 |
| 283 | 3300005577 | Ga0068857_100112367 | Ga0068857_1001123672 | 318 |
| 284 | 3300006237 | Ga0097621_100074955 | Ga0097621_1000749553 | 318 |
| 285 | 3300009553 | Ga0105249_10007529 | Ga0105249_100075294 | 318 |
| 286 | 3300009553 | Ga0105249_10059302 | Ga0105249_100593023 | 318 |
| 287 | 3300013100 | Ga0157373_10025296 | Ga0157373_100252965 | 318 |
| 288 | 3300013308 | Ga0157375_10093696 | Ga0157375_100936963 | 318 |
| 289 | 3300017792 | Ga0163161_10014389 | Ga0163161_100143892 | 318 |
| 290 | 3300025961 | Ga0207712_10010819 | Ga0207712_100108192 | 318 |
| 291 | 3300025961 | Ga0207712_10018274 | Ga0207712_100182742 | 318 |
| 292 | 3300026078 | Ga0207702_10049475 | Ga0207702_100494754 | 318 |
| 293 | 3300026089 | Ga0207648_10116190 | Ga0207648_101161901 | 318 |
| 294 | 3300026116 | Ga0207674_10271207 | Ga0207674_102712072 | 318 |
| 295 | 3300044658 | Ga0466972_0000010 | Ga0466972_0000010_92992_94035 | 318 |
| 296 | 3300044673 | Ga0453683_0204503 | Ga0453683_0204503_65_1105 | 318 |
| 297 | 3300044735 | Ga0466968_0033528 | Ga0466968_0033528_211_1254 | 318 |
| 298 | 3300044765 | Ga0466970_0000471 | Ga0466970_0000471_13598_14641 | 318 |
| 299 | 3300046538 | Ga0495609_0021448 | Ga0495609_0021448_84_1121 | 318 |
| 300 | 3300048903 | Ga0496100_0359845 | Ga0496100_0359845_13_1047 | 318 |
| 301 | 3300042876 | Ga0451577_0006314 | Ga0451577_0006314_7587_8657 | 319 |
| 302 | iso_pu_bacteria | 2852623160 | 2852627064 | 319 |
| 303 | iso_pu_bacteria | 2884933994 | 2884935202 | 319 |
| 304 | iso_pu_bacteria | 2928078545 | 2928083285 | 319 |
| 305 | 3300005334 | Ga0068869_100044765 | Ga0068869_1000447653 | 320 |
| 306 | 3300005844 | Ga0068862_100122192 | Ga0068862_1001221922 | 320 |
| 307 | 3300006844 | Ga0075428_100295416 | Ga0075428_1002954162 | 320 |
| 308 | 3300009094 | Ga0111539_10121157 | Ga0111539_101211572 | 320 |
| 309 | 3300009148 | Ga0105243_10267417 | Ga0105243_102674172 | 320 |
| 310 | 3300009176 | Ga0105242_10023597 | Ga0105242_100235975 | 320 |
| 311 | 3300009545 | Ga0105237_10001504 | Ga0105237_100015047 | 320 |
| 312 | 3300009553 | Ga0105249_10056562 | Ga0105249_100565622 | 320 |
| 313 | 3300010375 | Ga0105239_10000166 | Ga0105239_1000016640 | 320 |
| 314 | 3300013102 | Ga0157371_10038939 | Ga0157371_100389392 | 320 |
| 315 | 3300013307 | Ga0157372_10033521 | Ga0157372_100335213 | 320 |
| 316 | 3300013307 | Ga0157372_10355418 | Ga0157372_103554182 | 320 |
| 317 | 3300013307 | Ga0157372_10385494 | Ga0157372_103854941 | 320 |
| 318 | 3300013307 | Ga0157372_10614255 | Ga0157372_106142551 | 320 |
| 319 | 3300013308 | Ga0157375_10070243 | Ga0157375_100702435 | 320 |
| 320 | 3300014326 | Ga0157380_10033408 | Ga0157380_100334082 | 320 |
| 321 | 3300025914 | Ga0207671_10007623 | Ga0207671_100076233 | 320 |
| 322 | 3300025942 | Ga0207689_10031652 | Ga0207689_100316523 | 320 |
| 323 | 3300026089 | Ga0207648_10037679 | Ga0207648_100376792 | 320 |
| 324 | 3300031548 | Ga0307408_100000396 | Ga0307408_10000039622 | 320 |
| 325 | 3300037418 | Ga0395900_0504437 | Ga0395900_0504437_53_1114 | 320 |
| 326 | 3300044712 | Ga0453684_0086754 | Ga0453684_0086754_2434_3465 | 320 |
| 327 | 3300044712 | Ga0453684_0342350 | Ga0453684_0342350_424_1467 | 320 |
| 328 | 3300047472 | Ga0495686_0074784 | Ga0495686_0074784_752_1783 | 320 |
| 329 | 3300001979 | JGI24740J21852_10025207 | JGI24740J21852_100252072 | 321 |
| 330 | 3300005289 | Ga0065704_10005995 | Ga0065704_100059953 | 321 |
| 331 | 3300005290 | Ga0065712_10095713 | Ga0065712_100957131 | 321 |
| 332 | 3300005329 | Ga0070683_100000553 | Ga0070683_10000055316 | 321 |
| 333 | 3300005329 | Ga0070683_100004195 | Ga0070683_1000041956 | 321 |
| 334 | 3300005329 | Ga0070683_100148647 | Ga0070683_1001486471 | 321 |
| 335 | 3300005329 | Ga0070683_100164739 | Ga0070683_1001647392 | 321 |
| 336 | 3300005334 | Ga0068869_100020182 | Ga0068869_1000201822 | 321 |
| 337 | 3300005334 | Ga0068869_100032055 | Ga0068869_1000320552 | 321 |
| 338 | 3300005334 | Ga0068869_100042888 | Ga0068869_1000428882 | 321 |
| 339 | 3300005335 | Ga0070666_10038276 | Ga0070666_100382761 | 321 |
| 340 | 3300005338 | Ga0068868_100006083 | Ga0068868_1000060837 | 321 |
| 341 | 3300005338 | Ga0068868_100006616 | Ga0068868_10000661610 | 321 |
| 342 | 3300005338 | Ga0068868_100025162 | Ga0068868_1000251621 | 321 |
| 343 | 3300005340 | Ga0070689_100002494 | Ga0070689_1000024942 | 321 |
| 344 | 3300005340 | Ga0070689_100021302 | Ga0070689_1000213022 | 321 |
| 345 | 3300005343 | Ga0070687_100174905 | Ga0070687_1001749051 | 321 |
| 346 | 3300005344 | Ga0070661_100000179 | Ga0070661_1000001799 | 321 |
| 347 | 3300005344 | Ga0070661_100044057 | Ga0070661_1000440574 | 321 |
| 348 | 3300005355 | Ga0070671_100163158 | Ga0070671_1001631581 | 321 |
| 349 | 3300005364 | Ga0070673_100109466 | Ga0070673_1001094662 | 321 |
| 350 | 3300005365 | Ga0070688_100038106 | Ga0070688_1000381061 | 321 |
| 351 | 3300005365 | Ga0070688_100098046 | Ga0070688_1000980463 | 321 |
| 352 | 3300005366 | Ga0070659_100025291 | Ga0070659_1000252915 | 321 |
| 353 | 3300005366 | Ga0070659_100131931 | Ga0070659_1001319312 | 321 |
| 354 | 3300005367 | Ga0070667_100095701 | Ga0070667_1000957013 | 321 |
| 355 | 3300005455 | Ga0070663_100140558 | Ga0070663_1001405581 | 321 |
| 356 | 3300005456 | Ga0070678_100021468 | Ga0070678_1000214685 | 321 |
| 357 | 3300005457 | Ga0070662_100012586 | Ga0070662_1000125865 | 321 |
| 358 | 3300005457 | Ga0070662_100013751 | Ga0070662_1000137512 | 321 |
| 359 | 3300005457 | Ga0070662_100021047 | Ga0070662_1000210475 | 321 |
| 360 | 3300005457 | Ga0070662_100330288 | Ga0070662_1003302881 | 321 |
| 361 | 3300005459 | Ga0068867_100065084 | Ga0068867_1000650843 | 321 |
| 362 | 3300005459 | Ga0068867_100195453 | Ga0068867_1001954532 | 321 |
| 363 | 3300005535 | Ga0070684_100001469 | Ga0070684_1000014697 | 321 |
| 364 | 3300005535 | Ga0070684_100065293 | Ga0070684_1000652934 | 321 |
| 365 | 3300005539 | Ga0068853_100024340 | Ga0068853_1000243403 | 321 |
| 366 | 3300005539 | Ga0068853_100182403 | Ga0068853_1001824031 | 321 |
| 367 | 3300005543 | Ga0070672_100050257 | Ga0070672_1000502574 | 321 |
| 368 | 3300005544 | Ga0070686_100053016 | Ga0070686_1000530162 | 321 |
| 369 | 3300005564 | Ga0070664_100001077 | Ga0070664_1000010773 | 321 |
| 370 | 3300005564 | Ga0070664_100139753 | Ga0070664_1001397532 | 321 |
| 371 | 3300005577 | Ga0068857_100046270 | Ga0068857_1000462704 | 321 |
| 372 | 3300005618 | Ga0068864_100077517 | Ga0068864_1000775174 | 321 |
| 373 | 3300005618 | Ga0068864_100443316 | Ga0068864_1004433161 | 321 |
| 374 | 3300005834 | Ga0068851_10065723 | Ga0068851_100657232 | 321 |
| 375 | 3300005841 | Ga0068863_100273684 | Ga0068863_1002736842 | 321 |
| 376 | 3300005842 | Ga0068858_100169281 | Ga0068858_1001692812 | 321 |
| 377 | 3300005842 | Ga0068858_100252025 | Ga0068858_1002520251 | 321 |
| 378 | 3300005844 | Ga0068862_100242902 | Ga0068862_1002429022 | 321 |
| 379 | 3300005985 | Ga0081539_10013758 | Ga0081539_100137585 | 321 |
| 380 | 3300006358 | Ga0068871_100102960 | Ga0068871_1001029603 | 321 |
| 381 | 3300006881 | Ga0068865_100148045 | Ga0068865_1001480452 | 321 |
| 382 | 3300009545 | Ga0105237_10023370 | Ga0105237_100233703 | 321 |
| 383 | 3300010375 | Ga0105239_10023061 | Ga0105239_100230612 | 321 |
| 384 | 3300013100 | Ga0157373_10053330 | Ga0157373_100533302 | 321 |
| 385 | 3300013102 | Ga0157371_10001199 | Ga0157371_1000119925 | 321 |
| 386 | 3300013102 | Ga0157371_10011057 | Ga0157371_100110576 | 321 |
| 387 | 3300013104 | Ga0157370_10010241 | Ga0157370_100102417 | 321 |
| 388 | 3300013105 | Ga0157369_10003605 | Ga0157369_100036059 | 321 |
| 389 | 3300013105 | Ga0157369_10030384 | Ga0157369_100303845 | 321 |
| 390 | 3300013296 | Ga0157374_10002410 | Ga0157374_1000241017 | 321 |
| 391 | 3300013296 | Ga0157374_10033689 | Ga0157374_100336892 | 321 |
| 392 | 3300013296 | Ga0157374_10035226 | Ga0157374_100352262 | 321 |
| 393 | 3300013306 | Ga0163162_10002066 | Ga0163162_1000206617 | 321 |
| 394 | 3300013306 | Ga0163162_10126140 | Ga0163162_101261402 | 321 |
| 395 | 3300013306 | Ga0163162_10191838 | Ga0163162_101918381 | 321 |
| 396 | 3300013307 | Ga0157372_10000039 | Ga0157372_1000003935 | 321 |
| 397 | 3300013307 | Ga0157372_10155743 | Ga0157372_101557433 | 321 |
| 398 | 3300013307 | Ga0157372_10534894 | Ga0157372_105348941 | 321 |
| 399 | 3300013308 | Ga0157375_10056899 | Ga0157375_100568994 | 321 |
| 400 | 3300013308 | Ga0157375_10060974 | Ga0157375_100609743 | 321 |
| 401 | 3300013308 | Ga0157375_10173258 | Ga0157375_101732582 | 321 |
| 402 | 3300014325 | Ga0163163_10000088 | Ga0163163_1000008816 | 321 |
| 403 | 3300014745 | Ga0157377_10002113 | Ga0157377_100021131 | 321 |
| 404 | 3300014968 | Ga0157379_10078807 | Ga0157379_100788072 | 321 |
| 405 | 3300017792 | Ga0163161_10012415 | Ga0163161_100124152 | 321 |
| 406 | 3300017792 | Ga0163161_10044867 | Ga0163161_100448674 | 321 |
| 407 | 3300017792 | Ga0163161_10075077 | Ga0163161_100750772 | 321 |
| 408 | 3300025302 | Ga0207426_1000059 | Ga0207426_1000059300 | 321 |
| 409 | 3300025321 | Ga0207656_10098938 | Ga0207656_100989381 | 321 |
| 410 | 3300025899 | Ga0207642_10026071 | Ga0207642_100260711 | 321 |
| 411 | 3300025903 | Ga0207680_10095130 | Ga0207680_100951301 | 321 |
| 412 | 3300025920 | Ga0207649_10005271 | Ga0207649_100052714 | 321 |
| 413 | 3300025920 | Ga0207649_10304353 | Ga0207649_103043531 | 321 |
| 414 | 3300025925 | Ga0207650_10192912 | Ga0207650_101929122 | 321 |
| 415 | 3300025926 | Ga0207659_10010641 | Ga0207659_100106413 | 321 |
| 416 | 3300025932 | Ga0207690_10004290 | Ga0207690_100042908 | 321 |
| 417 | 3300025933 | Ga0207706_10010295 | Ga0207706_1001029511 | 321 |
| 418 | 3300025933 | Ga0207706_10019515 | Ga0207706_100195152 | 321 |
| 419 | 3300025933 | Ga0207706_10039441 | Ga0207706_100394413 | 321 |
| 420 | 3300025933 | Ga0207706_10057952 | Ga0207706_100579525 | 321 |
| 421 | 3300025934 | Ga0207686_10073256 | Ga0207686_100732561 | 321 |
| 422 | 3300025936 | Ga0207670_10011472 | Ga0207670_100114725 | 321 |
| 423 | 3300025938 | Ga0207704_10152129 | Ga0207704_101521292 | 321 |
| 424 | 3300025940 | Ga0207691_10011157 | Ga0207691_100111574 | 321 |
| 425 | 3300025942 | Ga0207689_10025266 | Ga0207689_100252661 | 321 |
| 426 | 3300025942 | Ga0207689_10029603 | Ga0207689_100296032 | 321 |
| 427 | 3300025942 | Ga0207689_10118628 | Ga0207689_101186283 | 321 |
| 428 | 3300025944 | Ga0207661_10018216 | Ga0207661_100182162 | 321 |
| 429 | 3300025944 | Ga0207661_10022846 | Ga0207661_100228463 | 321 |
| 430 | 3300025944 | Ga0207661_10143564 | Ga0207661_101435641 | 321 |
| 431 | 3300025944 | Ga0207661_10369109 | Ga0207661_103691091 | 321 |
| 432 | 3300025945 | Ga0207679_10001674 | Ga0207679_100016748 | 321 |
| 433 | 3300025945 | Ga0207679_10003082 | Ga0207679_1000308210 | 321 |
| 434 | 3300025945 | Ga0207679_10082863 | Ga0207679_100828632 | 321 |
| 435 | 3300025960 | Ga0207651_10080207 | Ga0207651_100802073 | 321 |
| 436 | 3300025960 | Ga0207651_10128335 | Ga0207651_101283352 | 321 |
| 437 | 3300025986 | Ga0207658_10076781 | Ga0207658_100767811 | 321 |
| 438 | 3300025986 | Ga0207658_10118779 | Ga0207658_101187792 | 321 |
| 439 | 3300026023 | Ga0207677_10008316 | Ga0207677_100083162 | 321 |
| 440 | 3300026023 | Ga0207677_10009458 | Ga0207677_100094583 | 321 |
| 441 | 3300026035 | Ga0207703_10096803 | Ga0207703_100968032 | 321 |
| 442 | 3300026089 | Ga0207648_10241290 | Ga0207648_102412901 | 321 |
| 443 | 3300026116 | Ga0207674_10000894 | Ga0207674_1000089424 | 321 |
| 444 | 3300026116 | Ga0207674_10065548 | Ga0207674_100655484 | 321 |
| 445 | 3300026121 | Ga0207683_10026793 | Ga0207683_100267936 | 321 |
| 446 | 3300028380 | Ga0268265_10087769 | Ga0268265_100877691 | 321 |
| 447 | 3300028381 | Ga0268264_10161729 | Ga0268264_101617292 | 321 |
| 448 | 3300028381 | Ga0268264_10371264 | Ga0268264_103712642 | 321 |
| 449 | 3300028573 | Ga0265334_10052976 | Ga0265334_100529762 | 321 |
| 450 | 3300031251 | Ga0265327_10000073 | Ga0265327_1000007349 | 321 |
| 451 | 3300031548 | Ga0307408_100043965 | Ga0307408_1000439653 | 321 |
| 452 | 3300031731 | Ga0307405_10049721 | Ga0307405_100497212 | 321 |
| 453 | 3300031852 | Ga0307410_10162893 | Ga0307410_101628932 | 321 |
| 454 | 3300031995 | Ga0307409_100143078 | Ga0307409_1001430782 | 321 |
| 455 | 3300032002 | Ga0307416_100000457 | Ga0307416_10000045710 | 321 |
| 456 | 3300032126 | Ga0307415_100015535 | Ga0307415_1000155353 | 321 |
| 457 | 3300035172 | Ga0373955_0043317 | Ga0373955_0043317_1122_2171 | 321 |
| 458 | 3300035692 | Ga0373935_0054280 | Ga0373935_0054280_869_1918 | 321 |
| 459 | 3300035725 | Ga0373947_0092909 | Ga0373947_0092909_652_1701 | 321 |
| 460 | 3300036401 | Ga0373937_0031794 | Ga0373937_0031794_3014_4063 | 321 |
| 461 | 3300037312 | Ga0395899_0000024 | Ga0395899_0000024_325317_326354 | 321 |
| 462 | 3300037312 | Ga0395899_0000064 | Ga0395899_0000064_61131_62177 | 321 |
| 463 | 3300037418 | Ga0395900_0012681 | Ga0395900_0012681_3683_4729 | 321 |
| 464 | 3300042004 | Ga0439445_0004249 | Ga0439445_0004249_25_1080 | 321 |
| 465 | 3300044712 | Ga0453684_0079509 | Ga0453684_0079509_2157_3179 | 321 |
| 466 | 3300044712 | Ga0453684_0548830 | Ga0453684_0548830_137_1186 | 321 |
| 467 | 3300046454 | Ga0495592_0045217 | Ga0495592_0045217_1736_2785 | 321 |
| 468 | 3300046516 | Ga0495628_0018695 | Ga0495628_0018695_605_1654 | 321 |
| 469 | 3300046517 | Ga0495630_0086572 | Ga0495630_0086572_130_1179 | 321 |
| 470 | 3300046533 | Ga0495640_0128613 | Ga0495640_0128613_302_1423 | 321 |
| 471 | 3300046660 | Ga0495625_0078383 | Ga0495625_0078383_734_1795 | 321 |
| 472 | 3300047317 | Ga0495604_0039706 | Ga0495604_0039706_2045_3094 | 321 |
| 473 | 3300049570 | Ga0501033_0014934 | Ga0501033_0014934_2907_3965 | 321 |
| 474 | 3300049663 | Ga0501223_000153 | Ga0501223_000153_5371_6501 | 321 |
| 475 | 3300049705 | Ga0501225_0035083 | Ga0501225_0035083_203_1336 | 321 |
| 476 | 3300053156 | Ga0500622_0002531 | Ga0500622_0002531_10943_12004 | 321 |
| 477 | iso_pu_bacteria | 2738541283 | 2738756039 | 321 |
| 478 | iso_pu_bacteria | 2738543023 | 2739304131 | 321 |
| 479 | 3300003316 | rootH1_10004943 | rootH1_100049432 | 322 |
| 480 | 3300003322 | rootL2_10151563 | rootL2_101515632 | 322 |
| 481 | 3300005327 | Ga0070658_10158374 | Ga0070658_101583742 | 322 |
| 482 | 3300005331 | Ga0070670_100035680 | Ga0070670_1000356802 | 322 |
| 483 | 3300005334 | Ga0068869_100012829 | Ga0068869_1000128294 | 322 |
| 484 | 3300005334 | Ga0068869_100122259 | Ga0068869_1001222592 | 322 |
| 485 | 3300005356 | Ga0070674_100063980 | Ga0070674_1000639802 | 322 |
| 486 | 3300005367 | Ga0070667_100142934 | Ga0070667_1001429342 | 322 |
| 487 | 3300005564 | Ga0070664_100349367 | Ga0070664_1003493671 | 322 |
| 488 | 3300005577 | Ga0068857_100122124 | Ga0068857_1001221242 | 322 |
| 489 | 3300005617 | Ga0068859_100014773 | Ga0068859_1000147738 | 322 |
| 490 | 3300005618 | Ga0068864_100030528 | Ga0068864_1000305283 | 322 |
| 491 | 3300005842 | Ga0068858_100363142 | Ga0068858_1003631422 | 322 |
| 492 | 3300005843 | Ga0068860_100123196 | Ga0068860_1001231962 | 322 |
| 493 | 3300005844 | Ga0068862_100137308 | Ga0068862_1001373081 | 322 |
| 494 | 3300006846 | Ga0075430_100287046 | Ga0075430_1002870462 | 322 |
| 495 | 3300006931 | Ga0097620_100014774 | Ga0097620_1000147748 | 322 |
| 496 | 3300009093 | Ga0105240_10188688 | Ga0105240_101886882 | 322 |
| 497 | 3300009101 | Ga0105247_10002997 | Ga0105247_1000299710 | 322 |
| 498 | 3300009553 | Ga0105249_10018555 | Ga0105249_100185554 | 322 |
| 499 | 3300009553 | Ga0105249_10026565 | Ga0105249_100265656 | 322 |
| 500 | 3300013100 | Ga0157373_10001842 | Ga0157373_100018422 | 322 |
| 501 | 3300013100 | Ga0157373_10009487 | Ga0157373_100094872 | 322 |
| 502 | 3300013307 | Ga0157372_10041830 | Ga0157372_100418301 | 322 |
| 503 | 3300013308 | Ga0157375_10231830 | Ga0157375_102318302 | 322 |
| 504 | 3300014325 | Ga0163163_10235113 | Ga0163163_102351132 | 322 |
| 505 | 3300014968 | Ga0157379_10531207 | Ga0157379_105312071 | 322 |
| 506 | 3300025900 | Ga0207710_10001252 | Ga0207710_100012527 | 322 |
| 507 | 3300025945 | Ga0207679_10212983 | Ga0207679_102129831 | 322 |
| 508 | 3300025961 | Ga0207712_10015720 | Ga0207712_100157202 | 322 |
| 509 | 3300025961 | Ga0207712_10042455 | Ga0207712_100424553 | 322 |
| 510 | 3300026088 | Ga0207641_10202813 | Ga0207641_102028133 | 322 |
| 511 | 3300026095 | Ga0207676_10054277 | Ga0207676_100542773 | 322 |
| 512 | 3300026118 | Ga0207675_100322644 | Ga0207675_1003226442 | 322 |
| 513 | 3300028380 | Ga0268265_10059888 | Ga0268265_100598884 | 322 |
| 514 | 3300028381 | Ga0268264_10086260 | Ga0268264_100862603 | 322 |
| 515 | 3300028800 | Ga0265338_10035459 | Ga0265338_100354595 | 322 |
| 516 | 3300032004 | Ga0307414_10201575 | Ga0307414_102015752 | 322 |
| 517 | 3300042532 | Ga0450893_0005472 | Ga0450893_0005472_494_1534 | 322 |
| 518 | 3300047472 | Ga0495686_0005442 | Ga0495686_0005442_7735_8769 | 322 |
| 519 | 3300049670 | Ga0501236_000154 | Ga0501236_000154_4578_5618 | 322 |
| 520 | 3300049686 | Ga0501257_004933 | Ga0501257_004933_708_1748 | 322 |
| 521 | 3300049705 | Ga0501225_0013373 | Ga0501225_0013373_619_1659 | 322 |
| 522 | iso_pu_bacteria | 2849281842 | 2849284226 | 322 |
| 523 | 3300001904 | JGI24736J21556_1004595 | JGI24736J21556_10045952 | 323 |
| 524 | 3300001979 | JGI24740J21852_10021582 | JGI24740J21852_100215823 | 323 |
| 525 | 3300001990 | JGI24737J22298_10015866 | JGI24737J22298_100158662 | 323 |
| 526 | 3300002067 | JGI24735J21928_10023534 | JGI24735J21928_100235342 | 323 |
| 527 | 3300002737 | JGI25162J39368_1000562 | JGI25162J39368_100056225 | 323 |
| 528 | 3300003214 | JGI25165J46597_1002545 | JGI25165J46597_10025455 | 323 |
| 529 | 3300003320 | rootH2_10056449 | rootH2_100564492 | 323 |
| 530 | 3300003323 | rootH1_10012646 | rootH1_1001264655 | 323 |
| 531 | 3300003794 | Ga0055531_10000868 | Ga0055531_1000086814 | 323 |
| 532 | 3300004799 | Ga0058863_10008894 | Ga0058863_100088948 | 323 |
| 533 | 3300004800 | Ga0058861_10875503 | Ga0058861_108755032 | 323 |
| 534 | 3300004803 | Ga0058862_10143705 | Ga0058862_101437059 | 323 |
| 535 | 3300005336 | Ga0070680_100005673 | Ga0070680_1000056736 | 323 |
| 536 | 3300005366 | Ga0070659_100000868 | Ga0070659_10000086824 | 323 |
| 537 | 3300005458 | Ga0070681_10019337 | Ga0070681_100193375 | 323 |
| 538 | 3300005530 | Ga0070679_100137891 | Ga0070679_1001378914 | 323 |
| 539 | 3300005563 | Ga0068855_100000049 | Ga0068855_100000049131 | 323 |
| 540 | 3300005614 | Ga0068856_100007533 | Ga0068856_10000753312 | 323 |
| 541 | 3300005614 | Ga0068856_100016616 | Ga0068856_1000166163 | 323 |
| 542 | 3300005617 | Ga0068859_100167794 | Ga0068859_1001677942 | 323 |
| 543 | 3300006195 | Ga0075366_10000556 | Ga0075366_100005566 | 323 |
| 544 | 3300006931 | Ga0097620_100167788 | Ga0097620_1001677883 | 323 |
| 545 | 3300013100 | Ga0157373_10314564 | Ga0157373_103145641 | 323 |
| 546 | 3300013102 | Ga0157371_10000107 | Ga0157371_1000010732 | 323 |
| 547 | 3300013307 | Ga0157372_10000238 | Ga0157372_1000023820 | 323 |
| 548 | 3300013307 | Ga0157372_10038960 | Ga0157372_100389605 | 323 |
| 549 | 3300014326 | Ga0157380_10353017 | Ga0157380_103530172 | 323 |
| 550 | 3300025231 | Ga0207427_100122 | Ga0207427_10012237 | 323 |
| 551 | 3300025233 | Ga0209437_100048 | Ga0209437_100048259 | 323 |
| 552 | 3300025261 | Ga0209233_1000029 | Ga0209233_1000029117 | 323 |
| 553 | 3300025261 | Ga0209233_1001271 | Ga0209233_10012717 | 323 |
| 554 | 3300025304 | Ga0209257_1000006 | Ga0209257_1000006717 | 323 |
| 555 | 3300025904 | Ga0207647_10000071 | Ga0207647_1000007151 | 323 |
| 556 | 3300025912 | Ga0207707_10013779 | Ga0207707_100137796 | 323 |
| 557 | 3300025921 | Ga0207652_10003461 | Ga0207652_100034618 | 323 |
| 558 | 3300025932 | Ga0207690_10001688 | Ga0207690_1000168813 | 323 |
| 559 | 3300025932 | Ga0207690_10017044 | Ga0207690_100170444 | 323 |
| 560 | 3300025949 | Ga0207667_10000015 | Ga0207667_10000015381 | 323 |
| 561 | 3300026035 | Ga0207703_10082239 | Ga0207703_100822394 | 323 |
| 562 | 3300026078 | Ga0207702_10048496 | Ga0207702_100484962 | 323 |
| 563 | 3300026088 | Ga0207641_10261081 | Ga0207641_102610812 | 323 |
| 564 | 3300028794 | Ga0307515_10000003 | Ga0307515_10000003711 | 323 |
| 565 | 3300031507 | Ga0307509_10033604 | Ga0307509_100336045 | 323 |
| 566 | 3300031649 | Ga0307514_10095802 | Ga0307514_100958022 | 323 |
| 567 | 3300037312 | Ga0395899_0000027 | Ga0395899_0000027_121936_122967 | 323 |
| 568 | 3300037312 | Ga0395899_0019564 | Ga0395899_0019564_3047_4102 | 323 |
| 569 | 3300037418 | Ga0395900_0006443 | Ga0395900_0006443_8653_9708 | 323 |
| 570 | 3300037466 | Ga0395898_0257836 | Ga0395898_0257836_11_1066 | 323 |
| 571 | 3300037471 | Ga0395905_0000327 | Ga0395905_0000327_24770_25825 | 323 |
| 572 | 3300038443 | Ga0395901_0008911 | Ga0395901_0008911_112_1167 | 323 |
| 573 | 3300044706 | Ga0466964_0018561 | Ga0466964_0018561_843_1886 | 323 |
| 574 | 3300046507 | Ga0495606_0053202 | Ga0495606_0053202_1568_2611 | 323 |
| 575 | 3300046660 | Ga0495625_0058566 | Ga0495625_0058566_1581_2624 | 323 |
| 576 | 3300047472 | Ga0495686_0000679 | Ga0495686_0000679_41374_42417 | 323 |
| 577 | 3300048917 | Ga0496114_0001046 | Ga0496114_0001046_18524_19597 | 323 |
| 578 | 3300050493 | nmdc:mga0k408_1014_c1 | nmdc:mga0k408_1014_c1_3067_4098 | 323 |
| 579 | 3300050511 | nmdc:mga08y16_224727_c1 | nmdc:mga08y16_224727_c1_638_1681 | 323 |
| 580 | iso_pu_bacteria | 2522125168 | 2522549153 | 323 |
| 581 | iso_pu_bacteria | 2842903701 | 2842904794 | 323 |
| 582 | iso_pu_bacteria | 2890737413 | 2890738862 | 323 |
| 583 | iso_pu_bacteria | 2896317667 | 2896320619 | 323 |
| 584 | iso_pu_bacteria | 2898713307 | 2898714492 | 323 |
| 585 | iso_pu_bacteria | 8055588893 | 8055592073 | 323 |
| 586 | 3300005347 | Ga0070668_100320212 | Ga0070668_1003202121 | 324 |
| 587 | 3300005459 | Ga0068867_100023969 | Ga0068867_1000239695 | 324 |
| 588 | 3300005614 | Ga0068856_100592044 | Ga0068856_1005920441 | 324 |
| 589 | 3300005843 | Ga0068860_100089002 | Ga0068860_1000890023 | 324 |
| 590 | 3300009176 | Ga0105242_10093693 | Ga0105242_100936932 | 324 |
| 591 | 3300025899 | Ga0207642_10012112 | Ga0207642_100121122 | 324 |
| 592 | 3300025934 | Ga0207686_10092089 | Ga0207686_100920892 | 324 |
| 593 | 3300025942 | Ga0207689_10260325 | Ga0207689_102603252 | 324 |
| 594 | 3300026089 | Ga0207648_10007532 | Ga0207648_1000753210 | 324 |
| 595 | 3300028381 | Ga0268264_10039477 | Ga0268264_100394773 | 324 |
| 596 | 3300031251 | Ga0265327_10000256 | Ga0265327_1000025612 | 324 |
| 597 | 3300031251 | Ga0265327_10006644 | Ga0265327_1000664410 | 324 |
| 598 | 3300037471 | Ga0395905_0000001 | Ga0395905_0000001_1591917_1592963 | 324 |
| 599 | 3300042876 | Ga0451577_0073662 | Ga0451577_0073662_930_1961 | 324 |
| 600 | 3300045049 | Ga0466959_0130951 | Ga0466959_0130951_315_1361 | 324 |
| 601 | 3300049523 | Ga0501300_003387 | Ga0501300_003387_434_1480 | 324 |
| 602 | 3300049539 | Ga0501323_002692 | Ga0501323_002692_403_1449 | 324 |
| 603 | 3300053153 | Ga0500616_0000043 | Ga0500616_0000043_269510_270556 | 324 |
| 604 | 3300053153 | Ga0500616_0092155 | Ga0500616_0092155_46_1092 | 324 |
| 605 | iso_pu_bacteria | 2721755487 | 2722731092 | 324 |
| 606 | iso_pu_bacteria | 2896344016 | 2896345420 | 324 |
| 607 | iso_pu_bacteria | 2904780799 | 2904783378 | 324 |
| 608 | iso_pu_bacteria | 2919177583 | 2919181244 | 324 |
| 609 | iso_pu_bacteria | 3003233435 | 3003235838 | 324 |
| 610 | 3300003322 | rootL2_10282716 | rootL2_102827162 | 325 |
| 611 | 3300003781 | Ga0055536_1000006 | Ga0055536_100000674 | 325 |
| 612 | 3300003781 | Ga0055536_1007763 | Ga0055536_10077634 | 325 |
| 613 | 3300005262 | Ga0065165_1000601 | Ga0065165_100060153 | 325 |
| 614 | 3300005288 | Ga0065714_10092478 | Ga0065714_100924782 | 325 |
| 615 | 3300014497 | Ga0182008_10045280 | Ga0182008_100452802 | 325 |
| 616 | 3300014745 | Ga0157377_10063195 | Ga0157377_100631952 | 325 |
| 617 | 3300025292 | Ga0209676_1000485 | Ga0209676_100048556 | 325 |
| 618 | 3300032004 | Ga0307414_10000470 | Ga0307414_1000047014 | 325 |
| 619 | 3300032004 | Ga0307414_10110557 | Ga0307414_101105572 | 325 |
| 620 | 3300037471 | Ga0395905_0000051 | Ga0395905_0000051_165035_166093 | 325 |
| 621 | 3300037471 | Ga0395905_0126828 | Ga0395905_0126828_80_1159 | 325 |
| 622 | 3300038443 | Ga0395901_0094508 | Ga0395901_0094508_1489_2547 | 325 |
| 623 | 3300044712 | Ga0453684_0001733 | Ga0453684_0001733_28843_29874 | 325 |
| 624 | 3300045051 | Ga0451576_0049378 | Ga0451576_0049378_152_1183 | 325 |
| 625 | 3300046460 | Ga0495638_0000026 | Ga0495638_0000026_154644_155693 | 325 |
| 626 | 3300005335 | Ga0070666_10000019 | Ga0070666_10000019169 | 326 |
| 627 | 3300005347 | Ga0070668_100088574 | Ga0070668_1000885742 | 326 |
| 628 | 3300005355 | Ga0070671_100244093 | Ga0070671_1002440932 | 326 |
| 629 | 3300005364 | Ga0070673_100139309 | Ga0070673_1001393092 | 326 |
| 630 | 3300005366 | Ga0070659_100010826 | Ga0070659_10001082610 | 326 |
| 631 | 3300005456 | Ga0070678_100067946 | Ga0070678_1000679462 | 326 |
| 632 | 3300005563 | Ga0068855_100024523 | Ga0068855_1000245233 | 326 |
| 633 | 3300005614 | Ga0068856_100021650 | Ga0068856_1000216502 | 326 |
| 634 | 3300005616 | Ga0068852_100004192 | Ga0068852_1000041928 | 326 |
| 635 | 3300005617 | Ga0068859_100000013 | Ga0068859_100000013203 | 326 |
| 636 | 3300005834 | Ga0068851_10030248 | Ga0068851_100302483 | 326 |
| 637 | 3300005841 | Ga0068863_100010161 | Ga0068863_1000101616 | 326 |
| 638 | 3300005842 | Ga0068858_100001874 | Ga0068858_10000187418 | 326 |
| 639 | 3300005843 | Ga0068860_100001911 | Ga0068860_1000019114 | 326 |
| 640 | 3300006358 | Ga0068871_100276159 | Ga0068871_1002761592 | 326 |
| 641 | 3300006931 | Ga0097620_100000013 | Ga0097620_100000013203 | 326 |
| 642 | 3300009101 | Ga0105247_10013814 | Ga0105247_100138142 | 326 |
| 643 | 3300009174 | Ga0105241_10001659 | Ga0105241_100016598 | 326 |
| 644 | 3300009176 | Ga0105242_10027714 | Ga0105242_100277145 | 326 |
| 645 | 3300009545 | Ga0105237_10088785 | Ga0105237_100887852 | 326 |
| 646 | 3300009553 | Ga0105249_10008471 | Ga0105249_100084718 | 326 |
| 647 | 3300013306 | Ga0163162_10000595 | Ga0163162_1000059519 | 326 |
| 648 | 3300013307 | Ga0157372_10128863 | Ga0157372_101288633 | 326 |
| 649 | 3300013308 | Ga0157375_10069271 | Ga0157375_100692712 | 326 |
| 650 | 3300014325 | Ga0163163_10203143 | Ga0163163_102031431 | 326 |
| 651 | 3300014968 | Ga0157379_10151332 | Ga0157379_101513322 | 326 |
| 652 | 3300025321 | Ga0207656_10017235 | Ga0207656_100172352 | 326 |
| 653 | 3300025903 | Ga0207680_10000586 | Ga0207680_1000058614 | 326 |
| 654 | 3300025931 | Ga0207644_10148372 | Ga0207644_101483722 | 326 |
| 655 | 3300025932 | Ga0207690_10007668 | Ga0207690_100076681 | 326 |
| 656 | 3300025942 | Ga0207689_10104438 | Ga0207689_101044382 | 326 |
| 657 | 3300025949 | Ga0207667_10012457 | Ga0207667_100124573 | 326 |
| 658 | 3300025961 | Ga0207712_10003737 | Ga0207712_100037378 | 326 |
| 659 | 3300026035 | Ga0207703_10016677 | Ga0207703_100166773 | 326 |
| 660 | 3300026078 | Ga0207702_10131149 | Ga0207702_101311492 | 326 |
| 661 | 3300026088 | Ga0207641_10001077 | Ga0207641_1000107715 | 326 |
| 662 | 3300026142 | Ga0207698_10003879 | Ga0207698_100038797 | 326 |
| 663 | 3300028381 | Ga0268264_10002805 | Ga0268264_100028056 | 326 |
| 664 | 3300031251 | Ga0265327_10022548 | Ga0265327_100225482 | 326 |
| 665 | 3300031456 | Ga0307513_10116236 | Ga0307513_101162362 | 326 |
| 666 | 3300031548 | Ga0307408_100000464 | Ga0307408_10000046413 | 326 |
| 667 | 3300031548 | Ga0307408_100000560 | Ga0307408_1000005605 | 326 |
| 668 | 3300031548 | Ga0307408_100001326 | Ga0307408_10000132613 | 326 |
| 669 | 3300031911 | Ga0307412_10009485 | Ga0307412_100094853 | 326 |
| 670 | 3300032002 | Ga0307416_100151244 | Ga0307416_1001512442 | 326 |
| 671 | 3300042014 | Ga0439457_005817 | Ga0439457_005817_1450_2508 | 326 |
| 672 | 3300046512 | Ga0495610_0000129 | Ga0495610_0000129_72939_73994 | 326 |
| 673 | 3300049758 | Ga0501241_002609 | Ga0501241_002609_1425_2555 | 326 |
| 674 | 3300053151 | Ga0500604_0002355 | Ga0500604_0002355_3325_4380 | 326 |
| 675 | 3300053156 | Ga0500622_0000163 | Ga0500622_0000163_17209_18261 | 326 |
| 676 | 3300053156 | Ga0500622_0000895 | Ga0500622_0000895_7299_8351 | 326 |
| 677 | 3300001979 | JGI24740J21852_10022760 | JGI24740J21852_100227602 | 327 |
| 678 | 3300002737 | JGI25162J39368_1000118 | JGI25162J39368_10001184 | 327 |
| 679 | 3300005367 | Ga0070667_100131921 | Ga0070667_1001319212 | 327 |
| 680 | 3300005563 | Ga0068855_100054484 | Ga0068855_1000544842 | 327 |
| 681 | 3300005616 | Ga0068852_100029170 | Ga0068852_1000291704 | 327 |
| 682 | 3300005843 | Ga0068860_100013335 | Ga0068860_1000133357 | 327 |
| 683 | 3300005985 | Ga0081539_10124610 | Ga0081539_101246101 | 327 |
| 684 | 3300009093 | Ga0105240_10037888 | Ga0105240_100378885 | 327 |
| 685 | 3300009093 | Ga0105240_10060549 | Ga0105240_100605495 | 327 |
| 686 | 3300009545 | Ga0105237_10072090 | Ga0105237_100720904 | 327 |
| 687 | 3300010375 | Ga0105239_10017420 | Ga0105239_100174205 | 327 |
| 688 | 3300010375 | Ga0105239_10345862 | Ga0105239_103458622 | 327 |
| 689 | 3300013306 | Ga0163162_10001704 | Ga0163162_1000170410 | 327 |
| 690 | 3300013306 | Ga0163162_10039941 | Ga0163162_100399414 | 327 |
| 691 | 3300025233 | Ga0209437_100102 | Ga0209437_100102146 | 327 |
| 692 | 3300025913 | Ga0207695_10046352 | Ga0207695_100463523 | 327 |
| 693 | 3300025914 | Ga0207671_10006548 | Ga0207671_100065482 | 327 |
| 694 | 3300025914 | Ga0207671_10026732 | Ga0207671_100267321 | 327 |
| 695 | 3300025986 | Ga0207658_10141422 | Ga0207658_101414222 | 327 |
| 696 | 3300026142 | Ga0207698_10024975 | Ga0207698_100249756 | 327 |
| 697 | 3300030731 | Ga0316177_1209362 | Ga0316177_12093623 | 327 |
| 698 | 3300030732 | Ga0316176_1026201 | Ga0316176_10262016 | 327 |
| 699 | 3300030742 | Ga0316183_1106482 | Ga0316183_110648224 | 327 |
| 700 | 3300030744 | Ga0316181_1039179 | Ga0316181_10391794 | 327 |
| 701 | 3300030744 | Ga0316181_1249451 | Ga0316181_12494512 | 327 |
| 702 | 3300045051 | Ga0451576_0000002 | Ga0451576_0000002_77355_78410 | 327 |
| 703 | 3300046471 | Ga0495650_0000231 | Ga0495650_0000231_36779_37822 | 327 |
| 704 | 3300046492 | Ga0495585_0000037 | Ga0495585_0000037_41251_42294 | 327 |
| 705 | 3300046507 | Ga0495606_0019314 | Ga0495606_0019314_2458_3501 | 327 |
| 706 | 3300046512 | Ga0495610_0001948 | Ga0495610_0001948_585_1628 | 327 |
| 707 | 3300046558 | Ga0495633_0005148 | Ga0495633_0005148_6570_7613 | 327 |
| 708 | 3300046660 | Ga0495625_0000191 | Ga0495625_0000191_56700_57743 | 327 |
| 709 | 3300046665 | Ga0495661_0026655 | Ga0495661_0026655_1643_2686 | 327 |
| 710 | 3300046694 | Ga0495649_0000061 | Ga0495649_0000061_39621_40664 | 327 |
| 711 | 3300047443 | Ga0495687_022613 | Ga0495687_022613_1067_2110 | 327 |
| 712 | 3300047472 | Ga0495686_0045737 | Ga0495686_0045737_636_1679 | 327 |
| 713 | 3300048919 | Ga0496116_0003271 | Ga0496116_0003271_12669_13709 | 328 |
| 714 | 3300048920 | Ga0496117_0006620 | Ga0496117_0006620_468_1508 | 328 |
| 715 | 3300048925 | Ga0496122_0007262 | Ga0496122_0007262_1565_2605 | 328 |
| 716 | 3300048925 | Ga0496122_0177638 | Ga0496122_0177638_27_1070 | 328 |
| 717 | 3300048926 | Ga0496123_0051104 | Ga0496123_0051104_1551_2594 | 328 |
| 718 | 3300049581 | Ga0501047_0023531 | Ga0501047_0023531_4113_5168 | 328 |
| 719 | 3300049663 | Ga0501223_000488 | Ga0501223_000488_2027_3076 | 328 |
| 720 | 2162886007 | SwRhRL2b_contig_3345962 | SwRhRL2b_0557.00004740 | 329 |
| 721 | 3300005289 | Ga0065704_10004114 | Ga0065704_100041146 | 329 |
| 722 | 3300009148 | Ga0105243_10000003 | Ga0105243_1000000360 | 329 |
| 723 | 3300025935 | Ga0207709_10000008 | Ga0207709_10000008514 | 329 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8e9h-assembly1.cif.gz_H | mycobacterial respiratory complex i, fully-inserted quinone | 0.8298 | 9 | 326 |
| 6l7o-assembly1.cif.gz_A | cryo-em structure of cyanobacteria fd-ndh-1l complex | 0.8118 | 15 | 321 |
| 8e9h-assembly1.cif.gz_H | mycobacterial respiratory complex i, fully-inserted quinone | 0.8017 | 9 | 326 |
| 7f9o-assembly1.cif.gz_G | psi-ndh supercomplex of barley | 0.8015 | 15 | 321 |
| 5xtc-assembly1.cif.gz_s | cryo-em structure of human respiratory complex i transmembrane arm | 0.793 | 13 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5ic0A02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.4432 | 76 | 164 | 1.20.120.230 |
| 2x0cA02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like | 0.4393 | 73 | 171 | 1.20.120.230 |
| af_A0A0R4ICV1_14_295_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3692 | 53 | 329 | 1.20.1070.10 |
| af_Q9BPV8_31_335_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3691 | 53 | 328 | 1.20.1070.10 |
| af_K7LDZ9_70_274_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.3372 | 76 | 246 | 1.20.1070.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538STI4-F1-model_v4 | NADH-quinone oxidoreductase subunit J (EC 7.1.1.-) | 0.9823 | 78 | 207 |
GO:0003954
GO:0005886 GO:0008137 GO:0009060 GO:0048038 |
| AF-A0A2V8A2L9-F1-model_v4 | NADH-quinone oxidoreductase subunit H | 0.9418 | 57 | 165 |
GO:0003954
GO:0005886 GO:0009060 |
| AF-A0A6N9C8V2-F1-model_v4 | NADH-quinone oxidoreductase subunit H | 0.911 | 5 | 182 |
GO:0003954
GO:0005886 GO:0009060 |
| AF-A0A661IBR2-F1-model_v4 | NADH-quinone oxidoreductase subunit H | 0.9091 | 1 | 182 |
GO:0003954
GO:0005886 GO:0009060 |
| AF-A0A382CZ91-F1-model_v4 | NADH-quinone oxidoreductase subunit H | 0.9077 | 6 | 202 |
GO:0003954
GO:0009060 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar