F477541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 724 | 506 | 529 | 297 |
Family's Representative Sequence
| Representative Sequence | 3300003215|JGI25153J46596_10009092|JGI25153J46596_100090922 |
| Length | 312 |
| Sequence | MSLVATLICNPDNPALDTTIVDGARTVLPQALPAHWLFDGVAVDIPFGADSNLEGDRHAIEQRLRELRGDLPIDIVVQPVGFRRKKLFLADMDSTMIGQECIDELADFAGLKAHVAAITERAMRGEIEFEPALRERVALLKDLPASATMRAHGAYTCLVSGGFTLFTTAVAARIGFQENRANXLVVRDGKFTGEVKXPILGRAAKXATLVDLMESFDLDDIDSVVVGDGANDLAMIQAAGLGVAXHAKPAVAAAAAARIDHGDLTALLYAQGYRRDEFVEXXLIRRSGVVRSTRPGTSRFRVRCFASPRNDG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 7 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 8 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 13 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 14 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 15 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 16 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 17 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 18 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 19 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 20 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 21 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 22 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 23 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 24 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 25 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 26 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 27 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 28 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 29 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 30 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 31 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 32 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 33 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 34 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 35 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 36 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 37 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 38 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 39 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 40 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 41 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 42 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 43 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 44 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 45 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 46 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 47 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 48 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 49 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 50 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 51 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 52 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 53 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 54 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 55 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 56 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 57 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 58 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 59 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 60 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 61 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 62 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 63 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 64 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 65 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 66 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 67 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 68 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 69 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 70 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 71 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 72 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 73 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 74 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 75 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 76 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 77 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 78 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 79 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 80 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 81 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 82 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 83 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 84 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 85 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 86 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 87 | 2906610324 | |||
| 88 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 89 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 90 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 91 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 92 | 2919450847 | Ancylobacter sp. 3268 | Isolate | Rhizosphere |
| 93 | 2922368715 | |||
| 94 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 95 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 96 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 97 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 98 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 99 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 100 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 101 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 102 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 103 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 104 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 105 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 106 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 107 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 108 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 109 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 110 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 111 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 112 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 113 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 114 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 115 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 116 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 117 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 118 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 119 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 120 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 121 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 122 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 123 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 124 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 125 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 126 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 127 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 128 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 129 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 130 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 131 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 132 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 133 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 134 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 135 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 136 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 137 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 138 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 139 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 140 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 141 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 142 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 143 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 144 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 145 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 146 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 147 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 148 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 149 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 150 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 151 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 152 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 153 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 154 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 155 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 156 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 157 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 158 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 159 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 160 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 161 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 162 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 163 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 164 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 165 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 166 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 167 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 168 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 169 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 170 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 171 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 172 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 173 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 174 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 175 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 176 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 177 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 179 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 183 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 185 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 186 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 187 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 188 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 189 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 190 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 191 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 192 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 193 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 194 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 195 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 196 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 197 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 198 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 199 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 200 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 201 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 203 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 204 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 205 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 206 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 207 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 208 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 209 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 210 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 211 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 212 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 213 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 214 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 215 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 216 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 217 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 218 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 219 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 220 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 221 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 222 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 223 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 224 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 225 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 226 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 227 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 228 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 229 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 230 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 231 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 232 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 233 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 234 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 235 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 236 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 237 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 243 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 245 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 246 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 247 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 248 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 276 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 278 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 279 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 280 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 281 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 282 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 283 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 284 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 285 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 286 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 287 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 288 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 289 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 290 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 291 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 292 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 293 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 294 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 295 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 296 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 297 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 298 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 299 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 300 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 301 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 302 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 303 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 304 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 305 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 306 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 307 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 308 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 309 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 310 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 311 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 312 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 313 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 314 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 315 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 316 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 317 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 318 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 319 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 320 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 321 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 322 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 323 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 324 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 325 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 326 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 327 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 328 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 329 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 330 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 331 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 384 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 385 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 386 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 387 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 388 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 389 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 391 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 392 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 393 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 394 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 395 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 396 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 397 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 398 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 399 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 400 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 401 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 402 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 403 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 404 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 405 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 412 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 414 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 417 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 418 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 420 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 421 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 422 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 423 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 424 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 425 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 426 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 427 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 428 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 429 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 430 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 431 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 432 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 433 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 434 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 435 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 436 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 437 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 438 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 439 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 440 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 441 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 442 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 443 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 444 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 445 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 446 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 447 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 448 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 449 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 450 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 451 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 452 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 453 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 454 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 455 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 456 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 457 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 458 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 459 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 460 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 461 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 462 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 463 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 464 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 465 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 466 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 467 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 468 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 470 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 471 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 472 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 473 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 474 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 475 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 476 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 477 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 478 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 479 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 480 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 481 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 482 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 483 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 484 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 485 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 486 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 487 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 488 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 489 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 490 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 491 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 492 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 493 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 494 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 495 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 496 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 497 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 498 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 499 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 500 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 501 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 502 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 503 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 504 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 505 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 506 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.13 |
| Metatranscriptomes | 0.14 |
| Isolates | 26.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.54 |
| Nodule | 21.69 |
| Rhizoplane | 4.42 |
| Rhizosphere | 40.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1004656 | 3300003214 | Bacteria | 2869 |
| 2 | JGI25153J46596_10004824 | 3300003215 | Bacteria | 7183 |
| 3 | JGI25153J46596_10009092 | 3300003215 | Bacteria | 4665 |
| 4 | JGI25153J46596_10027971 | 3300003215 | Bacteria | 1964 |
| 5 | JGI25153J46596_10028501 | 3300003215 | Bacteria | 1934 |
| 6 | JGI25160J50197_1009693 | 3300003354 | Bacteria | 3547 |
| 7 | JGI25404J52841_10001584 | 3300003659 | Bacteria | 4055 |
| 8 | Ga0055539_1003188 | 3300003752 | Bacteria | 2334 |
| 9 | Ga0055526_1028525 | 3300003771 | Bacteria | 1686 |
| 10 | Ga0055526_1029585 | 3300003771 | Bacteria | 1622 |
| 11 | Ga0055531_10003265 | 3300003794 | Bacteria | 10406 |
| 12 | Ga0055543_1003054 | 3300004625 | Bacteria | 5152 |
| 13 | Ga0055543_1016904 | 3300004625 | Bacteria | 1380 |
| 14 | Ga0065165_1002837 | 3300005262 | Bacteria | 13516 |
| 15 | Ga0065165_1005269 | 3300005262 | Bacteria | 7376 |
| 16 | Ga0065165_1007564 | 3300005262 | Bacteria | 5300 |
| 17 | Ga0070658_10019082 | 3300005327 | Bacteria | 5493 |
| 18 | Ga0070658_10045152 | 3300005327 | Bacteria | 3562 |
| 19 | Ga0070683_100125277 | 3300005329 | Bacteria | 2429 |
| 20 | Ga0068868_100017680 | 3300005338 | Bacteria | 5316 |
| 21 | Ga0070661_100065700 | 3300005344 | Bacteria | 2665 |
| 22 | Ga0070668_100077330 | 3300005347 | Bacteria | 2601 |
| 23 | Ga0070668_100123936 | 3300005347 | Bacteria | 2068 |
| 24 | Ga0070669_100270897 | 3300005353 | Bacteria | 1357 |
| 25 | Ga0070671_100052057 | 3300005355 | Bacteria | 3405 |
| 26 | Ga0070667_100053721 | 3300005367 | Bacteria | 3400 |
| 27 | Ga0070667_100135306 | 3300005367 | Bacteria | 2155 |
| 28 | Ga0070709_10001764 | 3300005434 | Bacteria | 11754 |
| 29 | Ga0070709_10028569 | 3300005434 | Bacteria | 3328 |
| 30 | Ga0070714_100010698 | 3300005435 | Bacteria | 7261 |
| 31 | Ga0070714_100185760 | 3300005435 | Bacteria | 1894 |
| 32 | Ga0070710_10001695 | 3300005437 | Bacteria | 10382 |
| 33 | Ga0070710_10021064 | 3300005437 | Bacteria | 3393 |
| 34 | Ga0070711_100002420 | 3300005439 | Bacteria | 10634 |
| 35 | Ga0070711_100137513 | 3300005439 | Bacteria | 1828 |
| 36 | Ga0070663_100050838 | 3300005455 | Bacteria | 2950 |
| 37 | Ga0070663_100056464 | 3300005455 | Bacteria | 2813 |
| 38 | Ga0070663_100106968 | 3300005455 | Bacteria | 2096 |
| 39 | Ga0070679_100069331 | 3300005530 | Bacteria | 3517 |
| 40 | Ga0070684_100038257 | 3300005535 | Bacteria | 4119 |
| 41 | Ga0070684_100559520 | 3300005535 | Bacteria | 1062 |
| 42 | Ga0068853_100047394 | 3300005539 | Bacteria | 3687 |
| 43 | Ga0070665_100256281 | 3300005548 | Bacteria | 1750 |
| 44 | Ga0068855_100097468 | 3300005563 | Bacteria | 3387 |
| 45 | Ga0068857_100019266 | 3300005577 | Bacteria | 5991 |
| 46 | Ga0068854_100313128 | 3300005578 | Bacteria | 1273 |
| 47 | Ga0068856_100002538 | 3300005614 | Bacteria | 18824 |
| 48 | Ga0068864_100322688 | 3300005618 | Bacteria | 1451 |
| 49 | Ga0068851_10161030 | 3300005834 | Bacteria | 1233 |
| 50 | Ga0068862_100493908 | 3300005844 | Bacteria | 1160 |
| 51 | Ga0081455_10003699 | 3300005937 | Bacteria | 17509 |
| 52 | Ga0081540_1003091 | 3300005983 | Bacteria | 13334 |
| 53 | Ga0081540_1010356 | 3300005983 | Bacteria | 6324 |
| 54 | Ga0081539_10001829 | 3300005985 | Bacteria | 33573 |
| 55 | Ga0070717_10029907 | 3300006028 | Bacteria | 4375 |
| 56 | Ga0075365_10088253 | 3300006038 | Bacteria | 2110 |
| 57 | Ga0075365_10119922 | 3300006038 | Bacteria | 1814 |
| 58 | Ga0075368_10034252 | 3300006042 | Bacteria | 1978 |
| 59 | Ga0075368_10056296 | 3300006042 | Bacteria | 1569 |
| 60 | Ga0075363_100045805 | 3300006048 | Bacteria | 2320 |
| 61 | Ga0075364_10062781 | 3300006051 | Bacteria | 2438 |
| 62 | Ga0070712_100007513 | 3300006175 | Bacteria | 6810 |
| 63 | Ga0075367_10098451 | 3300006178 | Bacteria | 1785 |
| 64 | Ga0075367_10152756 | 3300006178 | Bacteria | 1433 |
| 65 | Ga0075369_10010725 | 3300006186 | Bacteria | 3590 |
| 66 | Ga0075369_10059516 | 3300006186 | Bacteria | 1664 |
| 67 | Ga0075366_10034561 | 3300006195 | Bacteria | 2977 |
| 68 | Ga0075366_10197329 | 3300006195 | Bacteria | 1223 |
| 69 | Ga0075370_10069024 | 3300006353 | Bacteria | 2019 |
| 70 | Ga0075370_10251434 | 3300006353 | Bacteria | 1048 |
| 71 | Ga0068871_100080011 | 3300006358 | Bacteria | 2705 |
| 72 | Ga0099825_1020431 | 3300006941 | Bacteria | 4708 |
| 73 | Ga0099824_1025695 | 3300006942 | Bacteria | 3173 |
| 74 | Ga0099823_1063709 | 3300006944 | Bacteria | 1833 |
| 75 | Ga0099794_10046066 | 3300007265 | Bacteria | 2088 |
| 76 | Ga0105240_10014565 | 3300009093 | Bacteria | 10730 |
| 77 | Ga0105240_10076395 | 3300009093 | Bacteria | 4129 |
| 78 | Ga0105245_10074811 | 3300009098 | Bacteria | 3083 |
| 79 | Ga0105247_10099619 | 3300009101 | Bacteria | 1856 |
| 80 | Ga0105247_10105343 | 3300009101 | Bacteria | 1808 |
| 81 | Ga0105248_10366124 | 3300009177 | Bacteria | 1623 |
| 82 | Ga0105237_10004158 | 3300009545 | Bacteria | 16863 |
| 83 | Ga0105237_10005728 | 3300009545 | Bacteria | 13958 |
| 84 | Ga0105237_10030097 | 3300009545 | Bacteria | 5516 |
| 85 | Ga0105237_10127376 | 3300009545 | Bacteria | 2540 |
| 86 | Ga0105239_10018834 | 3300010375 | Bacteria | 7627 |
| 87 | Ga0105239_10097833 | 3300010375 | Bacteria | 3243 |
| 88 | Ga0105239_10213909 | 3300010375 | Bacteria | 2161 |
| 89 | Ga0105239_10635401 | 3300010375 | Bacteria | 1219 |
| 90 | Ga0157370_10099074 | 3300013104 | Bacteria | 2732 |
| 91 | Ga0157369_10005591 | 3300013105 | Bacteria | 14600 |
| 92 | Ga0157372_10055869 | 3300013307 | Bacteria | 4410 |
| 93 | Ga0157379_10275067 | 3300014968 | Bacteria | 1532 |
| 94 | Ga0157379_10289882 | 3300014968 | Bacteria | 1490 |
| 95 | Ga0157376_10175757 | 3300014969 | Bacteria | 1953 |
| 96 | Ga0157376_10495090 | 3300014969 | Bacteria | 1200 |
| 97 | Ga0206353_10981988 | 3300020082 | Bacteria | 2126 |
| 98 | Ga0214544_1000026 | 3300021320 | Bacteria | 161530 |
| 99 | Ga0214542_1000025 | 3300021321 | Bacteria | 183588 |
| 100 | Ga0214542_1030681 | 3300021321 | Bacteria | 2069 |
| 101 | Ga0214545_1000014 | 3300021324 | Bacteria | 183588 |
| 102 | Ga0214545_1025563 | 3300021324 | Bacteria | 3384 |
| 103 | Ga0214543_1000034 | 3300021327 | Bacteria | 183712 |
| 104 | Ga0213873_10010925 | 3300021358 | Bacteria | 1928 |
| 105 | Ga0213874_10006183 | 3300021377 | Bacteria | 2825 |
| 106 | Ga0213876_10003720 | 3300021384 | Bacteria | 8646 |
| 107 | Ga0213876_10069659 | 3300021384 | Bacteria | 1858 |
| 108 | Ga0213871_10016702 | 3300021441 | Bacteria | 1773 |
| 109 | Ga0207425_1008458 | 3300025245 | Bacteria | 2630 |
| 110 | Ga0209677_101109 | 3300025253 | Bacteria | 12646 |
| 111 | Ga0209148_1000250 | 3300025254 | Bacteria | 85755 |
| 112 | Ga0209233_1001802 | 3300025261 | Bacteria | 8254 |
| 113 | Ga0209455_1002768 | 3300025272 | Bacteria | 6563 |
| 114 | Ga0209455_1018947 | 3300025272 | Bacteria | 1401 |
| 115 | Ga0209130_1027315 | 3300025284 | Bacteria | 1214 |
| 116 | Ga0209564_1004750 | 3300025295 | Bacteria | 8125 |
| 117 | Ga0209564_1009379 | 3300025295 | Bacteria | 4669 |
| 118 | Ga0209564_1019544 | 3300025295 | Bacteria | 2525 |
| 119 | Ga0209758_1000141 | 3300025297 | Bacteria | 172481 |
| 120 | Ga0209758_1000324 | 3300025297 | Bacteria | 91475 |
| 121 | Ga0209758_1000476 | 3300025297 | Bacteria | 66180 |
| 122 | Ga0209758_1001389 | 3300025297 | Bacteria | 28787 |
| 123 | Ga0209758_1003697 | 3300025297 | Bacteria | 13574 |
| 124 | Ga0209758_1005554 | 3300025297 | Bacteria | 9612 |
| 125 | Ga0209256_1017836 | 3300025299 | Bacteria | 2337 |
| 126 | Ga0207426_1000523 | 3300025302 | Bacteria | 55736 |
| 127 | Ga0207426_1003307 | 3300025302 | Bacteria | 8962 |
| 128 | Ga0207426_1030127 | 3300025302 | Bacteria | 1782 |
| 129 | Ga0209051_1027196 | 3300025303 | Bacteria | 2284 |
| 130 | Ga0209257_1004661 | 3300025304 | Bacteria | 10331 |
| 131 | Ga0209257_1066684 | 3300025304 | Bacteria | 962 |
| 132 | Ga0207692_10022479 | 3300025898 | Bacteria | 2902 |
| 133 | Ga0207692_10025688 | 3300025898 | Bacteria | 2755 |
| 134 | Ga0207710_10030302 | 3300025900 | Bacteria | 2359 |
| 135 | Ga0207710_10040333 | 3300025900 | Bacteria | 2069 |
| 136 | Ga0207647_10016859 | 3300025904 | Bacteria | 4976 |
| 137 | Ga0207685_10026572 | 3300025905 | Bacteria | 2015 |
| 138 | Ga0207699_10000553 | 3300025906 | Bacteria | 18426 |
| 139 | Ga0207699_10036291 | 3300025906 | Bacteria | 2809 |
| 140 | Ga0207643_10181157 | 3300025908 | Bacteria | 1275 |
| 141 | Ga0207707_10000455 | 3300025912 | Bacteria | 42610 |
| 142 | Ga0207695_10000062 | 3300025913 | Bacteria | 351979 |
| 143 | Ga0207695_10082713 | 3300025913 | Bacteria | 3245 |
| 144 | Ga0207671_10007674 | 3300025914 | Bacteria | 9317 |
| 145 | Ga0207671_10033635 | 3300025914 | Bacteria | 3812 |
| 146 | Ga0207671_10040071 | 3300025914 | Bacteria | 3468 |
| 147 | Ga0207693_10001851 | 3300025915 | Bacteria | 18534 |
| 148 | Ga0207663_10004445 | 3300025916 | Bacteria | 6973 |
| 149 | Ga0207660_10005365 | 3300025917 | Bacteria | 8325 |
| 150 | Ga0207652_10001894 | 3300025921 | Bacteria | 18100 |
| 151 | Ga0207681_10154110 | 3300025923 | Bacteria | 1725 |
| 152 | Ga0207694_10010392 | 3300025924 | Bacteria | 7017 |
| 153 | Ga0207694_10203725 | 3300025924 | Bacteria | 1610 |
| 154 | Ga0207687_10173417 | 3300025927 | Bacteria | 1665 |
| 155 | Ga0207700_10043051 | 3300025928 | Bacteria | 3314 |
| 156 | Ga0207690_10403284 | 3300025932 | Bacteria | 1091 |
| 157 | Ga0207706_10069001 | 3300025933 | Bacteria | 3109 |
| 158 | Ga0207665_10008007 | 3300025939 | Bacteria | 6972 |
| 159 | Ga0207665_10272997 | 3300025939 | Bacteria | 1256 |
| 160 | Ga0207711_10424692 | 3300025941 | Bacteria | 1236 |
| 161 | Ga0207661_10081797 | 3300025944 | Bacteria | 2668 |
| 162 | Ga0207677_10069033 | 3300026023 | Bacteria | 2484 |
| 163 | Ga0207703_10061959 | 3300026035 | Bacteria | 3064 |
| 164 | Ga0207678_10052416 | 3300026067 | Bacteria | 3520 |
| 165 | Ga0207678_10061509 | 3300026067 | Bacteria | 3230 |
| 166 | Ga0207678_10074772 | 3300026067 | Bacteria | 2903 |
| 167 | Ga0207702_10000041 | 3300026078 | Bacteria | 150754 |
| 168 | Ga0207676_10157951 | 3300026095 | Bacteria | 1961 |
| 169 | Ga0207674_10020652 | 3300026116 | Bacteria | 7112 |
| 170 | Ga0207683_10359372 | 3300026121 | Bacteria | 1337 |
| 171 | Ga0207698_10032705 | 3300026142 | Bacteria | 3771 |
| 172 | Ga0209389_1000004 | 3300027296 | Bacteria | 263759 |
| 173 | Ga0209389_1000023 | 3300027296 | Bacteria | 150730 |
| 174 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 175 | Ga0209589_1000010 | 3300027357 | Bacteria | 237657 |
| 176 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 177 | Ga0209489_100011 | 3300027361 | Bacteria | 244710 |
| 178 | Ga0209489_110994 | 3300027361 | Bacteria | 9645 |
| 179 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 180 | Ga0209700_100013 | 3300027363 | Bacteria | 341906 |
| 181 | Ga0209813_10000927 | 3300027866 | Bacteria | 6587 |
| 182 | Ga0209813_10025239 | 3300027866 | Bacteria | 1707 |
| 183 | Ga0268266_10050511 | 3300028379 | Bacteria | 3568 |
| 184 | Ga0268264_10000093 | 3300028381 | Bacteria | 232057 |
| 185 | Ga0307515_10104177 | 3300028794 | Bacteria | 3393 |
| 186 | Ga0265338_10264055 | 3300028800 | Bacteria | 1264 |
| 187 | Ga0307511_10075177 | 3300030521 | Bacteria | 2427 |
| 188 | Ga0265325_10006666 | 3300031241 | Bacteria | 6986 |
| 189 | Ga0265340_10000952 | 3300031247 | Bacteria | 16474 |
| 190 | Ga0265339_10008913 | 3300031249 | Bacteria | 6348 |
| 191 | Ga0265316_10008327 | 3300031344 | Bacteria | 9627 |
| 192 | Ga0265313_10001147 | 3300031595 | Bacteria | 25315 |
| 193 | Ga0307508_10000034 | 3300031616 | Bacteria | 160115 |
| 194 | Ga0265314_10004394 | 3300031711 | Bacteria | 13098 |
| 195 | Ga0265314_10093213 | 3300031711 | Bacteria | 1956 |
| 196 | Ga0265342_10005336 | 3300031712 | Bacteria | 9833 |
| 197 | Ga0265342_10168281 | 3300031712 | Bacteria | 1208 |
| 198 | Ga0307510_10071474 | 3300033180 | Bacteria | 3455 |
| 199 | Ga0307510_10074167 | 3300033180 | Bacteria | 3364 |
| 200 | Ga0307510_10121889 | 3300033180 | Bacteria | 2309 |
| 201 | Ga0307510_10169646 | 3300033180 | Bacteria | 1763 |
| 202 | Ga0373950_0010582 | 3300034818 | Bacteria | 1493 |
| 203 | Ga0373926_0046657 | 3300035083 | Bacteria | 1555 |
| 204 | Ga0373923_0047140 | 3300035111 | Bacteria | 1795 |
| 205 | Ga0373953_0014080 | 3300035117 | Bacteria | 2869 |
| 206 | Ga0373954_0033846 | 3300035118 | Bacteria | 2364 |
| 207 | Ga0373954_0036855 | 3300035118 | Bacteria | 2271 |
| 208 | Ga0373956_0007755 | 3300035119 | Bacteria | 4329 |
| 209 | Ga0373957_0000736 | 3300035120 | Bacteria | 8502 |
| 210 | Ga0373955_0095837 | 3300035172 | Bacteria | 1697 |
| 211 | Ga0373924_0013953 | 3300035410 | Bacteria | 3027 |
| 212 | Ga0373935_0024123 | 3300035692 | Bacteria | 3741 |
| 213 | Ga0373927_0030875 | 3300035695 | Bacteria | 3495 |
| 214 | Ga0373947_0061286 | 3300035725 | Bacteria | 2286 |
| 215 | Ga0373925_0174005 | 3300037068 | Bacteria | 1701 |
| 216 | Ga0373925_0375315 | 3300037068 | Bacteria | 1157 |
| 217 | Ga0395900_0063174 | 3300037418 | Bacteria | 3806 |
| 218 | Ga0395900_0126981 | 3300037418 | Bacteria | 2616 |
| 219 | Ga0395905_0010894 | 3300037471 | Bacteria | 8805 |
| 220 | Ga0395905_0025659 | 3300037471 | Bacteria | 5557 |
| 221 | Ga0436364_1394155 | 3300037853 | Bacteria | 3739 |
| 222 | Ga0436365_0062390 | 3300039437 | Bacteria | 1829 |
| 223 | Ga0436365_0207937 | 3300039437 | Bacteria | 18457 |
| 224 | Ga0436365_1143724 | 3300039437 | Bacteria | 2586 |
| 225 | Ga0436365_1558193 | 3300039437 | Bacteria | 1308 |
| 226 | Ga0436361_0282868 | 3300039447 | Bacteria | 3368 |
| 227 | Ga0436361_0864922 | 3300039447 | Bacteria | 3169 |
| 228 | Ga0436361_0985631 | 3300039447 | Bacteria | 4268 |
| 229 | Ga0436363_0144469 | 3300039450 | Bacteria | 8876 |
| 230 | Ga0436362_0722869 | 3300039453 | Bacteria | 1590 |
| 231 | Ga0436362_0880762 | 3300039453 | Bacteria | 6633 |
| 232 | Ga0451841_0644879 | 3300041498 | Bacteria | 1543 |
| 233 | Ga0439455_0032503 | 3300042012 | Bacteria | 1305 |
| 234 | Ga0466969_0014623 | 3300044656 | Bacteria | 4127 |
| 235 | Ga0466969_0116841 | 3300044656 | Bacteria | 1244 |
| 236 | Ga0466969_0133445 | 3300044656 | Bacteria | 1150 |
| 237 | Ga0466972_0000884 | 3300044658 | Bacteria | 14415 |
| 238 | Ga0466965_0028587 | 3300044683 | Bacteria | 2709 |
| 239 | Ga0466966_0000419 | 3300044684 | Bacteria | 27305 |
| 240 | Ga0466966_0155124 | 3300044684 | Bacteria | 1395 |
| 241 | Ga0466961_0000020 | 3300044693 | Bacteria | 107610 |
| 242 | Ga0466963_0021740 | 3300044694 | Bacteria | 4051 |
| 243 | Ga0466968_0008072 | 3300044735 | Bacteria | 4025 |
| 244 | Ga0466968_0036874 | 3300044735 | Bacteria | 2049 |
| 245 | Ga0466957_0065416 | 3300044842 | Bacteria | 2239 |
| 246 | Ga0466960_0009778 | 3300044901 | Bacteria | 3966 |
| 247 | Ga0466959_0015465 | 3300045049 | Bacteria | 5560 |
| 248 | Ga0466958_0111198 | 3300045836 | Bacteria | 1710 |
| 249 | Ga0466967_0035765 | 3300045976 | Bacteria | 4232 |
| 250 | Ga0495592_0032248 | 3300046454 | Bacteria | 3954 |
| 251 | Ga0495592_0033017 | 3300046454 | Bacteria | 3905 |
| 252 | Ga0495592_0062498 | 3300046454 | Bacteria | 2734 |
| 253 | Ga0495592_0074237 | 3300046454 | Bacteria | 2471 |
| 254 | Ga0495603_0011576 | 3300046455 | Bacteria | 5336 |
| 255 | Ga0495629_0001285 | 3300046459 | Bacteria | 19732 |
| 256 | Ga0495629_0005714 | 3300046459 | Bacteria | 9286 |
| 257 | Ga0495638_0004256 | 3300046460 | Bacteria | 10894 |
| 258 | Ga0495638_0051379 | 3300046460 | Bacteria | 2570 |
| 259 | Ga0495651_0002943 | 3300046462 | Bacteria | 13173 |
| 260 | Ga0495651_0045396 | 3300046462 | Bacteria | 3404 |
| 261 | Ga0495653_0003792 | 3300046463 | Bacteria | 12222 |
| 262 | Ga0495653_0160928 | 3300046463 | Bacteria | 1558 |
| 263 | Ga0495639_0020450 | 3300046475 | Bacteria | 2893 |
| 264 | Ga0495664_0029166 | 3300046477 | Bacteria | 3225 |
| 265 | Ga0495594_0054357 | 3300046499 | Bacteria | 2207 |
| 266 | Ga0495583_0086990 | 3300046506 | Bacteria | 1351 |
| 267 | Ga0495606_0018195 | 3300046507 | Bacteria | 5279 |
| 268 | Ga0495608_0025820 | 3300046511 | Bacteria | 4009 |
| 269 | Ga0495608_0034226 | 3300046511 | Bacteria | 3430 |
| 270 | Ga0495608_0070527 | 3300046511 | Bacteria | 2280 |
| 271 | Ga0495610_0063678 | 3300046512 | Bacteria | 1745 |
| 272 | Ga0495610_0084059 | 3300046512 | Bacteria | 1455 |
| 273 | Ga0495628_0225902 | 3300046516 | Bacteria | 1404 |
| 274 | Ga0495632_0070855 | 3300046519 | Bacteria | 1676 |
| 275 | Ga0495643_0017154 | 3300046522 | Bacteria | 4239 |
| 276 | Ga0495648_0003170 | 3300046524 | Bacteria | 14641 |
| 277 | Ga0495652_0003125 | 3300046529 | Bacteria | 16545 |
| 278 | Ga0495640_0006193 | 3300046533 | Bacteria | 9475 |
| 279 | Ga0495640_0013630 | 3300046533 | Bacteria | 6179 |
| 280 | Ga0495640_0077352 | 3300046533 | Bacteria | 2218 |
| 281 | Ga0495587_0040557 | 3300046536 | Bacteria | 2782 |
| 282 | Ga0495587_0138874 | 3300046536 | Bacteria | 1387 |
| 283 | Ga0495609_0042687 | 3300046538 | Bacteria | 2037 |
| 284 | Ga0495645_0030962 | 3300046543 | Bacteria | 3897 |
| 285 | Ga0495645_0291132 | 3300046543 | Bacteria | 1070 |
| 286 | Ga0495622_0003529 | 3300046557 | Bacteria | 7358 |
| 287 | Ga0495622_0022704 | 3300046557 | Bacteria | 2923 |
| 288 | Ga0495667_0006907 | 3300046559 | Bacteria | 7698 |
| 289 | Ga0495667_0129442 | 3300046559 | Bacteria | 1628 |
| 290 | Ga0495667_0136629 | 3300046559 | Bacteria | 1580 |
| 291 | Ga0495668_0131622 | 3300046616 | Bacteria | 1369 |
| 292 | Ga0495668_0199454 | 3300046616 | Bacteria | 1096 |
| 293 | Ga0495634_0027819 | 3300046642 | Bacteria | 3931 |
| 294 | Ga0495634_0030692 | 3300046642 | Bacteria | 3709 |
| 295 | Ga0495611_0032459 | 3300046648 | Bacteria | 2301 |
| 296 | Ga0495611_0064116 | 3300046648 | Bacteria | 1673 |
| 297 | Ga0495625_0026834 | 3300046660 | Bacteria | 4344 |
| 298 | Ga0495635_0002149 | 3300046663 | Bacteria | 13377 |
| 299 | Ga0495635_0002910 | 3300046663 | Bacteria | 11762 |
| 300 | Ga0495635_0077127 | 3300046663 | Bacteria | 2283 |
| 301 | Ga0495588_0008982 | 3300046674 | Bacteria | 4603 |
| 302 | Ga0495657_0002869 | 3300046675 | Bacteria | 14315 |
| 303 | Ga0495657_0025540 | 3300046675 | Bacteria | 4193 |
| 304 | Ga0495599_0049823 | 3300046678 | Bacteria | 2625 |
| 305 | Ga0495623_0065880 | 3300046679 | Bacteria | 2264 |
| 306 | Ga0495623_0186665 | 3300046679 | Bacteria | 1200 |
| 307 | Ga0495646_0091179 | 3300046680 | Bacteria | 1759 |
| 308 | Ga0495646_0133506 | 3300046680 | Bacteria | 1395 |
| 309 | Ga0495646_0149256 | 3300046680 | Bacteria | 1301 |
| 310 | Ga0495613_0117094 | 3300046689 | Bacteria | 1916 |
| 311 | Ga0495613_0354177 | 3300046689 | Bacteria | 1008 |
| 312 | Ga0495670_0022409 | 3300046691 | Bacteria | 3118 |
| 313 | Ga0495649_0040585 | 3300046694 | Bacteria | 2547 |
| 314 | Ga0495600_0004830 | 3300046809 | Bacteria | 8093 |
| 315 | Ga0495600_0059270 | 3300046809 | Bacteria | 2500 |
| 316 | Ga0495604_0007695 | 3300047317 | Bacteria | 8534 |
| 317 | Ga0495604_0007712 | 3300047317 | Bacteria | 8528 |
| 318 | Ga0495604_0089021 | 3300047317 | Bacteria | 2295 |
| 319 | Ga0495674_0044542 | 3300047319 | Bacteria | 3945 |
| 320 | Ga0495674_0048975 | 3300047319 | Bacteria | 3736 |
| 321 | Ga0495672_0009510 | 3300047320 | Bacteria | 7037 |
| 322 | Ga0495672_0010901 | 3300047320 | Bacteria | 6448 |
| 323 | Ga0495672_0085538 | 3300047320 | Bacteria | 1747 |
| 324 | Ga0495676_0089041 | 3300047321 | Bacteria | 2313 |
| 325 | Ga0495676_0139333 | 3300047321 | Bacteria | 1740 |
| 326 | Ga0495680_0009327 | 3300047322 | Bacteria | 8839 |
| 327 | Ga0495680_0010422 | 3300047322 | Bacteria | 8293 |
| 328 | Ga0495680_0039739 | 3300047322 | Bacteria | 3751 |
| 329 | Ga0495683_0029211 | 3300047323 | Bacteria | 2818 |
| 330 | Ga0495687_006414 | 3300047443 | Bacteria | 7216 |
| 331 | Ga0495675_0006349 | 3300047444 | Bacteria | 7234 |
| 332 | Ga0495673_0104085 | 3300047469 | Bacteria | 1143 |
| 333 | Ga0495681_0161408 | 3300047470 | Bacteria | 933 |
| 334 | Ga0495684_0136904 | 3300047471 | Bacteria | 1837 |
| 335 | Ga0495686_0053553 | 3300047472 | Bacteria | 2529 |
| 336 | Ga0495686_0064675 | 3300047472 | Bacteria | 2263 |
| 337 | Ga0495593_0022030 | 3300047673 | Bacteria | 3555 |
| 338 | Ga0495602_0089280 | 3300048088 | Bacteria | 2563 |
| 339 | Ga0496100_0020659 | 3300048903 | Bacteria | 3952 |
| 340 | Ga0496100_0049703 | 3300048903 | Bacteria | 2713 |
| 341 | Ga0496102_0110959 | 3300048905 | Bacteria | 2557 |
| 342 | Ga0496102_0149129 | 3300048905 | Bacteria | 2196 |
| 343 | Ga0496102_0166000 | 3300048905 | Bacteria | 2077 |
| 344 | Ga0496102_0206350 | 3300048905 | Bacteria | 1853 |
| 345 | Ga0496103_0006040 | 3300048906 | Bacteria | 7237 |
| 346 | Ga0496103_0013113 | 3300048906 | Bacteria | 4915 |
| 347 | Ga0496105_0007938 | 3300048908 | Bacteria | 8247 |
| 348 | Ga0496105_0072433 | 3300048908 | Bacteria | 2847 |
| 349 | Ga0496105_0114424 | 3300048908 | Bacteria | 2225 |
| 350 | Ga0496105_0267429 | 3300048908 | Bacteria | 1381 |
| 351 | Ga0496106_0002438 | 3300048909 | Bacteria | 13856 |
| 352 | Ga0496106_0005543 | 3300048909 | Bacteria | 9342 |
| 353 | Ga0496106_0030606 | 3300048909 | Bacteria | 4012 |
| 354 | Ga0496106_0069423 | 3300048909 | Bacteria | 2689 |
| 355 | Ga0496107_0040003 | 3300048910 | Bacteria | 3365 |
| 356 | Ga0496107_0115896 | 3300048910 | Bacteria | 1972 |
| 357 | Ga0496107_0124522 | 3300048910 | Bacteria | 1900 |
| 358 | Ga0496108_0005372 | 3300048911 | Bacteria | 10354 |
| 359 | Ga0496108_0021547 | 3300048911 | Bacteria | 5294 |
| 360 | Ga0496109_0001905 | 3300048912 | Bacteria | 17328 |
| 361 | Ga0496109_0081491 | 3300048912 | Bacteria | 2982 |
| 362 | Ga0496110_0012096 | 3300048913 | Bacteria | 7091 |
| 363 | Ga0496110_0015008 | 3300048913 | Bacteria | 6442 |
| 364 | Ga0496110_0167420 | 3300048913 | Bacteria | 1993 |
| 365 | Ga0496110_0343158 | 3300048913 | Bacteria | 1360 |
| 366 | Ga0496112_0002552 | 3300048915 | Bacteria | 14709 |
| 367 | Ga0496112_0009780 | 3300048915 | Bacteria | 8660 |
| 368 | Ga0496114_0130114 | 3300048917 | Bacteria | 2173 |
| 369 | Ga0496115_0014720 | 3300048918 | Bacteria | 5926 |
| 370 | Ga0496116_0046071 | 3300048919 | Bacteria | 2946 |
| 371 | Ga0496117_0019495 | 3300048920 | Bacteria | 5567 |
| 372 | Ga0496117_0122959 | 3300048920 | Bacteria | 1590 |
| 373 | Ga0496117_0164011 | 3300048920 | Bacteria | 1298 |
| 374 | Ga0496117_0184533 | 3300048920 | Bacteria | 1195 |
| 375 | Ga0496117_0203566 | 3300048920 | Bacteria | 1116 |
| 376 | Ga0496117_0291492 | 3300048920 | Bacteria | 868 |
| 377 | Ga0496118_0006042 | 3300048921 | Bacteria | 13485 |
| 378 | Ga0496118_0040927 | 3300048921 | Bacteria | 3676 |
| 379 | Ga0496118_0042272 | 3300048921 | Bacteria | 3597 |
| 380 | Ga0496118_0063520 | 3300048921 | Bacteria | 2716 |
| 381 | Ga0496118_0233700 | 3300048921 | Bacteria | 1058 |
| 382 | Ga0496119_0052645 | 3300048922 | Bacteria | 2492 |
| 383 | Ga0496120_0030158 | 3300048923 | Bacteria | 3301 |
| 384 | Ga0496121_0000381 | 3300048924 | Bacteria | 90593 |
| 385 | Ga0496121_0000894 | 3300048924 | Bacteria | 53831 |
| 386 | Ga0496121_0022968 | 3300048924 | Bacteria | 6026 |
| 387 | Ga0496121_0025842 | 3300048924 | Bacteria | 5555 |
| 388 | Ga0496121_0045740 | 3300048924 | Bacteria | 3757 |
| 389 | Ga0496121_0096082 | 3300048924 | Bacteria | 2301 |
| 390 | Ga0496121_0154500 | 3300048924 | Bacteria | 1685 |
| 391 | Ga0496121_0257325 | 3300048924 | Bacteria | 1207 |
| 392 | Ga0496122_0075903 | 3300048925 | Bacteria | 2368 |
| 393 | Ga0496122_0105596 | 3300048925 | Bacteria | 1867 |
| 394 | Ga0496122_0191323 | 3300048925 | Bacteria | 1207 |
| 395 | Ga0496122_0234652 | 3300048925 | Bacteria | 1040 |
| 396 | Ga0496124_0125704 | 3300048927 | Bacteria | 2043 |
| 397 | Ga0496125_0000203 | 3300048928 | Bacteria | 125569 |
| 398 | Ga0496125_0008442 | 3300048928 | Bacteria | 10779 |
| 399 | Ga0496125_0061769 | 3300048928 | Bacteria | 3002 |
| 400 | Ga0496125_0062864 | 3300048928 | Bacteria | 2965 |
| 401 | Ga0496125_0065940 | 3300048928 | Bacteria | 2864 |
| 402 | Ga0496125_0066809 | 3300048928 | Bacteria | 2838 |
| 403 | Ga0496125_0115229 | 3300048928 | Bacteria | 1933 |
| 404 | Ga0496125_0156733 | 3300048928 | Bacteria | 1554 |
| 405 | Ga0496126_0003737 | 3300048929 | Bacteria | 18962 |
| 406 | Ga0496126_0031265 | 3300048929 | Bacteria | 5033 |
| 407 | Ga0496126_0033507 | 3300048929 | Bacteria | 4832 |
| 408 | Ga0496126_0058233 | 3300048929 | Bacteria | 3483 |
| 409 | Ga0496126_0072248 | 3300048929 | Bacteria | 3069 |
| 410 | Ga0496126_0158489 | 3300048929 | Bacteria | 1935 |
| 411 | Ga0496126_0181789 | 3300048929 | Bacteria | 1786 |
| 412 | Ga0496126_0232926 | 3300048929 | Bacteria | 1542 |
| 413 | Ga0496126_0240084 | 3300048929 | Bacteria | 1514 |
| 414 | Ga0496126_0296968 | 3300048929 | Bacteria | 1334 |
| 415 | Ga0495678_061814 | 3300049459 | Bacteria | 1404 |
| 416 | Ga0501033_0014949 | 3300049570 | Bacteria | 5892 |
| 417 | Ga0501034_0094551 | 3300049571 | Bacteria | 2985 |
| 418 | Ga0501034_0098319 | 3300049571 | Bacteria | 2922 |
| 419 | Ga0501034_0488180 | 3300049571 | Bacteria | 1146 |
| 420 | Ga0501037_0078046 | 3300049573 | Bacteria | 2403 |
| 421 | Ga0501038_0008323 | 3300049574 | Bacteria | 9544 |
| 422 | Ga0501038_0094169 | 3300049574 | Bacteria | 2504 |
| 423 | Ga0501038_0102461 | 3300049574 | Bacteria | 2382 |
| 424 | Ga0501043_0020301 | 3300049579 | Bacteria | 5212 |
| 425 | Ga0501043_0087651 | 3300049579 | Bacteria | 2446 |
| 426 | Ga0501043_0106403 | 3300049579 | Bacteria | 2203 |
| 427 | Ga0501043_0189138 | 3300049579 | Bacteria | 1602 |
| 428 | Ga0501047_0018314 | 3300049581 | Bacteria | 6711 |
| 429 | Ga0501047_0026863 | 3300049581 | Bacteria | 5542 |
| 430 | Ga0501047_0193360 | 3300049581 | Bacteria | 1897 |
| 431 | Ga0501067_0036259 | 3300049583 | Bacteria | 2738 |
| 432 | Ga0501070_0036466 | 3300049586 | Bacteria | 4106 |
| 433 | Ga0501070_0081744 | 3300049586 | Bacteria | 2673 |
| 434 | Ga0501070_0112302 | 3300049586 | Bacteria | 2252 |
| 435 | Ga0501070_0354661 | 3300049586 | Bacteria | 1190 |
| 436 | Ga0501073_0018379 | 3300049589 | Bacteria | 5053 |
| 437 | Ga0501074_0016566 | 3300049590 | Bacteria | 5350 |
| 438 | Ga0501079_0117553 | 3300049741 | Bacteria | 2067 |
| 439 | Ga0501080_0031335 | 3300049742 | Bacteria | 4954 |
| 440 | Ga0501080_0105685 | 3300049742 | Bacteria | 2610 |
| 441 | Ga0501035_0076300 | 3300049822 | Bacteria | 2964 |
| 442 | Ga0501035_0162387 | 3300049822 | Bacteria | 1933 |
| 443 | Ga0501044_0060011 | 3300049823 | Bacteria | 3896 |
| 444 | Ga0501044_0098629 | 3300049823 | Bacteria | 2941 |
| 445 | Ga0501044_0221329 | 3300049823 | Bacteria | 1843 |
| 446 | Ga0501044_0281870 | 3300049823 | Bacteria | 1595 |
| 447 | Ga0501044_0329678 | 3300049823 | Bacteria | 1449 |
| 448 | nmdc:mga03n38_40045_c1 | 3300050490 | Bacteria | 2035 |
| 449 | nmdc:mga00v17_168068_c1 | 3300050491 | Bacteria | 1413 |
| 450 | nmdc:mga0yw44_161474_c1 | 3300050492 | Bacteria | 1467 |
| 451 | nmdc:mga0yw44_169146_c1 | 3300050492 | Bacteria | 1434 |
| 452 | nmdc:mga0yw44_288523_c1 | 3300050492 | Bacteria | 1098 |
| 453 | nmdc:mga0k408_194564_c1 | 3300050493 | Bacteria | 1210 |
| 454 | nmdc:mga0k408_23356_c1 | 3300050493 | Bacteria | 3487 |
| 455 | nmdc:mga0k408_28176_c1 | 3300050493 | Bacteria | 3193 |
| 456 | nmdc:mga06z11_78529_c1 | 3300050494 | Bacteria | 1765 |
| 457 | nmdc:mga04h51_24029_c1 | 3300050495 | Bacteria | 1862 |
| 458 | nmdc:mga04h51_977_c1 | 3300050495 | Bacteria | 6603 |
| 459 | nmdc:mga07m45_121104_c1 | 3300050496 | Bacteria | 1511 |
| 460 | nmdc:mga07m45_170878_c1 | 3300050496 | Bacteria | 1263 |
| 461 | nmdc:mga0qj67_267_c1 | 3300050509 | Bacteria | 35925 |
| 462 | nmdc:mga0n895_291700_c1 | 3300050512 | Bacteria | 1654 |
| 463 | nmdc:mga0rr50_33962_c1 | 3300050513 | Bacteria | 3648 |
| 464 | nmdc:mga0sz30_37157_c1 | 3300050516 | Bacteria | 2038 |
| 465 | Ga0495601_0034782 | 3300053077 | Bacteria | 3144 |
| 466 | Ga0495601_0121914 | 3300053077 | Bacteria | 1694 |
| 467 | Ga0495612_0127891 | 3300053078 | Bacteria | 1096 |
| 468 | Ga0500635_0036306 | 3300053080 | Bacteria | 1623 |
| 469 | Ga0495655_0022058 | 3300053083 | Bacteria | 1450 |
| 470 | Ga0495595_0022452 | 3300053084 | Bacteria | 2770 |
| 471 | Ga0495619_0022381 | 3300053085 | Bacteria | 4044 |
| 472 | Ga0500643_000018 | 3300053087 | Bacteria | 296505 |
| 473 | Ga0500643_013312 | 3300053087 | Bacteria | 2910 |
| 474 | Ga0500581_037972 | 3300053089 | Bacteria | 2468 |
| 475 | Ga0500651_0021939 | 3300053093 | Bacteria | 3985 |
| 476 | Ga0500651_0116898 | 3300053093 | Bacteria | 1622 |
| 477 | Ga0500566_0018834 | 3300053094 | Bacteria | 4053 |
| 478 | Ga0500566_0040832 | 3300053094 | Bacteria | 2681 |
| 479 | Ga0500641_0013788 | 3300053096 | Bacteria | 2973 |
| 480 | Ga0500641_0116900 | 3300053096 | Bacteria | 1148 |
| 481 | Ga0500650_0016521 | 3300053098 | Bacteria | 3168 |
| 482 | Ga0500555_001894 | 3300053103 | Bacteria | 6209 |
| 483 | Ga0500556_0000778 | 3300053104 | Bacteria | 18849 |
| 484 | Ga0500556_0107433 | 3300053104 | Bacteria | 1079 |
| 485 | Ga0500557_000008 | 3300053105 | Bacteria | 127284 |
| 486 | Ga0500562_047754 | 3300053108 | Bacteria | 1142 |
| 487 | Ga0500569_000332 | 3300053109 | Bacteria | 7539 |
| 488 | Ga0500572_000927 | 3300053111 | Bacteria | 9023 |
| 489 | Ga0500572_023508 | 3300053111 | Bacteria | 1655 |
| 490 | Ga0500592_001472 | 3300053116 | Bacteria | 3822 |
| 491 | Ga0500592_002606 | 3300053116 | Bacteria | 2895 |
| 492 | Ga0500595_001022 | 3300053119 | Bacteria | 15703 |
| 493 | Ga0500595_004914 | 3300053119 | Bacteria | 5910 |
| 494 | Ga0500595_021071 | 3300053119 | Bacteria | 2333 |
| 495 | Ga0500607_007866 | 3300053121 | Bacteria | 6527 |
| 496 | Ga0500608_058663 | 3300053122 | Bacteria | 1842 |
| 497 | Ga0500608_136535 | 3300053122 | Bacteria | 1093 |
| 498 | Ga0500614_023246 | 3300053123 | Bacteria | 1455 |
| 499 | Ga0500618_007183 | 3300053125 | Bacteria | 3201 |
| 500 | Ga0500642_0000279 | 3300053130 | Bacteria | 18931 |
| 501 | Ga0500642_0000425 | 3300053130 | Bacteria | 13760 |
| 502 | Ga0500652_008162 | 3300053131 | Bacteria | 3475 |
| 503 | Ga0500658_0064369 | 3300053134 | Bacteria | 1533 |
| 504 | Ga0500559_0001443 | 3300053136 | Bacteria | 13494 |
| 505 | Ga0500559_0002465 | 3300053136 | Bacteria | 9560 |
| 506 | Ga0500559_0017531 | 3300053136 | Bacteria | 3024 |
| 507 | Ga0500568_0000833 | 3300053139 | Bacteria | 21699 |
| 508 | Ga0500568_0017296 | 3300053139 | Bacteria | 3185 |
| 509 | Ga0500573_0015044 | 3300053140 | Bacteria | 4382 |
| 510 | Ga0500577_0024782 | 3300053142 | Bacteria | 2021 |
| 511 | Ga0500586_028255 | 3300053145 | Bacteria | 1830 |
| 512 | Ga0500588_0100285 | 3300053146 | Bacteria | 997 |
| 513 | Ga0500603_002201 | 3300053150 | Bacteria | 4304 |
| 514 | Ga0500604_0016112 | 3300053151 | Bacteria | 2055 |
| 515 | Ga0500616_0000180 | 3300053153 | Bacteria | 106053 |
| 516 | Ga0500616_0007514 | 3300053153 | Bacteria | 6903 |
| 517 | Ga0500622_0004447 | 3300053156 | Bacteria | 8802 |
| 518 | Ga0500622_0006536 | 3300053156 | Bacteria | 6736 |
| 519 | Ga0500627_0007880 | 3300053158 | Bacteria | 3745 |
| 520 | Ga0500627_0059483 | 3300053158 | Bacteria | 1679 |
| 521 | Ga0500639_013282 | 3300053163 | Bacteria | 4332 |
| 522 | Ga0500636_0001226 | 3300053177 | Bacteria | 13863 |
| 523 | Ga0500636_0085715 | 3300053177 | Bacteria | 1809 |
| 524 | Ga0500637_0005742 | 3300053178 | Bacteria | 6040 |
| 525 | Ga0500637_0020186 | 3300053178 | Bacteria | 3604 |
| 526 | Ga0500576_009965 | 3300053725 | Bacteria | 4190 |
| 527 | Ga0500552_000615 | 3300053733 | Bacteria | 3353 |
| 528 | Ga0500596_003569 | 3300053735 | Bacteria | 2936 |
| 529 | Ga0500601_000920 | 3300053737 | Bacteria | 3496 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047470 | Ga0495681_0161408 | Ga0495681_0161408_77_910 | 255 |
| 2 | 3300048920 | Ga0496117_0122959 | Ga0496117_0122959_31_864 | 255 |
| 3 | 3300048920 | Ga0496117_0291492 | Ga0496117_0291492_21_854 | 255 |
| 4 | 3300048925 | Ga0496122_0191323 | Ga0496122_0191323_35_868 | 255 |
| 5 | 3300053134 | Ga0500658_0064369 | Ga0500658_0064369_672_1508 | 256 |
| 6 | 3300049573 | Ga0501037_0078046 | Ga0501037_0078046_687_1580 | 259 |
| 7 | 3300049579 | Ga0501043_0020301 | Ga0501043_0020301_1998_2891 | 259 |
| 8 | 3300049823 | Ga0501044_0329678 | Ga0501044_0329678_380_1273 | 259 |
| 9 | 3300006942 | Ga0099824_1025695 | Ga0099824_10256952 | 264 |
| 10 | 3300027296 | Ga0209389_1000023 | Ga0209389_100002386 | 264 |
| 11 | 3300027357 | Ga0209589_1000010 | Ga0209589_100001073 | 264 |
| 12 | 3300027361 | Ga0209489_100011 | Ga0209489_100011163 | 264 |
| 13 | 3300030521 | Ga0307511_10075177 | Ga0307511_100751772 | 266 |
| 14 | 3300033180 | Ga0307510_10071474 | Ga0307510_100714742 | 266 |
| 15 | 3300035083 | Ga0373926_0046657 | Ga0373926_0046657_330_1220 | 266 |
| 16 | 3300035692 | Ga0373935_0024123 | Ga0373935_0024123_1704_2594 | 266 |
| 17 | 3300035695 | Ga0373927_0030875 | Ga0373927_0030875_1142_2032 | 266 |
| 18 | 3300035725 | Ga0373947_0061286 | Ga0373947_0061286_1128_2018 | 266 |
| 19 | 3300046499 | Ga0495594_0054357 | Ga0495594_0054357_60_950 | 266 |
| 20 | 3300046557 | Ga0495622_0003529 | Ga0495622_0003529_1562_2452 | 266 |
| 21 | 3300053080 | Ga0500635_0036306 | Ga0500635_0036306_473_1363 | 266 |
| 22 | 3300053136 | Ga0500559_0017531 | Ga0500559_0017531_1813_2703 | 266 |
| 23 | 3300053140 | Ga0500573_0015044 | Ga0500573_0015044_1132_2022 | 266 |
| 24 | 3300053178 | Ga0500637_0020186 | Ga0500637_0020186_1383_2273 | 266 |
| 25 | 3300053733 | Ga0500552_000615 | Ga0500552_000615_2208_3098 | 266 |
| 26 | 3300010375 | Ga0105239_10635401 | Ga0105239_106354012 | 269 |
| 27 | 3300048909 | Ga0496106_0005543 | Ga0496106_0005543_1693_2583 | 269 |
| 28 | 3300048920 | Ga0496117_0019495 | Ga0496117_0019495_4398_5288 | 269 |
| 29 | 3300048921 | Ga0496118_0006042 | Ga0496118_0006042_9083_9973 | 269 |
| 30 | 3300048924 | Ga0496121_0000381 | Ga0496121_0000381_6627_7517 | 269 |
| 31 | 3300048928 | Ga0496125_0062864 | Ga0496125_0062864_1341_2231 | 269 |
| 32 | 3300048929 | Ga0496126_0003737 | Ga0496126_0003737_12557_13447 | 269 |
| 33 | 3300053077 | Ga0495601_0121914 | Ga0495601_0121914_645_1550 | 269 |
| 34 | 3300053096 | Ga0500641_0013788 | Ga0500641_0013788_1720_2598 | 270 |
| 35 | iso_pu_bacteria | 2508501128 | 2509147146 | 270 |
| 36 | iso_pu_bacteria | 2602042107 | 2603861230 | 270 |
| 37 | iso_pu_bacteria | 2919073203 | 2919077069 | 270 |
| 38 | 3300039437 | Ga0436365_1143724 | Ga0436365_1143724_1386_2282 | 271 |
| 39 | 3300046454 | Ga0495592_0062498 | Ga0495592_0062498_300_1205 | 271 |
| 40 | 3300049571 | Ga0501034_0094551 | Ga0501034_0094551_2064_2948 | 271 |
| 41 | 3300049574 | Ga0501038_0008323 | Ga0501038_0008323_171_1055 | 271 |
| 42 | 3300049822 | Ga0501035_0162387 | Ga0501035_0162387_486_1370 | 271 |
| 43 | iso_pu_bacteria | 2643221651 | 2644287393 | 271 |
| 44 | iso_pu_bacteria | 2857524615 | 2857530013 | 271 |
| 45 | iso_pu_bacteria | 2893066018 | 2893071063 | 271 |
| 46 | iso_pu_bacteria | 2919450847 | 2919452441 | 271 |
| 47 | 3300031247 | Ga0265340_10000952 | Ga0265340_1000095215 | 272 |
| 48 | 3300031249 | Ga0265339_10008913 | Ga0265339_100089135 | 272 |
| 49 | 3300031344 | Ga0265316_10008327 | Ga0265316_100083278 | 272 |
| 50 | 3300031595 | Ga0265313_10001147 | Ga0265313_1000114719 | 272 |
| 51 | 3300031712 | Ga0265342_10005336 | Ga0265342_100053362 | 272 |
| 52 | 3300049571 | Ga0501034_0098319 | Ga0501034_0098319_901_1788 | 272 |
| 53 | 3300049574 | Ga0501038_0094169 | Ga0501038_0094169_270_1157 | 272 |
| 54 | 3300049581 | Ga0501047_0018314 | Ga0501047_0018314_2960_3847 | 272 |
| 55 | 3300049586 | Ga0501070_0112302 | Ga0501070_0112302_864_1751 | 272 |
| 56 | 3300049742 | Ga0501080_0105685 | Ga0501080_0105685_1388_2275 | 272 |
| 57 | 3300049823 | Ga0501044_0221329 | Ga0501044_0221329_580_1467 | 272 |
| 58 | 3300049823 | Ga0501044_0281870 | Ga0501044_0281870_151_1038 | 272 |
| 59 | 3300005327 | Ga0070658_10045152 | Ga0070658_100451524 | 273 |
| 60 | 3300031711 | Ga0265314_10093213 | Ga0265314_100932133 | 273 |
| 61 | 3300031712 | Ga0265342_10168281 | Ga0265342_101682812 | 273 |
| 62 | 3300049590 | Ga0501074_0016566 | Ga0501074_0016566_1565_2455 | 273 |
| 63 | 3300053142 | Ga0500577_0024782 | Ga0500577_0024782_103_990 | 273 |
| 64 | 3300006038 | Ga0075365_10119922 | Ga0075365_101199221 | 274 |
| 65 | 3300006042 | Ga0075368_10056296 | Ga0075368_100562962 | 274 |
| 66 | 3300006048 | Ga0075363_100045805 | Ga0075363_1000458053 | 274 |
| 67 | 3300006353 | Ga0075370_10069024 | Ga0075370_100690241 | 274 |
| 68 | 3300009101 | Ga0105247_10099619 | Ga0105247_100996192 | 274 |
| 69 | 3300025297 | Ga0209758_1001389 | Ga0209758_100138920 | 274 |
| 70 | 3300025900 | Ga0207710_10040333 | Ga0207710_100403332 | 274 |
| 71 | 3300025939 | Ga0207665_10272997 | Ga0207665_102729971 | 274 |
| 72 | 3300026035 | Ga0207703_10061959 | Ga0207703_100619593 | 274 |
| 73 | 3300027866 | Ga0209813_10025239 | Ga0209813_100252392 | 274 |
| 74 | 3300031241 | Ga0265325_10006666 | Ga0265325_100066664 | 274 |
| 75 | 3300031616 | Ga0307508_10000034 | Ga0307508_1000003441 | 274 |
| 76 | 3300037418 | Ga0395900_0126981 | Ga0395900_0126981_197_1087 | 274 |
| 77 | 3300046524 | Ga0495648_0003170 | Ga0495648_0003170_13253_14143 | 274 |
| 78 | 3300046648 | Ga0495611_0064116 | Ga0495611_0064116_131_1021 | 274 |
| 79 | 3300046691 | Ga0495670_0022409 | Ga0495670_0022409_403_1293 | 274 |
| 80 | 3300047320 | Ga0495672_0085538 | Ga0495672_0085538_722_1612 | 274 |
| 81 | 3300047472 | Ga0495686_0064675 | Ga0495686_0064675_435_1325 | 274 |
| 82 | 3300048919 | Ga0496116_0046071 | Ga0496116_0046071_1639_2529 | 274 |
| 83 | 3300048920 | Ga0496117_0184533 | Ga0496117_0184533_194_1084 | 274 |
| 84 | 3300048920 | Ga0496117_0203566 | Ga0496117_0203566_64_954 | 274 |
| 85 | 3300048921 | Ga0496118_0040927 | Ga0496118_0040927_1942_2832 | 274 |
| 86 | 3300048921 | Ga0496118_0042272 | Ga0496118_0042272_713_1603 | 274 |
| 87 | 3300048921 | Ga0496118_0233700 | Ga0496118_0233700_77_967 | 274 |
| 88 | 3300048924 | Ga0496121_0022968 | Ga0496121_0022968_412_1302 | 274 |
| 89 | 3300048924 | Ga0496121_0025842 | Ga0496121_0025842_1021_1911 | 274 |
| 90 | 3300048925 | Ga0496122_0075903 | Ga0496122_0075903_870_1760 | 274 |
| 91 | 3300048925 | Ga0496122_0105596 | Ga0496122_0105596_625_1515 | 274 |
| 92 | 3300048925 | Ga0496122_0234652 | Ga0496122_0234652_17_907 | 274 |
| 93 | 3300048927 | Ga0496124_0125704 | Ga0496124_0125704_98_988 | 274 |
| 94 | 3300048928 | Ga0496125_0000203 | Ga0496125_0000203_102285_103175 | 274 |
| 95 | 3300048928 | Ga0496125_0061769 | Ga0496125_0061769_378_1268 | 274 |
| 96 | 3300048928 | Ga0496125_0065940 | Ga0496125_0065940_499_1389 | 274 |
| 97 | 3300048928 | Ga0496125_0115229 | Ga0496125_0115229_199_1089 | 274 |
| 98 | 3300048928 | Ga0496125_0156733 | Ga0496125_0156733_414_1304 | 274 |
| 99 | 3300048929 | Ga0496126_0031265 | Ga0496126_0031265_3182_4072 | 274 |
| 100 | 3300048929 | Ga0496126_0158489 | Ga0496126_0158489_609_1499 | 274 |
| 101 | 3300049459 | Ga0495678_061814 | Ga0495678_061814_72_962 | 274 |
| 102 | 3300049570 | Ga0501033_0014949 | Ga0501033_0014949_807_1697 | 274 |
| 103 | 3300049579 | Ga0501043_0106403 | Ga0501043_0106403_423_1319 | 274 |
| 104 | 3300049581 | Ga0501047_0193360 | Ga0501047_0193360_131_1027 | 274 |
| 105 | 3300049583 | Ga0501067_0036259 | Ga0501067_0036259_866_1762 | 274 |
| 106 | 3300049586 | Ga0501070_0081744 | Ga0501070_0081744_1008_1904 | 274 |
| 107 | 3300049589 | Ga0501073_0018379 | Ga0501073_0018379_1491_2387 | 274 |
| 108 | 3300049741 | Ga0501079_0117553 | Ga0501079_0117553_608_1504 | 274 |
| 109 | 3300049742 | Ga0501080_0031335 | Ga0501080_0031335_1710_2606 | 274 |
| 110 | 3300049823 | Ga0501044_0060011 | Ga0501044_0060011_1792_2688 | 274 |
| 111 | 3300050490 | nmdc:mga03n38_40045_c1 | nmdc:mga03n38_40045_c1_261_1151 | 274 |
| 112 | 3300050491 | nmdc:mga00v17_168068_c1 | nmdc:mga00v17_168068_c1_333_1223 | 274 |
| 113 | 3300050492 | nmdc:mga0yw44_161474_c1 | nmdc:mga0yw44_161474_c1_272_1162 | 274 |
| 114 | 3300050495 | nmdc:mga04h51_24029_c1 | nmdc:mga04h51_24029_c1_229_1119 | 274 |
| 115 | 3300050496 | nmdc:mga07m45_121104_c1 | nmdc:mga07m45_121104_c1_374_1264 | 274 |
| 116 | 3300050496 | nmdc:mga07m45_170878_c1 | nmdc:mga07m45_170878_c1_236_1126 | 274 |
| 117 | 3300053078 | Ga0495612_0127891 | Ga0495612_0127891_177_1067 | 274 |
| 118 | 3300053087 | Ga0500643_013312 | Ga0500643_013312_486_1376 | 274 |
| 119 | 3300053089 | Ga0500581_037972 | Ga0500581_037972_1201_2091 | 274 |
| 120 | 3300053093 | Ga0500651_0021939 | Ga0500651_0021939_549_1439 | 274 |
| 121 | 3300053104 | Ga0500556_0000778 | Ga0500556_0000778_317_1207 | 274 |
| 122 | 3300053108 | Ga0500562_047754 | Ga0500562_047754_56_946 | 274 |
| 123 | 3300053116 | Ga0500592_001472 | Ga0500592_001472_322_1212 | 274 |
| 124 | 3300053119 | Ga0500595_001022 | Ga0500595_001022_12122_13012 | 274 |
| 125 | 3300053119 | Ga0500595_004914 | Ga0500595_004914_2421_3311 | 274 |
| 126 | 3300053130 | Ga0500642_0000279 | Ga0500642_0000279_687_1577 | 274 |
| 127 | 3300053131 | Ga0500652_008162 | Ga0500652_008162_2035_2925 | 274 |
| 128 | 3300053136 | Ga0500559_0001443 | Ga0500559_0001443_4729_5619 | 274 |
| 129 | 3300053145 | Ga0500586_028255 | Ga0500586_028255_808_1698 | 274 |
| 130 | 3300053153 | Ga0500616_0000180 | Ga0500616_0000180_19625_20515 | 274 |
| 131 | 3300053156 | Ga0500622_0006536 | Ga0500622_0006536_313_1203 | 274 |
| 132 | 3300053158 | Ga0500627_0007880 | Ga0500627_0007880_120_1010 | 274 |
| 133 | 3300053158 | Ga0500627_0059483 | Ga0500627_0059483_464_1354 | 274 |
| 134 | 3300053725 | Ga0500576_009965 | Ga0500576_009965_2263_3153 | 274 |
| 135 | iso_pu_bacteria | 2517572143 | 2517894671 | 274 |
| 136 | iso_pu_bacteria | 2728368998 | 2728747670 | 274 |
| 137 | iso_pu_bacteria | 8056689827 | 8056695099 | 274 |
| 138 | 3300003659 | JGI25404J52841_10001584 | JGI25404J52841_100015841 | 275 |
| 139 | 3300005338 | Ga0068868_100017680 | Ga0068868_1000176802 | 275 |
| 140 | 3300005434 | Ga0070709_10028569 | Ga0070709_100285693 | 275 |
| 141 | 3300005435 | Ga0070714_100185760 | Ga0070714_1001857602 | 275 |
| 142 | 3300005437 | Ga0070710_10021064 | Ga0070710_100210642 | 275 |
| 143 | 3300005439 | Ga0070711_100137513 | Ga0070711_1001375132 | 275 |
| 144 | 3300005455 | Ga0070663_100050838 | Ga0070663_1000508382 | 275 |
| 145 | 3300005535 | Ga0070684_100559520 | Ga0070684_1005595202 | 275 |
| 146 | 3300005614 | Ga0068856_100002538 | Ga0068856_10000253811 | 275 |
| 147 | 3300005937 | Ga0081455_10003699 | Ga0081455_100036998 | 275 |
| 148 | 3300005983 | Ga0081540_1003091 | Ga0081540_100309116 | 275 |
| 149 | 3300005983 | Ga0081540_1010356 | Ga0081540_10103563 | 275 |
| 150 | 3300005985 | Ga0081539_10001829 | Ga0081539_1000182911 | 275 |
| 151 | 3300006028 | Ga0070717_10029907 | Ga0070717_100299072 | 275 |
| 152 | 3300006038 | Ga0075365_10088253 | Ga0075365_100882532 | 275 |
| 153 | 3300006175 | Ga0070712_100007513 | Ga0070712_1000075137 | 275 |
| 154 | 3300006186 | Ga0075369_10059516 | Ga0075369_100595162 | 275 |
| 155 | 3300006195 | Ga0075366_10197329 | Ga0075366_101973292 | 275 |
| 156 | 3300006353 | Ga0075370_10251434 | Ga0075370_102514341 | 275 |
| 157 | 3300006358 | Ga0068871_100080011 | Ga0068871_1000800113 | 275 |
| 158 | 3300009098 | Ga0105245_10074811 | Ga0105245_100748113 | 275 |
| 159 | 3300009101 | Ga0105247_10105343 | Ga0105247_101053432 | 275 |
| 160 | 3300009545 | Ga0105237_10127376 | Ga0105237_101273762 | 275 |
| 161 | 3300013307 | Ga0157372_10055869 | Ga0157372_100558695 | 275 |
| 162 | 3300014968 | Ga0157379_10275067 | Ga0157379_102750672 | 275 |
| 163 | 3300014968 | Ga0157379_10289882 | Ga0157379_102898822 | 275 |
| 164 | 3300014969 | Ga0157376_10495090 | Ga0157376_104950901 | 275 |
| 165 | 3300021377 | Ga0213874_10006183 | Ga0213874_100061832 | 275 |
| 166 | 3300025295 | Ga0209564_1004750 | Ga0209564_10047503 | 275 |
| 167 | 3300025898 | Ga0207692_10025688 | Ga0207692_100256882 | 275 |
| 168 | 3300025900 | Ga0207710_10030302 | Ga0207710_100303022 | 275 |
| 169 | 3300025908 | Ga0207643_10181157 | Ga0207643_101811571 | 275 |
| 170 | 3300025914 | Ga0207671_10033635 | Ga0207671_100336353 | 275 |
| 171 | 3300025915 | Ga0207693_10001851 | Ga0207693_1000185113 | 275 |
| 172 | 3300025927 | Ga0207687_10173417 | Ga0207687_101734172 | 275 |
| 173 | 3300026023 | Ga0207677_10069033 | Ga0207677_100690332 | 275 |
| 174 | 3300026067 | Ga0207678_10052416 | Ga0207678_100524162 | 275 |
| 175 | 3300026078 | Ga0207702_10000041 | Ga0207702_100000414 | 275 |
| 176 | 3300026095 | Ga0207676_10157951 | Ga0207676_101579512 | 275 |
| 177 | 3300028381 | Ga0268264_10000093 | Ga0268264_100000935 | 275 |
| 178 | 3300028794 | Ga0307515_10104177 | Ga0307515_101041772 | 275 |
| 179 | 3300031711 | Ga0265314_10004394 | Ga0265314_100043945 | 275 |
| 180 | 3300033180 | Ga0307510_10121889 | Ga0307510_101218892 | 275 |
| 181 | 3300034818 | Ga0373950_0010582 | Ga0373950_0010582_124_1017 | 275 |
| 182 | 3300037068 | Ga0373925_0174005 | Ga0373925_0174005_651_1544 | 275 |
| 183 | 3300037418 | Ga0395900_0063174 | Ga0395900_0063174_925_1818 | 275 |
| 184 | 3300039447 | Ga0436361_0282868 | Ga0436361_0282868_2440_3333 | 275 |
| 185 | 3300039450 | Ga0436363_0144469 | Ga0436363_0144469_7058_7951 | 275 |
| 186 | 3300046455 | Ga0495603_0011576 | Ga0495603_0011576_3901_4794 | 275 |
| 187 | 3300046460 | Ga0495638_0051379 | Ga0495638_0051379_905_1798 | 275 |
| 188 | 3300046475 | Ga0495639_0020450 | Ga0495639_0020450_135_1028 | 275 |
| 189 | 3300046512 | Ga0495610_0063678 | Ga0495610_0063678_744_1637 | 275 |
| 190 | 3300046616 | Ga0495668_0199454 | Ga0495668_0199454_31_924 | 275 |
| 191 | 3300046660 | Ga0495625_0026834 | Ga0495625_0026834_2414_3307 | 275 |
| 192 | 3300047320 | Ga0495672_0009510 | Ga0495672_0009510_4438_5331 | 275 |
| 193 | 3300047320 | Ga0495672_0010901 | Ga0495672_0010901_5004_5897 | 275 |
| 194 | 3300047472 | Ga0495686_0053553 | Ga0495686_0053553_996_1889 | 275 |
| 195 | 3300048903 | Ga0496100_0020659 | Ga0496100_0020659_524_1417 | 275 |
| 196 | 3300048905 | Ga0496102_0110959 | Ga0496102_0110959_933_1826 | 275 |
| 197 | 3300048905 | Ga0496102_0166000 | Ga0496102_0166000_996_1889 | 275 |
| 198 | 3300048906 | Ga0496103_0013113 | Ga0496103_0013113_1446_2339 | 275 |
| 199 | 3300048908 | Ga0496105_0072433 | Ga0496105_0072433_88_981 | 275 |
| 200 | 3300048909 | Ga0496106_0002438 | Ga0496106_0002438_7279_8172 | 275 |
| 201 | 3300048909 | Ga0496106_0069423 | Ga0496106_0069423_436_1329 | 275 |
| 202 | 3300048910 | Ga0496107_0040003 | Ga0496107_0040003_673_1566 | 275 |
| 203 | 3300048911 | Ga0496108_0005372 | Ga0496108_0005372_913_1806 | 275 |
| 204 | 3300048911 | Ga0496108_0021547 | Ga0496108_0021547_2825_3718 | 275 |
| 205 | 3300048912 | Ga0496109_0001905 | Ga0496109_0001905_8526_9419 | 275 |
| 206 | 3300048913 | Ga0496110_0012096 | Ga0496110_0012096_4165_5058 | 275 |
| 207 | 3300048913 | Ga0496110_0015008 | Ga0496110_0015008_73_966 | 275 |
| 208 | 3300048915 | Ga0496112_0002552 | Ga0496112_0002552_4827_5720 | 275 |
| 209 | 3300048917 | Ga0496114_0130114 | Ga0496114_0130114_83_976 | 275 |
| 210 | 3300048924 | Ga0496121_0154500 | Ga0496121_0154500_199_1092 | 275 |
| 211 | 3300048928 | Ga0496125_0008442 | Ga0496125_0008442_123_1016 | 275 |
| 212 | 3300048929 | Ga0496126_0058233 | Ga0496126_0058233_2201_3094 | 275 |
| 213 | 3300048929 | Ga0496126_0181789 | Ga0496126_0181789_492_1385 | 275 |
| 214 | 3300048929 | Ga0496126_0232926 | Ga0496126_0232926_31_924 | 275 |
| 215 | 3300049571 | Ga0501034_0488180 | Ga0501034_0488180_24_917 | 275 |
| 216 | 3300049574 | Ga0501038_0102461 | Ga0501038_0102461_1369_2262 | 275 |
| 217 | 3300049579 | Ga0501043_0087651 | Ga0501043_0087651_1339_2232 | 275 |
| 218 | 3300049579 | Ga0501043_0189138 | Ga0501043_0189138_568_1461 | 275 |
| 219 | 3300049581 | Ga0501047_0026863 | Ga0501047_0026863_4079_4972 | 275 |
| 220 | 3300049586 | Ga0501070_0036466 | Ga0501070_0036466_2754_3647 | 275 |
| 221 | 3300049586 | Ga0501070_0354661 | Ga0501070_0354661_18_911 | 275 |
| 222 | 3300049822 | Ga0501035_0076300 | Ga0501035_0076300_1743_2636 | 275 |
| 223 | 3300049823 | Ga0501044_0098629 | Ga0501044_0098629_1452_2345 | 275 |
| 224 | 3300050492 | nmdc:mga0yw44_288523_c1 | nmdc:mga0yw44_288523_c1_194_1087 | 275 |
| 225 | 3300050493 | nmdc:mga0k408_194564_c1 | nmdc:mga0k408_194564_c1_15_911 | 275 |
| 226 | 3300053083 | Ga0495655_0022058 | Ga0495655_0022058_323_1216 | 275 |
| 227 | 3300053094 | Ga0500566_0040832 | Ga0500566_0040832_759_1652 | 275 |
| 228 | 3300053096 | Ga0500641_0116900 | Ga0500641_0116900_13_906 | 275 |
| 229 | 3300053098 | Ga0500650_0016521 | Ga0500650_0016521_773_1666 | 275 |
| 230 | 3300053122 | Ga0500608_058663 | Ga0500608_058663_264_1157 | 275 |
| 231 | 3300053125 | Ga0500618_007183 | Ga0500618_007183_170_1063 | 275 |
| 232 | 3300053136 | Ga0500559_0002465 | Ga0500559_0002465_1009_1902 | 275 |
| 233 | 3300053139 | Ga0500568_0000833 | Ga0500568_0000833_1015_1908 | 275 |
| 234 | 3300053150 | Ga0500603_002201 | Ga0500603_002201_1931_2824 | 275 |
| 235 | 3300053151 | Ga0500604_0016112 | Ga0500604_0016112_362_1255 | 275 |
| 236 | 3300053177 | Ga0500636_0085715 | Ga0500636_0085715_628_1521 | 275 |
| 237 | 3300053178 | Ga0500637_0005742 | Ga0500637_0005742_2212_3105 | 275 |
| 238 | iso_pu_bacteria | 2507262055 | 2507510914 | 275 |
| 239 | iso_pu_bacteria | 2508501009 | 2508544726 | 275 |
| 240 | iso_pu_bacteria | 2508501042 | 2508697044 | 275 |
| 241 | iso_pu_bacteria | 2511231028 | 2511394394 | 275 |
| 242 | iso_pu_bacteria | 2513237092 | 2513623397 | 275 |
| 243 | iso_pu_bacteria | 2513237094 | 2513637575 | 275 |
| 244 | iso_pu_bacteria | 2513237095 | 2513649582 | 275 |
| 245 | iso_pu_bacteria | 2513237102 | 2513700035 | 275 |
| 246 | iso_pu_bacteria | 2513237104 | 2513719234 | 275 |
| 247 | iso_pu_bacteria | 2513237139 | 2513874563 | 275 |
| 248 | iso_pu_bacteria | 2513237161 | 2514015531 | 275 |
| 249 | iso_pu_bacteria | 2515154112 | 2515625542 | 275 |
| 250 | iso_pu_bacteria | 2517093001 | 2517100494 | 275 |
| 251 | iso_pu_bacteria | 2524023205 | 2524437354 | 275 |
| 252 | iso_pu_bacteria | 2524023228 | 2524534411 | 275 |
| 253 | iso_pu_bacteria | 2528768022 | 2528849927 | 275 |
| 254 | iso_pu_bacteria | 2617270735 | 2617350672 | 275 |
| 255 | iso_pu_bacteria | 2617270741 | 2617377920 | 275 |
| 256 | iso_pu_bacteria | 2744054633 | 2745076830 | 275 |
| 257 | iso_pu_bacteria | 2791355196 | 2793066062 | 275 |
| 258 | iso_pu_bacteria | 2802429603 | 2805916558 | 275 |
| 259 | iso_pu_bacteria | 2816332527 | 2818238052 | 275 |
| 260 | iso_pu_bacteria | 2824600985 | 2824606146 | 275 |
| 261 | iso_pu_bacteria | 2824609381 | 2824616026 | 275 |
| 262 | iso_pu_bacteria | 2824617872 | 2824618949 | 275 |
| 263 | iso_pu_bacteria | 2824626560 | 2824627531 | 275 |
| 264 | iso_pu_bacteria | 2824635225 | 2824638856 | 275 |
| 265 | iso_pu_bacteria | 2824644064 | 2824647658 | 275 |
| 266 | iso_pu_bacteria | 2824653114 | 2824657325 | 275 |
| 267 | iso_pu_bacteria | 2824661429 | 2824668197 | 275 |
| 268 | iso_pu_bacteria | 2824671348 | 2824675565 | 275 |
| 269 | iso_pu_bacteria | 2824679649 | 2824682032 | 275 |
| 270 | iso_pu_bacteria | 2824687955 | 2824692231 | 275 |
| 271 | iso_pu_bacteria | 2824696289 | 2824698703 | 275 |
| 272 | iso_pu_bacteria | 2824704595 | 2824706525 | 275 |
| 273 | iso_pu_bacteria | 2824714736 | 2824716453 | 275 |
| 274 | iso_pu_bacteria | 2824723954 | 2824726399 | 275 |
| 275 | iso_pu_bacteria | 2824732956 | 2824736300 | 275 |
| 276 | iso_pu_bacteria | 2824746037 | 2824751942 | 275 |
| 277 | iso_pu_bacteria | 2824753945 | 2824756927 | 275 |
| 278 | iso_pu_bacteria | 2824763712 | 2824769723 | 275 |
| 279 | iso_pu_bacteria | 2824773399 | 2824778465 | 275 |
| 280 | iso_pu_bacteria | 2838122688 | 2838127804 | 275 |
| 281 | iso_pu_bacteria | 2841941048 | 2841943097 | 275 |
| 282 | iso_pu_bacteria | 2841949485 | 2841956118 | 275 |
| 283 | iso_pu_bacteria | 2841957949 | 2841960310 | 275 |
| 284 | iso_pu_bacteria | 2841966195 | 2841968261 | 275 |
| 285 | iso_pu_bacteria | 2841974524 | 2841976525 | 275 |
| 286 | iso_pu_bacteria | 2841983080 | 2841987901 | 275 |
| 287 | iso_pu_bacteria | 2842038055 | 2842042796 | 275 |
| 288 | iso_pu_bacteria | 2842045827 | 2842050838 | 275 |
| 289 | iso_pu_bacteria | 2844315083 | 2844317008 | 275 |
| 290 | iso_pu_bacteria | 2847930680 | 2847938475 | 275 |
| 291 | iso_pu_bacteria | 2847939898 | 2847944327 | 275 |
| 292 | iso_pu_bacteria | 2849076700 | 2849081435 | 275 |
| 293 | iso_pu_bacteria | 2857509624 | 2857512095 | 275 |
| 294 | iso_pu_bacteria | 2874590934 | 2874597639 | 275 |
| 295 | iso_pu_bacteria | 2874612657 | 2874615721 | 275 |
| 296 | iso_pu_bacteria | 2874620515 | 2874623523 | 275 |
| 297 | iso_pu_bacteria | 2874628541 | 2874630546 | 275 |
| 298 | iso_pu_bacteria | 2874645413 | 2874649203 | 275 |
| 299 | iso_pu_bacteria | 2876771140 | 2876774888 | 275 |
| 300 | iso_pu_bacteria | 2876818435 | 2876822360 | 275 |
| 301 | iso_pu_bacteria | 2879074833 | 2879077976 | 275 |
| 302 | iso_pu_bacteria | 2879083081 | 2879088714 | 275 |
| 303 | iso_pu_bacteria | 2879099564 | 2879102001 | 275 |
| 304 | iso_pu_bacteria | 2879127579 | 2879132473 | 275 |
| 305 | iso_pu_bacteria | 2879142872 | 2879145973 | 275 |
| 306 | iso_pu_bacteria | 2881364244 | 2881370592 | 275 |
| 307 | iso_pu_bacteria | 2881665667 | 2881667355 | 275 |
| 308 | iso_pu_bacteria | 2885366525 | 2885367019 | 275 |
| 309 | iso_pu_bacteria | 2885409591 | 2885416557 | 275 |
| 310 | iso_pu_bacteria | 2888378607 | 2888381631 | 275 |
| 311 | iso_pu_bacteria | 2888388044 | 2888388998 | 275 |
| 312 | iso_pu_bacteria | 2888419890 | 2888422030 | 275 |
| 313 | iso_pu_bacteria | 2903727486 | 2903734976 | 275 |
| 314 | iso_pu_bacteria | 2904666416 | 2904667673 | 275 |
| 315 | iso_pu_bacteria | 2904711408 | 2904719109 | 275 |
| 316 | iso_pu_bacteria | 2906602504 | 2906604091 | 275 |
| 317 | iso_pu_bacteria | 2906610324 | 2906611398 | 275 |
| 318 | iso_pu_bacteria | 2906626472 | 2906632998 | 275 |
| 319 | iso_pu_bacteria | 2906643746 | 2906648266 | 275 |
| 320 | iso_pu_bacteria | 2908775508 | 2908782030 | 275 |
| 321 | iso_pu_bacteria | 2922368715 | 2922371304 | 275 |
| 322 | iso_pu_bacteria | 2922393267 | 2922393786 | 275 |
| 323 | iso_pu_bacteria | 2929615660 | 2929619681 | 275 |
| 324 | iso_pu_bacteria | 2929624759 | 2929627848 | 275 |
| 325 | iso_pu_bacteria | 2932784394 | 2932786013 | 275 |
| 326 | iso_pu_bacteria | 2932794094 | 2932798216 | 275 |
| 327 | iso_pu_bacteria | 2932801729 | 2932804009 | 275 |
| 328 | iso_pu_bacteria | 2932809354 | 2932817038 | 275 |
| 329 | iso_pu_bacteria | 2932818245 | 2932822471 | 275 |
| 330 | iso_pu_bacteria | 2932828146 | 2932831057 | 275 |
| 331 | iso_pu_bacteria | 2933577622 | 2933581600 | 275 |
| 332 | iso_pu_bacteria | 2935608549 | 2935612868 | 275 |
| 333 | iso_pu_bacteria | 2935616580 | 2935624155 | 275 |
| 334 | iso_pu_bacteria | 2935630451 | 2935632112 | 275 |
| 335 | iso_pu_bacteria | 2935638405 | 2935640199 | 275 |
| 336 | iso_pu_bacteria | 2935648319 | 2935654993 | 275 |
| 337 | iso_pu_bacteria | 2935656913 | 2935663873 | 275 |
| 338 | iso_pu_bacteria | 2935665750 | 2935666963 | 275 |
| 339 | iso_pu_bacteria | 2935675223 | 2935680397 | 275 |
| 340 | iso_pu_bacteria | 2935684952 | 2935690094 | 275 |
| 341 | iso_pu_bacteria | 2935694250 | 2935699824 | 275 |
| 342 | iso_pu_bacteria | 2935703347 | 2935704718 | 275 |
| 343 | iso_pu_bacteria | 2935713505 | 2935722194 | 275 |
| 344 | iso_pu_bacteria | 2935722832 | 2935731503 | 275 |
| 345 | iso_pu_bacteria | 2935732158 | 2935735409 | 275 |
| 346 | iso_pu_bacteria | 2935741537 | 2935745320 | 275 |
| 347 | iso_pu_bacteria | 2935750917 | 2935755105 | 275 |
| 348 | iso_pu_bacteria | 2935760218 | 2935762380 | 275 |
| 349 | iso_pu_bacteria | 2935769743 | 2935775415 | 275 |
| 350 | iso_pu_bacteria | 2935777560 | 2935780317 | 275 |
| 351 | iso_pu_bacteria | 2935785616 | 2935790664 | 275 |
| 352 | iso_pu_bacteria | 2935793552 | 2935799153 | 275 |
| 353 | iso_pu_bacteria | 2935801545 | 2935803879 | 275 |
| 354 | iso_pu_bacteria | 2935810662 | 2935811797 | 275 |
| 355 | iso_pu_bacteria | 2935819856 | 2935824356 | 275 |
| 356 | iso_pu_bacteria | 2935827899 | 2935829682 | 275 |
| 357 | iso_pu_bacteria | 2935837841 | 2935842986 | 275 |
| 358 | iso_pu_bacteria | 2935847175 | 2935852499 | 275 |
| 359 | iso_pu_bacteria | 2935855204 | 2935862345 | 275 |
| 360 | iso_pu_bacteria | 2935864058 | 2935870480 | 275 |
| 361 | iso_pu_bacteria | 2935873716 | 2935881062 | 275 |
| 362 | iso_pu_bacteria | 2935883170 | 2935884185 | 275 |
| 363 | iso_pu_bacteria | 2935908558 | 2935912347 | 275 |
| 364 | iso_pu_bacteria | 2935916978 | 2935923979 | 275 |
| 365 | iso_pu_bacteria | 2935926038 | 2935929376 | 275 |
| 366 | iso_pu_bacteria | 2935934488 | 2935936007 | 275 |
| 367 | iso_pu_bacteria | 2935942939 | 2935949907 | 275 |
| 368 | iso_pu_bacteria | 2935951376 | 2935957327 | 275 |
| 369 | iso_pu_bacteria | 2935959822 | 2935962154 | 275 |
| 370 | iso_pu_bacteria | 2935967501 | 2935968358 | 275 |
| 371 | iso_pu_bacteria | 2935975950 | 2935976545 | 275 |
| 372 | iso_pu_bacteria | 2935984226 | 2935988009 | 275 |
| 373 | iso_pu_bacteria | 2935992306 | 2935993559 | 275 |
| 374 | iso_pu_bacteria | 2936002035 | 2936004455 | 275 |
| 375 | iso_pu_bacteria | 2936011229 | 2936018058 | 275 |
| 376 | iso_pu_bacteria | 2936019824 | 2936026532 | 275 |
| 377 | iso_pu_bacteria | 2936028420 | 2936035275 | 275 |
| 378 | iso_pu_bacteria | 2936037263 | 2936038380 | 275 |
| 379 | iso_pu_bacteria | 2936046547 | 2936053453 | 275 |
| 380 | iso_pu_bacteria | 2936055302 | 2936059434 | 275 |
| 381 | iso_pu_bacteria | 2940556831 | 2940561615 | 275 |
| 382 | iso_pu_bacteria | 2941507105 | 2941508060 | 275 |
| 383 | iso_pu_bacteria | 2941515067 | 2941515435 | 275 |
| 384 | iso_pu_bacteria | 2941523033 | 2941523990 | 275 |
| 385 | iso_pu_bacteria | 2941531003 | 2941533793 | 275 |
| 386 | iso_pu_bacteria | 2941538514 | 2941544210 | 275 |
| 387 | iso_pu_bacteria | 3005483717 | 3005485407 | 275 |
| 388 | iso_pu_bacteria | 3005506211 | 3005507218 | 275 |
| 389 | iso_pu_bacteria | 3005587118 | 3005594578 | 275 |
| 390 | iso_pu_bacteria | 3005594810 | 3005596652 | 275 |
| 391 | iso_pu_bacteria | 3005710791 | 3005712727 | 275 |
| 392 | iso_pu_bacteria | 3005718088 | 3005719777 | 275 |
| 393 | iso_pu_bacteria | 8006926726 | 8006933166 | 275 |
| 394 | iso_pu_bacteria | 8016511872 | 8016516323 | 275 |
| 395 | iso_pu_bacteria | 8016522445 | 8016523719 | 275 |
| 396 | iso_pu_bacteria | 8016530956 | 8016537243 | 275 |
| 397 | iso_pu_bacteria | 8016539877 | 8016541504 | 275 |
| 398 | iso_pu_bacteria | 8016548790 | 8016551749 | 275 |
| 399 | iso_pu_bacteria | 8016557553 | 8016560138 | 275 |
| 400 | iso_pu_bacteria | 8016566248 | 8016566896 | 275 |
| 401 | iso_pu_bacteria | 8016575299 | 8016579626 | 275 |
| 402 | iso_pu_bacteria | 8016583857 | 8016589243 | 275 |
| 403 | iso_pu_bacteria | 8016595262 | 8016598057 | 275 |
| 404 | iso_pu_bacteria | 8016603502 | 8016604196 | 275 |
| 405 | iso_pu_bacteria | 8016613128 | 8016620777 | 275 |
| 406 | iso_pu_bacteria | 8016622563 | 8016629209 | 275 |
| 407 | iso_pu_bacteria | 8017057580 | 8017060210 | 275 |
| 408 | iso_pu_bacteria | 8019530166 | 8019536932 | 275 |
| 409 | iso_pu_bacteria | 8019547302 | 8019548141 | 275 |
| 410 | iso_pu_bacteria | 8019576017 | 8019579729 | 275 |
| 411 | iso_pu_bacteria | 8019586578 | 8019587441 | 275 |
| 412 | iso_pu_bacteria | 8019608314 | 8019614636 | 275 |
| 413 | iso_pu_bacteria | 8019619141 | 8019625254 | 275 |
| 414 | iso_pu_bacteria | 8019629233 | 8019636927 | 275 |
| 415 | iso_pu_bacteria | 8019638758 | 8019642681 | 275 |
| 416 | iso_pu_bacteria | 8019648815 | 8019649908 | 275 |
| 417 | iso_pu_bacteria | 8019659431 | 8019664750 | 275 |
| 418 | iso_pu_bacteria | 8019668869 | 8019674332 | 275 |
| 419 | iso_pu_bacteria | 8019678201 | 8019681782 | 275 |
| 420 | iso_pu_bacteria | 8019687851 | 8019693997 | 275 |
| 421 | iso_pu_bacteria | 8055742211 | 8055749063 | 275 |
| 422 | iso_pu_bacteria | 8056967851 | 8056969916 | 275 |
| 423 | 3300021441 | Ga0213871_10016702 | Ga0213871_100167021 | 276 |
| 424 | 3300035111 | Ga0373923_0047140 | Ga0373923_0047140_303_1199 | 276 |
| 425 | 3300035117 | Ga0373953_0014080 | Ga0373953_0014080_96_992 | 276 |
| 426 | 3300035118 | Ga0373954_0033846 | Ga0373954_0033846_1336_2232 | 276 |
| 427 | 3300039447 | Ga0436361_0864922 | Ga0436361_0864922_1023_1925 | 276 |
| 428 | 3300039447 | Ga0436361_0985631 | Ga0436361_0985631_1899_2801 | 276 |
| 429 | 3300039453 | Ga0436362_0722869 | Ga0436362_0722869_554_1456 | 276 |
| 430 | 3300046454 | Ga0495592_0032248 | Ga0495592_0032248_965_1861 | 276 |
| 431 | 3300046462 | Ga0495651_0045396 | Ga0495651_0045396_2205_3101 | 276 |
| 432 | 3300046511 | Ga0495608_0025820 | Ga0495608_0025820_1081_1977 | 276 |
| 433 | 3300046536 | Ga0495587_0138874 | Ga0495587_0138874_478_1374 | 276 |
| 434 | 3300046559 | Ga0495667_0136629 | Ga0495667_0136629_671_1567 | 276 |
| 435 | 3300046680 | Ga0495646_0149256 | Ga0495646_0149256_147_1043 | 276 |
| 436 | 3300046689 | Ga0495613_0354177 | Ga0495613_0354177_68_964 | 276 |
| 437 | 3300047322 | Ga0495680_0039739 | Ga0495680_0039739_2135_3031 | 276 |
| 438 | 3300048088 | Ga0495602_0089280 | Ga0495602_0089280_362_1258 | 276 |
| 439 | 3300048905 | Ga0496102_0206350 | Ga0496102_0206350_203_1099 | 276 |
| 440 | 3300050509 | nmdc:mga0qj67_267_c1 | nmdc:mga0qj67_267_c1_9520_10422 | 276 |
| 441 | 3300004625 | Ga0055543_1003054 | Ga0055543_10030544 | 277 |
| 442 | 3300004625 | Ga0055543_1016904 | Ga0055543_10169041 | 277 |
| 443 | 3300005262 | Ga0065165_1002837 | Ga0065165_10028374 | 277 |
| 444 | 3300005262 | Ga0065165_1005269 | Ga0065165_10052694 | 277 |
| 445 | 3300007265 | Ga0099794_10046066 | Ga0099794_100460662 | 277 |
| 446 | 3300010375 | Ga0105239_10018834 | Ga0105239_100188343 | 277 |
| 447 | 3300025284 | Ga0209130_1027315 | Ga0209130_10273151 | 277 |
| 448 | 3300025302 | Ga0207426_1003307 | Ga0207426_10033074 | 277 |
| 449 | 3300044656 | Ga0466969_0116841 | Ga0466969_0116841_64_969 | 277 |
| 450 | 3300044684 | Ga0466966_0155124 | Ga0466966_0155124_59_964 | 277 |
| 451 | 3300005434 | Ga0070709_10001764 | Ga0070709_100017643 | 278 |
| 452 | 3300005435 | Ga0070714_100010698 | Ga0070714_1000106982 | 278 |
| 453 | 3300005437 | Ga0070710_10001695 | Ga0070710_100016954 | 278 |
| 454 | 3300005439 | Ga0070711_100002420 | Ga0070711_1000024204 | 278 |
| 455 | 3300025272 | Ga0209455_1018947 | Ga0209455_10189472 | 278 |
| 456 | 3300025898 | Ga0207692_10022479 | Ga0207692_100224791 | 278 |
| 457 | 3300025905 | Ga0207685_10026572 | Ga0207685_100265722 | 278 |
| 458 | 3300025906 | Ga0207699_10000553 | Ga0207699_100005533 | 278 |
| 459 | 3300025906 | Ga0207699_10036291 | Ga0207699_100362912 | 278 |
| 460 | 3300025916 | Ga0207663_10004445 | Ga0207663_100044452 | 278 |
| 461 | 3300025928 | Ga0207700_10043051 | Ga0207700_100430511 | 278 |
| 462 | 3300025939 | Ga0207665_10008007 | Ga0207665_100080076 | 278 |
| 463 | 3300027357 | Ga0209589_1000006 | Ga0209589_1000006308 | 278 |
| 464 | 3300027361 | Ga0209489_100007 | Ga0209489_100007308 | 278 |
| 465 | 3300027363 | Ga0209700_100008 | Ga0209700_100008308 | 278 |
| 466 | 3300046689 | Ga0495613_0117094 | Ga0495613_0117094_55_960 | 278 |
| 467 | 3300048924 | Ga0496121_0096082 | Ga0496121_0096082_1287_2189 | 278 |
| 468 | 3300048924 | Ga0496121_0257325 | Ga0496121_0257325_194_1171 | 278 |
| 469 | 3300048929 | Ga0496126_0240084 | Ga0496126_0240084_296_1198 | 278 |
| 470 | 3300053111 | Ga0500572_000927 | Ga0500572_000927_5137_6039 | 278 |
| 471 | 3300053153 | Ga0500616_0007514 | Ga0500616_0007514_4188_5093 | 278 |
| 472 | 3300053156 | Ga0500622_0004447 | Ga0500622_0004447_2815_3720 | 278 |
| 473 | 3300053163 | Ga0500639_013282 | Ga0500639_013282_1113_2015 | 278 |
| 474 | 3300053735 | Ga0500596_003569 | Ga0500596_003569_656_1558 | 278 |
| 475 | 3300003214 | JGI25165J46597_1004656 | JGI25165J46597_10046564 | 279 |
| 476 | 3300003215 | JGI25153J46596_10004824 | JGI25153J46596_100048243 | 279 |
| 477 | 3300003215 | JGI25153J46596_10009092 | JGI25153J46596_100090922 | 279 |
| 478 | 3300003215 | JGI25153J46596_10027971 | JGI25153J46596_100279712 | 279 |
| 479 | 3300003215 | JGI25153J46596_10028501 | JGI25153J46596_100285012 | 279 |
| 480 | 3300003354 | JGI25160J50197_1009693 | JGI25160J50197_10096934 | 279 |
| 481 | 3300003752 | Ga0055539_1003188 | Ga0055539_10031882 | 279 |
| 482 | 3300003771 | Ga0055526_1028525 | Ga0055526_10285252 | 279 |
| 483 | 3300003771 | Ga0055526_1029585 | Ga0055526_10295852 | 279 |
| 484 | 3300003794 | Ga0055531_10003265 | Ga0055531_1000326510 | 279 |
| 485 | 3300005262 | Ga0065165_1007564 | Ga0065165_10075642 | 279 |
| 486 | 3300005327 | Ga0070658_10019082 | Ga0070658_100190823 | 279 |
| 487 | 3300005329 | Ga0070683_100125277 | Ga0070683_1001252771 | 279 |
| 488 | 3300005344 | Ga0070661_100065700 | Ga0070661_1000657002 | 279 |
| 489 | 3300005347 | Ga0070668_100077330 | Ga0070668_1000773303 | 279 |
| 490 | 3300005347 | Ga0070668_100123936 | Ga0070668_1001239361 | 279 |
| 491 | 3300005353 | Ga0070669_100270897 | Ga0070669_1002708972 | 279 |
| 492 | 3300005355 | Ga0070671_100052057 | Ga0070671_1000520574 | 279 |
| 493 | 3300005367 | Ga0070667_100053721 | Ga0070667_1000537212 | 279 |
| 494 | 3300005367 | Ga0070667_100135306 | Ga0070667_1001353062 | 279 |
| 495 | 3300005455 | Ga0070663_100056464 | Ga0070663_1000564642 | 279 |
| 496 | 3300005455 | Ga0070663_100106968 | Ga0070663_1001069682 | 279 |
| 497 | 3300005530 | Ga0070679_100069331 | Ga0070679_1000693312 | 279 |
| 498 | 3300005535 | Ga0070684_100038257 | Ga0070684_1000382573 | 279 |
| 499 | 3300005539 | Ga0068853_100047394 | Ga0068853_1000473942 | 279 |
| 500 | 3300005548 | Ga0070665_100256281 | Ga0070665_1002562811 | 279 |
| 501 | 3300005563 | Ga0068855_100097468 | Ga0068855_1000974682 | 279 |
| 502 | 3300005577 | Ga0068857_100019266 | Ga0068857_1000192663 | 279 |
| 503 | 3300005578 | Ga0068854_100313128 | Ga0068854_1003131282 | 279 |
| 504 | 3300005618 | Ga0068864_100322688 | Ga0068864_1003226881 | 279 |
| 505 | 3300005834 | Ga0068851_10161030 | Ga0068851_101610302 | 279 |
| 506 | 3300005844 | Ga0068862_100493908 | Ga0068862_1004939082 | 279 |
| 507 | 3300006042 | Ga0075368_10034252 | Ga0075368_100342522 | 279 |
| 508 | 3300006051 | Ga0075364_10062781 | Ga0075364_100627812 | 279 |
| 509 | 3300006178 | Ga0075367_10098451 | Ga0075367_100984511 | 279 |
| 510 | 3300006178 | Ga0075367_10152756 | Ga0075367_101527562 | 279 |
| 511 | 3300006186 | Ga0075369_10010725 | Ga0075369_100107253 | 279 |
| 512 | 3300006195 | Ga0075366_10034561 | Ga0075366_100345612 | 279 |
| 513 | 3300006941 | Ga0099825_1020431 | Ga0099825_10204314 | 279 |
| 514 | 3300006944 | Ga0099823_1063709 | Ga0099823_10637092 | 279 |
| 515 | 3300009093 | Ga0105240_10014565 | Ga0105240_100145653 | 279 |
| 516 | 3300009093 | Ga0105240_10076395 | Ga0105240_100763952 | 279 |
| 517 | 3300009177 | Ga0105248_10366124 | Ga0105248_103661242 | 279 |
| 518 | 3300009545 | Ga0105237_10004158 | Ga0105237_1000415812 | 279 |
| 519 | 3300009545 | Ga0105237_10005728 | Ga0105237_100057285 | 279 |
| 520 | 3300009545 | Ga0105237_10030097 | Ga0105237_100300975 | 279 |
| 521 | 3300010375 | Ga0105239_10097833 | Ga0105239_100978333 | 279 |
| 522 | 3300010375 | Ga0105239_10213909 | Ga0105239_102139093 | 279 |
| 523 | 3300013104 | Ga0157370_10099074 | Ga0157370_100990742 | 279 |
| 524 | 3300013105 | Ga0157369_10005591 | Ga0157369_100055915 | 279 |
| 525 | 3300014969 | Ga0157376_10175757 | Ga0157376_101757572 | 279 |
| 526 | 3300020082 | Ga0206353_10981988 | Ga0206353_109819883 | 279 |
| 527 | 3300021320 | Ga0214544_1000026 | Ga0214544_100002651 | 279 |
| 528 | 3300021321 | Ga0214542_1000025 | Ga0214542_1000025110 | 279 |
| 529 | 3300021321 | Ga0214542_1030681 | Ga0214542_10306811 | 279 |
| 530 | 3300021324 | Ga0214545_1000014 | Ga0214545_100001468 | 279 |
| 531 | 3300021324 | Ga0214545_1025563 | Ga0214545_10255632 | 279 |
| 532 | 3300021327 | Ga0214543_1000034 | Ga0214543_1000034109 | 279 |
| 533 | 3300021358 | Ga0213873_10010925 | Ga0213873_100109252 | 279 |
| 534 | 3300021384 | Ga0213876_10003720 | Ga0213876_100037204 | 279 |
| 535 | 3300021384 | Ga0213876_10069659 | Ga0213876_100696592 | 279 |
| 536 | 3300025245 | Ga0207425_1008458 | Ga0207425_10084581 | 279 |
| 537 | 3300025253 | Ga0209677_101109 | Ga0209677_1011093 | 279 |
| 538 | 3300025254 | Ga0209148_1000250 | Ga0209148_100025068 | 279 |
| 539 | 3300025261 | Ga0209233_1001802 | Ga0209233_10018023 | 279 |
| 540 | 3300025272 | Ga0209455_1002768 | Ga0209455_10027683 | 279 |
| 541 | 3300025295 | Ga0209564_1009379 | Ga0209564_10093794 | 279 |
| 542 | 3300025295 | Ga0209564_1019544 | Ga0209564_10195442 | 279 |
| 543 | 3300025297 | Ga0209758_1000141 | Ga0209758_100014162 | 279 |
| 544 | 3300025297 | Ga0209758_1000324 | Ga0209758_100032447 | 279 |
| 545 | 3300025297 | Ga0209758_1000476 | Ga0209758_100047610 | 279 |
| 546 | 3300025297 | Ga0209758_1003697 | Ga0209758_100369715 | 279 |
| 547 | 3300025297 | Ga0209758_1005554 | Ga0209758_10055543 | 279 |
| 548 | 3300025299 | Ga0209256_1017836 | Ga0209256_10178362 | 279 |
| 549 | 3300025302 | Ga0207426_1000523 | Ga0207426_100052351 | 279 |
| 550 | 3300025302 | Ga0207426_1030127 | Ga0207426_10301271 | 279 |
| 551 | 3300025303 | Ga0209051_1027196 | Ga0209051_10271962 | 279 |
| 552 | 3300025304 | Ga0209257_1004661 | Ga0209257_10046613 | 279 |
| 553 | 3300025304 | Ga0209257_1066684 | Ga0209257_10666841 | 279 |
| 554 | 3300025904 | Ga0207647_10016859 | Ga0207647_100168594 | 279 |
| 555 | 3300025912 | Ga0207707_10000455 | Ga0207707_1000045528 | 279 |
| 556 | 3300025913 | Ga0207695_10000062 | Ga0207695_10000062176 | 279 |
| 557 | 3300025913 | Ga0207695_10082713 | Ga0207695_100827132 | 279 |
| 558 | 3300025914 | Ga0207671_10007674 | Ga0207671_100076744 | 279 |
| 559 | 3300025914 | Ga0207671_10040071 | Ga0207671_100400712 | 279 |
| 560 | 3300025917 | Ga0207660_10005365 | Ga0207660_100053652 | 279 |
| 561 | 3300025921 | Ga0207652_10001894 | Ga0207652_1000189418 | 279 |
| 562 | 3300025923 | Ga0207681_10154110 | Ga0207681_101541101 | 279 |
| 563 | 3300025924 | Ga0207694_10010392 | Ga0207694_100103925 | 279 |
| 564 | 3300025924 | Ga0207694_10203725 | Ga0207694_102037252 | 279 |
| 565 | 3300025932 | Ga0207690_10403284 | Ga0207690_104032841 | 279 |
| 566 | 3300025933 | Ga0207706_10069001 | Ga0207706_100690012 | 279 |
| 567 | 3300025941 | Ga0207711_10424692 | Ga0207711_104246922 | 279 |
| 568 | 3300025944 | Ga0207661_10081797 | Ga0207661_100817971 | 279 |
| 569 | 3300026067 | Ga0207678_10061509 | Ga0207678_100615092 | 279 |
| 570 | 3300026067 | Ga0207678_10074772 | Ga0207678_100747722 | 279 |
| 571 | 3300026116 | Ga0207674_10020652 | Ga0207674_100206525 | 279 |
| 572 | 3300026121 | Ga0207683_10359372 | Ga0207683_103593721 | 279 |
| 573 | 3300026142 | Ga0207698_10032705 | Ga0207698_100327053 | 279 |
| 574 | 3300027296 | Ga0209389_1000004 | Ga0209389_100000490 | 279 |
| 575 | 3300027361 | Ga0209489_110994 | Ga0209489_1109944 | 279 |
| 576 | 3300027363 | Ga0209700_100013 | Ga0209700_100013176 | 279 |
| 577 | 3300027866 | Ga0209813_10000927 | Ga0209813_100009277 | 279 |
| 578 | 3300028379 | Ga0268266_10050511 | Ga0268266_100505114 | 279 |
| 579 | 3300028800 | Ga0265338_10264055 | Ga0265338_102640551 | 279 |
| 580 | 3300033180 | Ga0307510_10074167 | Ga0307510_100741672 | 279 |
| 581 | 3300033180 | Ga0307510_10169646 | Ga0307510_101696462 | 279 |
| 582 | 3300035118 | Ga0373954_0036855 | Ga0373954_0036855_134_1042 | 279 |
| 583 | 3300035119 | Ga0373956_0007755 | Ga0373956_0007755_2072_2980 | 279 |
| 584 | 3300035120 | Ga0373957_0000736 | Ga0373957_0000736_477_1385 | 279 |
| 585 | 3300035172 | Ga0373955_0095837 | Ga0373955_0095837_654_1562 | 279 |
| 586 | 3300035410 | Ga0373924_0013953 | Ga0373924_0013953_59_967 | 279 |
| 587 | 3300037068 | Ga0373925_0375315 | Ga0373925_0375315_181_1089 | 279 |
| 588 | 3300037471 | Ga0395905_0010894 | Ga0395905_0010894_6805_7710 | 279 |
| 589 | 3300037471 | Ga0395905_0025659 | Ga0395905_0025659_3677_4582 | 279 |
| 590 | 3300037853 | Ga0436364_1394155 | Ga0436364_1394155_1065_1970 | 279 |
| 591 | 3300039437 | Ga0436365_0062390 | Ga0436365_0062390_627_1532 | 279 |
| 592 | 3300039437 | Ga0436365_0207937 | Ga0436365_0207937_6727_7632 | 279 |
| 593 | 3300039437 | Ga0436365_1558193 | Ga0436365_1558193_152_1057 | 279 |
| 594 | 3300039453 | Ga0436362_0880762 | Ga0436362_0880762_545_1450 | 279 |
| 595 | 3300041498 | Ga0451841_0644879 | Ga0451841_0644879_124_1029 | 279 |
| 596 | 3300042012 | Ga0439455_0032503 | Ga0439455_0032503_66_971 | 279 |
| 597 | 3300044656 | Ga0466969_0014623 | Ga0466969_0014623_2268_3173 | 279 |
| 598 | 3300044656 | Ga0466969_0133445 | Ga0466969_0133445_175_1080 | 279 |
| 599 | 3300044658 | Ga0466972_0000884 | Ga0466972_0000884_6101_7006 | 279 |
| 600 | 3300044683 | Ga0466965_0028587 | Ga0466965_0028587_237_1142 | 279 |
| 601 | 3300044684 | Ga0466966_0000419 | Ga0466966_0000419_10299_11204 | 279 |
| 602 | 3300044693 | Ga0466961_0000020 | Ga0466961_0000020_73411_74316 | 279 |
| 603 | 3300044694 | Ga0466963_0021740 | Ga0466963_0021740_1783_2688 | 279 |
| 604 | 3300044735 | Ga0466968_0008072 | Ga0466968_0008072_2583_3488 | 279 |
| 605 | 3300044735 | Ga0466968_0036874 | Ga0466968_0036874_1054_1959 | 279 |
| 606 | 3300044842 | Ga0466957_0065416 | Ga0466957_0065416_113_1018 | 279 |
| 607 | 3300044901 | Ga0466960_0009778 | Ga0466960_0009778_904_1809 | 279 |
| 608 | 3300045049 | Ga0466959_0015465 | Ga0466959_0015465_2070_2975 | 279 |
| 609 | 3300045836 | Ga0466958_0111198 | Ga0466958_0111198_133_1038 | 279 |
| 610 | 3300045976 | Ga0466967_0035765 | Ga0466967_0035765_1654_2559 | 279 |
| 611 | 3300046454 | Ga0495592_0033017 | Ga0495592_0033017_2032_2937 | 279 |
| 612 | 3300046454 | Ga0495592_0074237 | Ga0495592_0074237_1375_2283 | 279 |
| 613 | 3300046459 | Ga0495629_0001285 | Ga0495629_0001285_16708_17613 | 279 |
| 614 | 3300046459 | Ga0495629_0005714 | Ga0495629_0005714_2777_3685 | 279 |
| 615 | 3300046460 | Ga0495638_0004256 | Ga0495638_0004256_7246_8151 | 279 |
| 616 | 3300046462 | Ga0495651_0002943 | Ga0495651_0002943_491_1396 | 279 |
| 617 | 3300046463 | Ga0495653_0003792 | Ga0495653_0003792_124_1032 | 279 |
| 618 | 3300046463 | Ga0495653_0160928 | Ga0495653_0160928_630_1535 | 279 |
| 619 | 3300046477 | Ga0495664_0029166 | Ga0495664_0029166_1213_2118 | 279 |
| 620 | 3300046506 | Ga0495583_0086990 | Ga0495583_0086990_223_1128 | 279 |
| 621 | 3300046507 | Ga0495606_0018195 | Ga0495606_0018195_599_1504 | 279 |
| 622 | 3300046511 | Ga0495608_0034226 | Ga0495608_0034226_2051_2959 | 279 |
| 623 | 3300046511 | Ga0495608_0070527 | Ga0495608_0070527_827_1732 | 279 |
| 624 | 3300046512 | Ga0495610_0084059 | Ga0495610_0084059_477_1382 | 279 |
| 625 | 3300046516 | Ga0495628_0225902 | Ga0495628_0225902_186_1094 | 279 |
| 626 | 3300046519 | Ga0495632_0070855 | Ga0495632_0070855_327_1232 | 279 |
| 627 | 3300046522 | Ga0495643_0017154 | Ga0495643_0017154_3008_3913 | 279 |
| 628 | 3300046529 | Ga0495652_0003125 | Ga0495652_0003125_6939_7844 | 279 |
| 629 | 3300046533 | Ga0495640_0006193 | Ga0495640_0006193_5437_6342 | 279 |
| 630 | 3300046533 | Ga0495640_0013630 | Ga0495640_0013630_2447_3355 | 279 |
| 631 | 3300046533 | Ga0495640_0077352 | Ga0495640_0077352_369_1274 | 279 |
| 632 | 3300046536 | Ga0495587_0040557 | Ga0495587_0040557_1065_1970 | 279 |
| 633 | 3300046538 | Ga0495609_0042687 | Ga0495609_0042687_342_1247 | 279 |
| 634 | 3300046543 | Ga0495645_0030962 | Ga0495645_0030962_2845_3753 | 279 |
| 635 | 3300046543 | Ga0495645_0291132 | Ga0495645_0291132_145_1050 | 279 |
| 636 | 3300046557 | Ga0495622_0022704 | Ga0495622_0022704_336_1241 | 279 |
| 637 | 3300046559 | Ga0495667_0006907 | Ga0495667_0006907_6763_7668 | 279 |
| 638 | 3300046559 | Ga0495667_0129442 | Ga0495667_0129442_278_1186 | 279 |
| 639 | 3300046616 | Ga0495668_0131622 | Ga0495668_0131622_278_1183 | 279 |
| 640 | 3300046642 | Ga0495634_0027819 | Ga0495634_0027819_2877_3782 | 279 |
| 641 | 3300046642 | Ga0495634_0030692 | Ga0495634_0030692_503_1411 | 279 |
| 642 | 3300046648 | Ga0495611_0032459 | Ga0495611_0032459_583_1488 | 279 |
| 643 | 3300046663 | Ga0495635_0002149 | Ga0495635_0002149_12320_13228 | 279 |
| 644 | 3300046663 | Ga0495635_0002910 | Ga0495635_0002910_3159_4064 | 279 |
| 645 | 3300046663 | Ga0495635_0077127 | Ga0495635_0077127_1167_2072 | 279 |
| 646 | 3300046674 | Ga0495588_0008982 | Ga0495588_0008982_1553_2458 | 279 |
| 647 | 3300046675 | Ga0495657_0002869 | Ga0495657_0002869_7766_8671 | 279 |
| 648 | 3300046675 | Ga0495657_0025540 | Ga0495657_0025540_1923_2831 | 279 |
| 649 | 3300046678 | Ga0495599_0049823 | Ga0495599_0049823_1210_2115 | 279 |
| 650 | 3300046679 | Ga0495623_0065880 | Ga0495623_0065880_177_1082 | 279 |
| 651 | 3300046679 | Ga0495623_0186665 | Ga0495623_0186665_91_999 | 279 |
| 652 | 3300046680 | Ga0495646_0091179 | Ga0495646_0091179_812_1720 | 279 |
| 653 | 3300046680 | Ga0495646_0133506 | Ga0495646_0133506_103_1008 | 279 |
| 654 | 3300046694 | Ga0495649_0040585 | Ga0495649_0040585_1410_2315 | 279 |
| 655 | 3300046809 | Ga0495600_0004830 | Ga0495600_0004830_6468_7373 | 279 |
| 656 | 3300046809 | Ga0495600_0059270 | Ga0495600_0059270_1125_2030 | 279 |
| 657 | 3300047317 | Ga0495604_0007695 | Ga0495604_0007695_6483_7388 | 279 |
| 658 | 3300047317 | Ga0495604_0007712 | Ga0495604_0007712_552_1457 | 279 |
| 659 | 3300047317 | Ga0495604_0089021 | Ga0495604_0089021_238_1146 | 279 |
| 660 | 3300047319 | Ga0495674_0044542 | Ga0495674_0044542_834_1742 | 279 |
| 661 | 3300047319 | Ga0495674_0048975 | Ga0495674_0048975_1996_2901 | 279 |
| 662 | 3300047321 | Ga0495676_0089041 | Ga0495676_0089041_1349_2254 | 279 |
| 663 | 3300047321 | Ga0495676_0139333 | Ga0495676_0139333_731_1636 | 279 |
| 664 | 3300047322 | Ga0495680_0009327 | Ga0495680_0009327_309_1217 | 279 |
| 665 | 3300047322 | Ga0495680_0010422 | Ga0495680_0010422_945_1850 | 279 |
| 666 | 3300047323 | Ga0495683_0029211 | Ga0495683_0029211_693_1598 | 279 |
| 667 | 3300047443 | Ga0495687_006414 | Ga0495687_006414_638_1543 | 279 |
| 668 | 3300047444 | Ga0495675_0006349 | Ga0495675_0006349_284_1189 | 279 |
| 669 | 3300047469 | Ga0495673_0104085 | Ga0495673_0104085_175_1080 | 279 |
| 670 | 3300047471 | Ga0495684_0136904 | Ga0495684_0136904_254_1162 | 279 |
| 671 | 3300047673 | Ga0495593_0022030 | Ga0495593_0022030_1838_2746 | 279 |
| 672 | 3300048903 | Ga0496100_0049703 | Ga0496100_0049703_1702_2607 | 279 |
| 673 | 3300048905 | Ga0496102_0149129 | Ga0496102_0149129_1076_1981 | 279 |
| 674 | 3300048906 | Ga0496103_0006040 | Ga0496103_0006040_3559_4464 | 279 |
| 675 | 3300048908 | Ga0496105_0007938 | Ga0496105_0007938_601_1506 | 279 |
| 676 | 3300048908 | Ga0496105_0114424 | Ga0496105_0114424_359_1264 | 279 |
| 677 | 3300048908 | Ga0496105_0267429 | Ga0496105_0267429_413_1318 | 279 |
| 678 | 3300048909 | Ga0496106_0030606 | Ga0496106_0030606_1525_2430 | 279 |
| 679 | 3300048910 | Ga0496107_0115896 | Ga0496107_0115896_935_1840 | 279 |
| 680 | 3300048910 | Ga0496107_0124522 | Ga0496107_0124522_108_1013 | 279 |
| 681 | 3300048912 | Ga0496109_0081491 | Ga0496109_0081491_1300_2205 | 279 |
| 682 | 3300048913 | Ga0496110_0167420 | Ga0496110_0167420_672_1577 | 279 |
| 683 | 3300048913 | Ga0496110_0343158 | Ga0496110_0343158_428_1333 | 279 |
| 684 | 3300048915 | Ga0496112_0009780 | Ga0496112_0009780_250_1155 | 279 |
| 685 | 3300048918 | Ga0496115_0014720 | Ga0496115_0014720_2780_3685 | 279 |
| 686 | 3300048920 | Ga0496117_0164011 | Ga0496117_0164011_357_1262 | 279 |
| 687 | 3300048921 | Ga0496118_0063520 | Ga0496118_0063520_706_1611 | 279 |
| 688 | 3300048922 | Ga0496119_0052645 | Ga0496119_0052645_811_1716 | 279 |
| 689 | 3300048923 | Ga0496120_0030158 | Ga0496120_0030158_901_1806 | 279 |
| 690 | 3300048924 | Ga0496121_0000894 | Ga0496121_0000894_38624_39529 | 279 |
| 691 | 3300048924 | Ga0496121_0045740 | Ga0496121_0045740_866_1771 | 279 |
| 692 | 3300048928 | Ga0496125_0066809 | Ga0496125_0066809_1691_2596 | 279 |
| 693 | 3300048929 | Ga0496126_0033507 | Ga0496126_0033507_1255_2160 | 279 |
| 694 | 3300048929 | Ga0496126_0072248 | Ga0496126_0072248_1817_2722 | 279 |
| 695 | 3300048929 | Ga0496126_0296968 | Ga0496126_0296968_250_1155 | 279 |
| 696 | 3300050492 | nmdc:mga0yw44_169146_c1 | nmdc:mga0yw44_169146_c1_471_1376 | 279 |
| 697 | 3300050493 | nmdc:mga0k408_23356_c1 | nmdc:mga0k408_23356_c1_1348_2253 | 279 |
| 698 | 3300050493 | nmdc:mga0k408_28176_c1 | nmdc:mga0k408_28176_c1_1043_1948 | 279 |
| 699 | 3300050494 | nmdc:mga06z11_78529_c1 | nmdc:mga06z11_78529_c1_253_1158 | 279 |
| 700 | 3300050495 | nmdc:mga04h51_977_c1 | nmdc:mga04h51_977_c1_4868_5773 | 279 |
| 701 | 3300050512 | nmdc:mga0n895_291700_c1 | nmdc:mga0n895_291700_c1_426_1331 | 279 |
| 702 | 3300050513 | nmdc:mga0rr50_33962_c1 | nmdc:mga0rr50_33962_c1_1770_2675 | 279 |
| 703 | 3300050516 | nmdc:mga0sz30_37157_c1 | nmdc:mga0sz30_37157_c1_528_1433 | 279 |
| 704 | 3300053077 | Ga0495601_0034782 | Ga0495601_0034782_189_1097 | 279 |
| 705 | 3300053084 | Ga0495595_0022452 | Ga0495595_0022452_1702_2610 | 279 |
| 706 | 3300053085 | Ga0495619_0022381 | Ga0495619_0022381_2327_3235 | 279 |
| 707 | 3300053087 | Ga0500643_000018 | Ga0500643_000018_292587_293492 | 279 |
| 708 | 3300053093 | Ga0500651_0116898 | Ga0500651_0116898_680_1585 | 279 |
| 709 | 3300053094 | Ga0500566_0018834 | Ga0500566_0018834_1824_2729 | 279 |
| 710 | 3300053103 | Ga0500555_001894 | Ga0500555_001894_5067_5972 | 279 |
| 711 | 3300053104 | Ga0500556_0107433 | Ga0500556_0107433_136_1041 | 279 |
| 712 | 3300053105 | Ga0500557_000008 | Ga0500557_000008_110688_111593 | 279 |
| 713 | 3300053109 | Ga0500569_000332 | Ga0500569_000332_4040_4945 | 279 |
| 714 | 3300053111 | Ga0500572_023508 | Ga0500572_023508_366_1271 | 279 |
| 715 | 3300053116 | Ga0500592_002606 | Ga0500592_002606_1498_2403 | 279 |
| 716 | 3300053119 | Ga0500595_021071 | Ga0500595_021071_39_944 | 279 |
| 717 | 3300053121 | Ga0500607_007866 | Ga0500607_007866_657_1562 | 279 |
| 718 | 3300053122 | Ga0500608_136535 | Ga0500608_136535_17_922 | 279 |
| 719 | 3300053123 | Ga0500614_023246 | Ga0500614_023246_417_1322 | 279 |
| 720 | 3300053130 | Ga0500642_0000425 | Ga0500642_0000425_11428_12333 | 279 |
| 721 | 3300053139 | Ga0500568_0017296 | Ga0500568_0017296_1621_2526 | 279 |
| 722 | 3300053146 | Ga0500588_0100285 | Ga0500588_0100285_55_960 | 279 |
| 723 | 3300053177 | Ga0500636_0001226 | Ga0500636_0001226_11344_12249 | 279 |
| 724 | 3300053737 | Ga0500601_000920 | Ga0500601_000920_2531_3436 | 279 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1nrw-assembly1.cif.gz_A | the structure of a haloacid dehalogenase-like hydrolase from b. subtilis | 0.9431 | 202 | 256 |
| 4bbj-assembly1.cif.gz_A | copper-transporting pib-atpase in complex with beryllium fluoride representing the e2p state | 0.8699 | 151 | 270 |
| 2yj4-assembly1.cif.gz_A | conformational changes in the catalytic domain of the cpx-atpase copb- b upon nucleotide binding | 0.8547 | 148 | 269 |
| 7si6-assembly1.cif.gz_A | structure of atp7b in state 1 | 0.8515 | 151 | 270 |
| 7si3-assembly1.cif.gz_A | consensus structure of atp7b | 0.8508 | 151 | 270 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9UTA6_18_291_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.9056 | 203 | 256 | 3.40.50.1000 |
| af_Q2FWA2_5_277_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8865 | 203 | 259 | 3.40.50.1000 |
| af_A0A1D6GSK2_41_144_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8756 | 222 | 253 | 3.40.50.1000 |
| af_P0AGB0_183_315_3.40.50.1000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8626 | 131 | 267 | 3.40.50.1000 |
| 3m1yC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like | 0.8564 | 85 | 265 | 3.40.50.1000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2UJY9-F1-model_v4 | deleted | 0.9777 | 155 | 267 |
|
| AF-A0A2N2SD60-F1-model_v4 | phosphoserine phosphatase (EC 3.1.3.3) | 0.9723 | 158 | 267 |
GO:0000287
GO:0005737 GO:0006564 GO:0036424 |
| AF-A0A527FV55-F1-model_v4 | deleted | 0.9721 | 147 | 278 |
|
| AF-A0A849IKB7-F1-model_v4 | phosphoserine phosphatase (EC 3.1.3.3) | 0.9713 | 170 | 267 |
GO:0000287
GO:0005737 GO:0006564 GO:0036424 |
| AF-A0A3B8Q769-F1-model_v4 | phosphoserine phosphatase (EC 3.1.3.3) | 0.9708 | 181 | 267 |
GO:0000287
GO:0005737 GO:0006564 GO:0036424 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar