F477586
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 724 | 367 | 707 | 265 |
Family's Representative Sequence
| Representative Sequence | 3300060353|Ga0501082_0273708|Ga0501082_0273708_257_1162 |
| Length | 301 |
| Sequence | MSATLRVTVLGCGSSPGVPRIGNDWGACDPNEPRNRRLRCSILLERMEEGGVTRALVDTGPDVREQLLAAKVGTLDGVVYTHSHADHTHGIDDLRAFWQNTKRLVDVYADAMTFDRLNAAFGYCFAAPPGSSYPPILKHRPIAAGTPFAIDGAGGLLTVVPFAQVHGDIETLGLRVGAFAYSCDVSGLSDTAQSVLRGLDVWIVDALRYHPHPSHFSVNESLQWIDRVKPKHAVLTHMHIDLDYQTLRRTLPTGVEPAYDGMRIEAAAVRPERMSGFASRTVSGCVPSKITRQFRPAAFAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 3 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 4 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 5 | 2828305725 | Xanthobacter tagetidis DSM 11105 | Isolate | Unclassified |
| 6 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 7 | 2889306138 | Methylobacterium sp. PvR107 | Isolate | Rhizosphere |
| 8 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 9 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 10 | 2902405164 | Methylobacterium sp. P1-11 | Isolate | Unclassified |
| 11 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 12 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 13 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 14 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 15 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 16 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 71 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 72 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 98 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 110 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 165 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 166 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 168 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 170 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 171 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 175 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 179 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 182 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 183 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 185 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 197 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 199 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 201 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 202 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 204 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 205 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 206 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 207 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 208 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 209 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 210 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 215 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 216 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 219 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 283 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 284 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 285 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 286 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 287 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 288 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 289 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 290 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 291 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 292 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 293 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 294 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 295 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 296 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 297 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 298 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 299 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 321 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 322 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 323 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 324 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 325 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 326 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 327 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 331 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 335 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 336 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 337 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 352 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 354 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 355 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 356 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 357 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 358 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 359 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 360 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 361 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 362 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 363 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 365 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 366 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 367 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.51 |
| Metatranscriptomes | 0.14 |
| Isolates | 2.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.14 |
| Nodule | 0.41 |
| Rhizoplane | 9.25 |
| Rhizosphere | 82.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3148643 | 2162886007 | Bacteria | 925 |
| 2 | JGI25404J52841_10012620 | 3300003659 | Bacteria | 1831 |
| 3 | Ga0055524_1009044 | 3300003775 | Bacteria | 4087 |
| 4 | Ga0065704_10011146 | 3300005289 | Bacteria | 3784 |
| 5 | Ga0065707_10086855 | 3300005295 | Bacteria | 5274 |
| 6 | Ga0065707_10232668 | 3300005295 | Bacteria | 1175 |
| 7 | Ga0070658_10074784 | 3300005327 | Bacteria | 2778 |
| 8 | Ga0070658_10207048 | 3300005327 | Bacteria | 1656 |
| 9 | Ga0070683_100372946 | 3300005329 | Unclassified | 1359 |
| 10 | Ga0070666_10012760 | 3300005335 | Bacteria | 5312 |
| 11 | Ga0070680_100010440 | 3300005336 | Bacteria | 7161 |
| 12 | Ga0070680_100344497 | 3300005336 | Bacteria | 1267 |
| 13 | Ga0070682_100012105 | 3300005337 | Bacteria | 4937 |
| 14 | Ga0070682_100058723 | 3300005337 | Bacteria | 2427 |
| 15 | Ga0068868_100016541 | 3300005338 | Bacteria | 5481 |
| 16 | Ga0070660_100133662 | 3300005339 | Bacteria | 1987 |
| 17 | Ga0070660_100217926 | 3300005339 | Bacteria | 1551 |
| 18 | Ga0070689_100123406 | 3300005340 | Bacteria | 2071 |
| 19 | Ga0070669_100366078 | 3300005353 | Bacteria | 1173 |
| 20 | Ga0070671_100424108 | 3300005355 | Bacteria | 1139 |
| 21 | Ga0070674_100256515 | 3300005356 | Bacteria | 1376 |
| 22 | Ga0070673_100538415 | 3300005364 | Bacteria | 1060 |
| 23 | Ga0070659_100008759 | 3300005366 | Bacteria | 7406 |
| 24 | Ga0070659_100343138 | 3300005366 | Bacteria | 1252 |
| 25 | Ga0070659_100446356 | 3300005366 | Bacteria | 1097 |
| 26 | Ga0070667_100036594 | 3300005367 | Bacteria | 4115 |
| 27 | Ga0070667_100046824 | 3300005367 | Bacteria | 3638 |
| 28 | Ga0070667_100203743 | 3300005367 | Bacteria | 1756 |
| 29 | Ga0070714_100026165 | 3300005435 | Bacteria | 4820 |
| 30 | Ga0070714_100111798 | 3300005435 | Bacteria | 2420 |
| 31 | Ga0070713_100001334 | 3300005436 | Bacteria | 15775 |
| 32 | Ga0070713_100010460 | 3300005436 | Bacteria | 6700 |
| 33 | Ga0070713_100022406 | 3300005436 | Bacteria | 4882 |
| 34 | Ga0070713_100546771 | 3300005436 | Bacteria | 1096 |
| 35 | Ga0070710_10034315 | 3300005437 | Bacteria | 2760 |
| 36 | Ga0070710_10060442 | 3300005437 | Bacteria | 2156 |
| 37 | Ga0070710_10198065 | 3300005437 | Bacteria | 1266 |
| 38 | Ga0070705_100111701 | 3300005440 | Bacteria | 1747 |
| 39 | Ga0070694_100201447 | 3300005444 | Bacteria | 1484 |
| 40 | Ga0070708_100170066 | 3300005445 | Bacteria | 2034 |
| 41 | Ga0070663_100033099 | 3300005455 | Bacteria | 3568 |
| 42 | Ga0070663_100140935 | 3300005455 | Bacteria | 1841 |
| 43 | Ga0070678_100283137 | 3300005456 | Bacteria | 1403 |
| 44 | Ga0070662_100342898 | 3300005457 | Bacteria | 1223 |
| 45 | Ga0070681_10014737 | 3300005458 | Bacteria | 7772 |
| 46 | Ga0070681_10019210 | 3300005458 | Bacteria | 6840 |
| 47 | Ga0070681_10355447 | 3300005458 | Bacteria | 1375 |
| 48 | Ga0070707_100545999 | 3300005468 | Bacteria | 1121 |
| 49 | Ga0070679_100014161 | 3300005530 | Bacteria | 7651 |
| 50 | Ga0070679_100071061 | 3300005530 | Bacteria | 3471 |
| 51 | Ga0070679_100072922 | 3300005530 | Bacteria | 3425 |
| 52 | Ga0070679_100090176 | 3300005530 | Bacteria | 3054 |
| 53 | Ga0070679_100220086 | 3300005530 | Bacteria | 1860 |
| 54 | Ga0070679_100272100 | 3300005530 | Bacteria | 1648 |
| 55 | Ga0070684_100080641 | 3300005535 | Bacteria | 2879 |
| 56 | Ga0070684_100085934 | 3300005535 | Bacteria | 2791 |
| 57 | Ga0068853_100012299 | 3300005539 | Bacteria | 6960 |
| 58 | Ga0068853_100340757 | 3300005539 | Bacteria | 1393 |
| 59 | Ga0070695_100113809 | 3300005545 | Bacteria | 1840 |
| 60 | Ga0070695_100120402 | 3300005545 | Bacteria | 1795 |
| 61 | Ga0070696_100074129 | 3300005546 | Bacteria | 2399 |
| 62 | Ga0070693_100080219 | 3300005547 | Bacteria | 1944 |
| 63 | Ga0070665_100263611 | 3300005548 | Bacteria | 1724 |
| 64 | Ga0068855_100040468 | 3300005563 | Bacteria | 5532 |
| 65 | Ga0068855_100053478 | 3300005563 | Bacteria | 4750 |
| 66 | Ga0070664_100350466 | 3300005564 | Bacteria | 1343 |
| 67 | Ga0068857_100109762 | 3300005577 | Bacteria | 2479 |
| 68 | Ga0068856_100365364 | 3300005614 | Bacteria | 1462 |
| 69 | Ga0070702_100008860 | 3300005615 | Bacteria | 4895 |
| 70 | Ga0070702_100281733 | 3300005615 | Bacteria | 1142 |
| 71 | Ga0068864_100577944 | 3300005618 | Bacteria | 1088 |
| 72 | Ga0068866_10006292 | 3300005718 | Bacteria | 4943 |
| 73 | Ga0068861_100159895 | 3300005719 | Bacteria | 1857 |
| 74 | Ga0068858_100066767 | 3300005842 | Bacteria | 3331 |
| 75 | Ga0068858_100075971 | 3300005842 | Bacteria | 3121 |
| 76 | Ga0068858_100082519 | 3300005842 | Bacteria | 2988 |
| 77 | Ga0068860_100252508 | 3300005843 | Bacteria | 1718 |
| 78 | Ga0081455_10006367 | 3300005937 | Bacteria | 12673 |
| 79 | Ga0081540_1000092 | 3300005983 | Bacteria | 94188 |
| 80 | Ga0070717_10010099 | 3300006028 | Bacteria | 7109 |
| 81 | Ga0070717_10144372 | 3300006028 | Bacteria | 2055 |
| 82 | Ga0070717_10149331 | 3300006028 | Bacteria | 2021 |
| 83 | Ga0075368_10113374 | 3300006042 | Bacteria | 1119 |
| 84 | Ga0075363_100035266 | 3300006048 | Bacteria | 2617 |
| 85 | Ga0075432_10005920 | 3300006058 | Bacteria | 4160 |
| 86 | Ga0070715_10016048 | 3300006163 | Bacteria | 2806 |
| 87 | Ga0070712_100011837 | 3300006175 | Bacteria | 5542 |
| 88 | Ga0075367_10101239 | 3300006178 | Bacteria | 1761 |
| 89 | Ga0075369_10099478 | 3300006186 | Bacteria | 1304 |
| 90 | Ga0075366_10145078 | 3300006195 | Bacteria | 1436 |
| 91 | Ga0097621_100078050 | 3300006237 | Bacteria | 2750 |
| 92 | Ga0097621_100111963 | 3300006237 | Bacteria | 2307 |
| 93 | Ga0075370_10292180 | 3300006353 | Bacteria | 969 |
| 94 | Ga0068871_100122289 | 3300006358 | Bacteria | 2200 |
| 95 | Ga0068871_100134061 | 3300006358 | Bacteria | 2102 |
| 96 | Ga0068871_100275488 | 3300006358 | Bacteria | 1470 |
| 97 | Ga0075428_100040128 | 3300006844 | Bacteria | 5151 |
| 98 | Ga0075428_100208507 | 3300006844 | Bacteria | 2112 |
| 99 | Ga0075430_100008514 | 3300006846 | Bacteria | 8664 |
| 100 | Ga0075430_100266169 | 3300006846 | Bacteria | 1419 |
| 101 | Ga0075430_100362983 | 3300006846 | Bacteria | 1196 |
| 102 | Ga0075431_100003469 | 3300006847 | Bacteria | 15291 |
| 103 | Ga0075431_100054811 | 3300006847 | Bacteria | 4112 |
| 104 | Ga0075431_100100179 | 3300006847 | Bacteria | 2989 |
| 105 | Ga0075431_100388789 | 3300006847 | Bacteria | 1398 |
| 106 | Ga0075433_10000381 | 3300006852 | Bacteria | 28058 |
| 107 | Ga0075433_10026584 | 3300006852 | Bacteria | 4902 |
| 108 | Ga0075433_10439198 | 3300006852 | Bacteria | 1150 |
| 109 | Ga0075434_100003667 | 3300006871 | Bacteria | 13720 |
| 110 | Ga0075434_100139490 | 3300006871 | Bacteria | 2444 |
| 111 | Ga0075434_100414545 | 3300006871 | Bacteria | 1368 |
| 112 | Ga0075429_100002836 | 3300006880 | Bacteria | 14660 |
| 113 | Ga0075429_100275512 | 3300006880 | Bacteria | 1473 |
| 114 | Ga0075436_100002343 | 3300006914 | Bacteria | 13078 |
| 115 | Ga0075436_100028198 | 3300006914 | Bacteria | 3862 |
| 116 | Ga0075435_100106840 | 3300007076 | Bacteria | 2324 |
| 117 | Ga0075435_100124241 | 3300007076 | Bacteria | 2156 |
| 118 | Ga0105240_10024091 | 3300009093 | Bacteria | 8036 |
| 119 | Ga0111539_10003115 | 3300009094 | Bacteria | 21974 |
| 120 | Ga0105245_10047623 | 3300009098 | Bacteria | 3832 |
| 121 | Ga0105245_10051168 | 3300009098 | Bacteria | 3703 |
| 122 | Ga0105245_10098913 | 3300009098 | Bacteria | 2696 |
| 123 | Ga0105247_10040503 | 3300009101 | Bacteria | 2848 |
| 124 | Ga0105247_10236596 | 3300009101 | Bacteria | 1242 |
| 125 | Ga0114129_10018648 | 3300009147 | Bacteria | 9879 |
| 126 | Ga0114129_10125652 | 3300009147 | Bacteria | 3527 |
| 127 | Ga0114129_10270134 | 3300009147 | Bacteria | 2275 |
| 128 | Ga0114129_10687566 | 3300009147 | Bacteria | 1316 |
| 129 | Ga0105243_10009745 | 3300009148 | Bacteria | 7316 |
| 130 | Ga0105243_10050314 | 3300009148 | Bacteria | 3291 |
| 131 | Ga0105243_10779916 | 3300009148 | Bacteria | 940 |
| 132 | Ga0105241_10142191 | 3300009174 | Bacteria | 1955 |
| 133 | Ga0105242_10045782 | 3300009176 | Bacteria | 3547 |
| 134 | Ga0105237_10022531 | 3300009545 | Bacteria | 6462 |
| 135 | Ga0105237_10094800 | 3300009545 | Bacteria | 2973 |
| 136 | Ga0105238_10160394 | 3300009551 | Bacteria | 2224 |
| 137 | Ga0105238_10244566 | 3300009551 | Bacteria | 1772 |
| 138 | Ga0105148_100072 | 3300009978 | Bacteria | 15543 |
| 139 | Ga0105239_10155328 | 3300010375 | Bacteria | 2555 |
| 140 | Ga0105246_10047511 | 3300011119 | Bacteria | 2931 |
| 141 | Ga0105246_10094682 | 3300011119 | Bacteria | 2161 |
| 142 | Ga0105246_10216768 | 3300011119 | Bacteria | 1497 |
| 143 | Ga0105246_10270913 | 3300011119 | Bacteria | 1357 |
| 144 | Ga0157336_1005365 | 3300012477 | Bacteria | 843 |
| 145 | Ga0157327_1001340 | 3300012512 | Bacteria | 1523 |
| 146 | Ga0157371_10066651 | 3300013102 | Bacteria | 2549 |
| 147 | Ga0157370_10283515 | 3300013104 | Bacteria | 1530 |
| 148 | Ga0157374_10056485 | 3300013296 | Bacteria | 3665 |
| 149 | Ga0157374_10207808 | 3300013296 | Bacteria | 1919 |
| 150 | Ga0157378_10157005 | 3300013297 | Bacteria | 2124 |
| 151 | Ga0157378_10237158 | 3300013297 | Bacteria | 1741 |
| 152 | Ga0163162_10507502 | 3300013306 | Bacteria | 1336 |
| 153 | Ga0163162_10539032 | 3300013306 | Bacteria | 1296 |
| 154 | Ga0157372_10323707 | 3300013307 | Bacteria | 1795 |
| 155 | Ga0157375_10062711 | 3300013308 | Bacteria | 3695 |
| 156 | Ga0157375_10111621 | 3300013308 | Bacteria | 2833 |
| 157 | Ga0157375_10211693 | 3300013308 | Bacteria | 2096 |
| 158 | Ga0157380_10145983 | 3300014326 | Bacteria | 2039 |
| 159 | Ga0157379_10092458 | 3300014968 | Bacteria | 2713 |
| 160 | Ga0157379_10408390 | 3300014968 | Bacteria | 1249 |
| 161 | Ga0157376_10143604 | 3300014969 | Bacteria | 2144 |
| 162 | Ga0213874_10049336 | 3300021377 | Bacteria | 1286 |
| 163 | Ga0209563_101940 | 3300025230 | Bacteria | 4990 |
| 164 | Ga0207692_10017186 | 3300025898 | Bacteria | 3221 |
| 165 | Ga0207692_10079013 | 3300025898 | Bacteria | 1754 |
| 166 | Ga0207692_10091747 | 3300025898 | Bacteria | 1649 |
| 167 | Ga0207710_10006645 | 3300025900 | Bacteria | 4930 |
| 168 | Ga0207710_10069449 | 3300025900 | Bacteria | 1613 |
| 169 | Ga0207680_10003367 | 3300025903 | Bacteria | 7532 |
| 170 | Ga0207647_10046405 | 3300025904 | Bacteria | 2708 |
| 171 | Ga0207685_10003024 | 3300025905 | Bacteria | 3996 |
| 172 | Ga0207699_10002350 | 3300025906 | Bacteria | 8939 |
| 173 | Ga0207645_10049701 | 3300025907 | Bacteria | 2678 |
| 174 | Ga0207645_10218904 | 3300025907 | Bacteria | 1255 |
| 175 | Ga0207705_10076088 | 3300025909 | Bacteria | 2439 |
| 176 | Ga0207705_10126975 | 3300025909 | Bacteria | 1896 |
| 177 | Ga0207654_10012053 | 3300025911 | Bacteria | 4423 |
| 178 | Ga0207654_10213604 | 3300025911 | Bacteria | 1276 |
| 179 | Ga0207707_10008102 | 3300025912 | Bacteria | 9123 |
| 180 | Ga0207707_10168105 | 3300025912 | Bacteria | 1916 |
| 181 | Ga0207707_10196483 | 3300025912 | Bacteria | 1759 |
| 182 | Ga0207695_10051868 | 3300025913 | Bacteria | 4303 |
| 183 | Ga0207671_10058380 | 3300025914 | Bacteria | 2860 |
| 184 | Ga0207671_10380559 | 3300025914 | Bacteria | 1121 |
| 185 | Ga0207693_10012596 | 3300025915 | Bacteria | 6832 |
| 186 | Ga0207663_10031210 | 3300025916 | Bacteria | 3151 |
| 187 | Ga0207663_10099009 | 3300025916 | Bacteria | 1954 |
| 188 | Ga0207660_10073511 | 3300025917 | Bacteria | 2493 |
| 189 | Ga0207660_10167178 | 3300025917 | Bacteria | 1701 |
| 190 | Ga0207660_10285680 | 3300025917 | Bacteria | 1310 |
| 191 | Ga0207660_10436646 | 3300025917 | Bacteria | 1057 |
| 192 | Ga0207657_10114435 | 3300025919 | Bacteria | 2225 |
| 193 | Ga0207657_10205037 | 3300025919 | Bacteria | 1584 |
| 194 | Ga0207652_10029320 | 3300025921 | Bacteria | 4600 |
| 195 | Ga0207652_10053749 | 3300025921 | Bacteria | 3460 |
| 196 | Ga0207652_10060507 | 3300025921 | Bacteria | 3267 |
| 197 | Ga0207652_10160213 | 3300025921 | Bacteria | 2017 |
| 198 | Ga0207652_10275026 | 3300025921 | Bacteria | 1519 |
| 199 | Ga0207681_10184656 | 3300025923 | Bacteria | 1591 |
| 200 | Ga0207694_10105985 | 3300025924 | Bacteria | 2232 |
| 201 | Ga0207694_10226115 | 3300025924 | Bacteria | 1527 |
| 202 | Ga0207694_10236776 | 3300025924 | Bacteria | 1491 |
| 203 | Ga0207650_10331237 | 3300025925 | Bacteria | 1249 |
| 204 | Ga0207659_10247545 | 3300025926 | Bacteria | 1445 |
| 205 | Ga0207687_10005912 | 3300025927 | Bacteria | 8097 |
| 206 | Ga0207700_10001704 | 3300025928 | Bacteria | 12483 |
| 207 | Ga0207700_10080569 | 3300025928 | Bacteria | 2539 |
| 208 | Ga0207664_10003652 | 3300025929 | Bacteria | 10310 |
| 209 | Ga0207644_10052826 | 3300025931 | Bacteria | 2922 |
| 210 | Ga0207644_10292448 | 3300025931 | Bacteria | 1310 |
| 211 | Ga0207690_10011868 | 3300025932 | Bacteria | 5209 |
| 212 | Ga0207690_10136120 | 3300025932 | Bacteria | 1804 |
| 213 | Ga0207706_10013231 | 3300025933 | Bacteria | 7505 |
| 214 | Ga0207686_10126220 | 3300025934 | Bacteria | 1749 |
| 215 | Ga0207670_10024593 | 3300025936 | Bacteria | 3766 |
| 216 | Ga0207669_10145742 | 3300025937 | Bacteria | 1651 |
| 217 | Ga0207704_10277794 | 3300025938 | Bacteria | 1272 |
| 218 | Ga0207665_10001096 | 3300025939 | Bacteria | 18237 |
| 219 | Ga0207665_10079067 | 3300025939 | Bacteria | 2260 |
| 220 | Ga0207665_10197896 | 3300025939 | Bacteria | 1463 |
| 221 | Ga0207711_10049726 | 3300025941 | Bacteria | 3589 |
| 222 | Ga0207711_10502391 | 3300025941 | Bacteria | 1130 |
| 223 | Ga0207689_10487060 | 3300025942 | Bacteria | 1033 |
| 224 | Ga0207661_10040178 | 3300025944 | Bacteria | 3676 |
| 225 | Ga0207661_10286278 | 3300025944 | Bacteria | 1474 |
| 226 | Ga0207679_10010041 | 3300025945 | Bacteria | 6084 |
| 227 | Ga0207679_10124061 | 3300025945 | Bacteria | 2061 |
| 228 | Ga0207667_10197621 | 3300025949 | Bacteria | 2063 |
| 229 | Ga0207667_10640506 | 3300025949 | Bacteria | 1069 |
| 230 | Ga0207668_10085410 | 3300025972 | Bacteria | 2303 |
| 231 | Ga0207668_10237479 | 3300025972 | Bacteria | 1473 |
| 232 | Ga0207640_10151336 | 3300025981 | Bacteria | 1705 |
| 233 | Ga0207640_10283622 | 3300025981 | Bacteria | 1302 |
| 234 | Ga0207658_10123273 | 3300025986 | Bacteria | 2070 |
| 235 | Ga0207677_10016714 | 3300026023 | Bacteria | 4354 |
| 236 | Ga0207703_10066839 | 3300026035 | Bacteria | 2958 |
| 237 | Ga0207639_10006047 | 3300026041 | Bacteria | 8212 |
| 238 | Ga0207678_10002916 | 3300026067 | Bacteria | 15510 |
| 239 | Ga0207678_10012097 | 3300026067 | Bacteria | 7577 |
| 240 | Ga0207678_10061279 | 3300026067 | Bacteria | 3236 |
| 241 | Ga0207708_10043682 | 3300026075 | Bacteria | 3415 |
| 242 | Ga0207702_10282914 | 3300026078 | Bacteria | 1569 |
| 243 | Ga0207676_10012407 | 3300026095 | Bacteria | 6105 |
| 244 | Ga0207674_10044393 | 3300026116 | Bacteria | 4577 |
| 245 | Ga0207674_10157185 | 3300026116 | Bacteria | 2229 |
| 246 | Ga0207675_100367329 | 3300026118 | Bacteria | 1413 |
| 247 | Ga0207683_10011732 | 3300026121 | Bacteria | 7479 |
| 248 | Ga0207683_10019514 | 3300026121 | Bacteria | 5789 |
| 249 | Ga0209813_10012654 | 3300027866 | Bacteria | 2236 |
| 250 | Ga0207428_10000776 | 3300027907 | Bacteria | 36258 |
| 251 | Ga0268266_10016436 | 3300028379 | Bacteria | 6324 |
| 252 | Ga0265337_1018756 | 3300028556 | Bacteria | 2191 |
| 253 | Ga0307515_10001215 | 3300028794 | Bacteria | 58879 |
| 254 | Ga0265338_10022980 | 3300028800 | Bacteria | 6429 |
| 255 | Ga0265338_10169730 | 3300028800 | Bacteria | 1675 |
| 256 | Ga0265330_10030052 | 3300031235 | Bacteria | 2441 |
| 257 | Ga0265330_10046342 | 3300031235 | Bacteria | 1916 |
| 258 | Ga0265328_10000087 | 3300031239 | Bacteria | 47641 |
| 259 | Ga0265328_10000410 | 3300031239 | Bacteria | 20044 |
| 260 | Ga0265328_10014176 | 3300031239 | Bacteria | 3142 |
| 261 | Ga0265328_10019206 | 3300031239 | Bacteria | 2628 |
| 262 | Ga0265328_10020256 | 3300031239 | Bacteria | 2547 |
| 263 | Ga0265328_10034280 | 3300031239 | Bacteria | 1880 |
| 264 | Ga0265328_10060414 | 3300031239 | Bacteria | 1391 |
| 265 | Ga0265325_10000006 | 3300031241 | Bacteria | 255758 |
| 266 | Ga0265325_10030103 | 3300031241 | Bacteria | 2913 |
| 267 | Ga0265325_10051855 | 3300031241 | Bacteria | 2108 |
| 268 | Ga0265329_10008674 | 3300031242 | Bacteria | 3839 |
| 269 | Ga0265339_10013815 | 3300031249 | Bacteria | 4886 |
| 270 | Ga0265339_10029619 | 3300031249 | Bacteria | 3105 |
| 271 | Ga0265339_10032332 | 3300031249 | Bacteria | 2951 |
| 272 | Ga0265339_10167686 | 3300031249 | Bacteria | 1101 |
| 273 | Ga0265331_10000007 | 3300031250 | Bacteria | 331074 |
| 274 | Ga0265331_10000585 | 3300031250 | Bacteria | 32602 |
| 275 | Ga0265331_10003778 | 3300031250 | Bacteria | 9605 |
| 276 | Ga0265316_10000423 | 3300031344 | Bacteria | 48244 |
| 277 | Ga0307513_10048768 | 3300031456 | Bacteria | 4592 |
| 278 | Ga0307513_10163272 | 3300031456 | Bacteria | 2116 |
| 279 | Ga0265313_10000115 | 3300031595 | Bacteria | 81365 |
| 280 | Ga0265313_10001555 | 3300031595 | Bacteria | 21310 |
| 281 | Ga0316575_10090114 | 3300031665 | Bacteria | 1242 |
| 282 | Ga0265342_10000763 | 3300031712 | Bacteria | 32827 |
| 283 | Ga0265342_10013987 | 3300031712 | Bacteria | 5346 |
| 284 | Ga0316576_10005920 | 3300031727 | Bacteria | 7549 |
| 285 | Ga0316576_10084976 | 3300031727 | Bacteria | 2352 |
| 286 | Ga0316578_10006902 | 3300031728 | Bacteria | 5645 |
| 287 | Ga0307516_10067237 | 3300031730 | Bacteria | 3454 |
| 288 | Ga0316583_10000647 | 3300032133 | Bacteria | 10673 |
| 289 | Ga0373926_0010240 | 3300035083 | Bacteria | 3139 |
| 290 | Ga0373949_0009779 | 3300035090 | Bacteria | 2099 |
| 291 | Ga0373952_0021629 | 3300035092 | Bacteria | 1359 |
| 292 | Ga0373923_0011828 | 3300035111 | Bacteria | 3212 |
| 293 | Ga0373923_0149719 | 3300035111 | Bacteria | 1059 |
| 294 | Ga0373932_0075721 | 3300035112 | Bacteria | 1053 |
| 295 | Ga0373936_0006091 | 3300035113 | Bacteria | 4544 |
| 296 | Ga0373939_0021458 | 3300035114 | Bacteria | 1768 |
| 297 | Ga0373941_0006526 | 3300035115 | Bacteria | 2816 |
| 298 | Ga0373941_0160623 | 3300035115 | Bacteria | 831 |
| 299 | Ga0373945_0005656 | 3300035116 | Bacteria | 4009 |
| 300 | Ga0373945_0077005 | 3300035116 | Bacteria | 1272 |
| 301 | Ga0373953_0013803 | 3300035117 | Bacteria | 2892 |
| 302 | Ga0373954_0029504 | 3300035118 | Bacteria | 2526 |
| 303 | Ga0373954_0068508 | 3300035118 | Bacteria | 1683 |
| 304 | Ga0373956_0004635 | 3300035119 | Bacteria | 5496 |
| 305 | Ga0373956_0042918 | 3300035119 | Bacteria | 2012 |
| 306 | Ga0373956_0056408 | 3300035119 | Bacteria | 1773 |
| 307 | Ga0373957_0022515 | 3300035120 | Bacteria | 2246 |
| 308 | Ga0373960_0051821 | 3300035121 | Bacteria | 1220 |
| 309 | Ga0373943_0108900 | 3300035170 | Bacteria | 1459 |
| 310 | Ga0373946_0006988 | 3300035171 | Bacteria | 4113 |
| 311 | Ga0373946_0007704 | 3300035171 | Bacteria | 3945 |
| 312 | Ga0373946_0077086 | 3300035171 | Bacteria | 1452 |
| 313 | Ga0373955_0001327 | 3300035172 | Bacteria | 10492 |
| 314 | Ga0373955_0002179 | 3300035172 | Bacteria | 8483 |
| 315 | Ga0373955_0011098 | 3300035172 | Bacteria | 4280 |
| 316 | Ga0373961_0017473 | 3300035241 | Bacteria | 1861 |
| 317 | Ga0373961_0030359 | 3300035241 | Bacteria | 1503 |
| 318 | Ga0373962_0040675 | 3300035242 | Bacteria | 1308 |
| 319 | Ga0316574_0000075 | 3300035398 | Bacteria | 27326 |
| 320 | Ga0316574_0000154 | 3300035398 | Bacteria | 22281 |
| 321 | Ga0373924_0006015 | 3300035410 | Bacteria | 4328 |
| 322 | Ga0373924_0006213 | 3300035410 | Bacteria | 4272 |
| 323 | Ga0373924_0021735 | 3300035410 | Bacteria | 2503 |
| 324 | Ga0373924_0117042 | 3300035410 | Bacteria | 1155 |
| 325 | Ga0373931_0049261 | 3300035691 | Bacteria | 2236 |
| 326 | Ga0373931_0050069 | 3300035691 | Bacteria | 2222 |
| 327 | Ga0373935_0000006 | 3300035692 | Bacteria | 121726 |
| 328 | Ga0373935_0061327 | 3300035692 | Bacteria | 2407 |
| 329 | Ga0373935_0070231 | 3300035692 | Bacteria | 2257 |
| 330 | Ga0373927_0001008 | 3300035695 | Bacteria | 21456 |
| 331 | Ga0373927_0010512 | 3300035695 | Bacteria | 6169 |
| 332 | Ga0373933_0004844 | 3300035724 | Bacteria | 7352 |
| 333 | Ga0373933_0010010 | 3300035724 | Bacteria | 5191 |
| 334 | Ga0373933_0028451 | 3300035724 | Bacteria | 3224 |
| 335 | Ga0373947_0004133 | 3300035725 | Bacteria | 8533 |
| 336 | Ga0373947_0022516 | 3300035725 | Bacteria | 3655 |
| 337 | Ga0373937_0000124 | 3300036401 | Bacteria | 73933 |
| 338 | Ga0373937_0009181 | 3300036401 | Bacteria | 8582 |
| 339 | Ga0373937_0037169 | 3300036401 | Bacteria | 4437 |
| 340 | Ga0373937_0144541 | 3300036401 | Bacteria | 2226 |
| 341 | Ga0316584_0003492 | 3300036712 | Bacteria | 10237 |
| 342 | Ga0316584_0087795 | 3300036712 | Bacteria | 2328 |
| 343 | Ga0373925_0000210 | 3300037068 | Bacteria | 63621 |
| 344 | Ga0373925_0005243 | 3300037068 | Bacteria | 9685 |
| 345 | Ga0373925_0449614 | 3300037068 | Bacteria | 1055 |
| 346 | Ga0395899_0002072 | 3300037312 | Bacteria | 16480 |
| 347 | Ga0395900_0001691 | 3300037418 | Bacteria | 25639 |
| 348 | Ga0395900_0002324 | 3300037418 | Bacteria | 21074 |
| 349 | Ga0395898_0004548 | 3300037466 | Bacteria | 15139 |
| 350 | Ga0395898_0009208 | 3300037466 | Bacteria | 10388 |
| 351 | Ga0395898_0042046 | 3300037466 | Bacteria | 4511 |
| 352 | Ga0395898_0164347 | 3300037466 | Bacteria | 2123 |
| 353 | Ga0395905_0001088 | 3300037471 | Bacteria | 34174 |
| 354 | Ga0395905_0027361 | 3300037471 | Bacteria | 5377 |
| 355 | Ga0395905_0038658 | 3300037471 | Bacteria | 4476 |
| 356 | Ga0436364_1065930 | 3300037853 | Bacteria | 1234 |
| 357 | Ga0395901_0080700 | 3300038443 | Bacteria | 3397 |
| 358 | Ga0395901_0083715 | 3300038443 | Bacteria | 3334 |
| 359 | Ga0395901_0123735 | 3300038443 | Bacteria | 2718 |
| 360 | Ga0436365_1213299 | 3300039437 | Bacteria | 7836 |
| 361 | Ga0436365_1523457 | 3300039437 | Bacteria | 981 |
| 362 | Ga0436365_1884774 | 3300039437 | Bacteria | 9036 |
| 363 | Ga0436361_0418519 | 3300039447 | Bacteria | 1230 |
| 364 | Ga0436363_1287891 | 3300039450 | Bacteria | 5234 |
| 365 | Ga0466966_0092610 | 3300044684 | Bacteria | 1875 |
| 366 | Ga0466963_0016707 | 3300044694 | Bacteria | 4566 |
| 367 | Ga0466963_0095765 | 3300044694 | Bacteria | 2027 |
| 368 | Ga0466957_0387863 | 3300044842 | Bacteria | 953 |
| 369 | Ga0466959_0053100 | 3300045049 | Bacteria | 2964 |
| 370 | Ga0466959_0117710 | 3300045049 | Bacteria | 1891 |
| 371 | Ga0451576_0140632 | 3300045051 | Bacteria | 2517 |
| 372 | Ga0466967_0269413 | 3300045976 | Bacteria | 1631 |
| 373 | Ga0466967_0293779 | 3300045976 | Bacteria | 1562 |
| 374 | Ga0466967_0344499 | 3300045976 | Bacteria | 1442 |
| 375 | Ga0495617_024550 | 3300046452 | Bacteria | 2034 |
| 376 | Ga0495627_000132 | 3300046453 | Bacteria | 90039 |
| 377 | Ga0495627_004439 | 3300046453 | Bacteria | 5872 |
| 378 | Ga0495592_0000020 | 3300046454 | Bacteria | 140576 |
| 379 | Ga0495592_0030192 | 3300046454 | Bacteria | 4099 |
| 380 | Ga0495603_0040512 | 3300046455 | Bacteria | 2788 |
| 381 | Ga0495603_0072991 | 3300046455 | Bacteria | 2016 |
| 382 | Ga0495629_0003499 | 3300046459 | Bacteria | 11873 |
| 383 | Ga0495629_0006124 | 3300046459 | Bacteria | 8936 |
| 384 | Ga0495629_0021025 | 3300046459 | Bacteria | 4656 |
| 385 | Ga0495629_0042163 | 3300046459 | Bacteria | 3208 |
| 386 | Ga0495641_0037402 | 3300046461 | Bacteria | 2275 |
| 387 | Ga0495641_0110901 | 3300046461 | Bacteria | 1224 |
| 388 | Ga0495651_0001410 | 3300046462 | Bacteria | 18660 |
| 389 | Ga0495651_0009161 | 3300046462 | Bacteria | 7598 |
| 390 | Ga0495653_0000046 | 3300046463 | Bacteria | 113893 |
| 391 | Ga0495653_0004086 | 3300046463 | Bacteria | 11805 |
| 392 | Ga0495582_0006763 | 3300046473 | Bacteria | 6376 |
| 393 | Ga0495582_0054771 | 3300046473 | Bacteria | 2199 |
| 394 | Ga0495582_0327595 | 3300046473 | Bacteria | 881 |
| 395 | Ga0495639_0053255 | 3300046475 | Bacteria | 1843 |
| 396 | Ga0495639_0191680 | 3300046475 | Bacteria | 998 |
| 397 | Ga0495662_0000709 | 3300046476 | Bacteria | 15836 |
| 398 | Ga0495662_0079961 | 3300046476 | Bacteria | 1590 |
| 399 | Ga0495664_0000017 | 3300046477 | Bacteria | 172210 |
| 400 | Ga0495664_0022796 | 3300046477 | Bacteria | 3632 |
| 401 | Ga0495584_0059196 | 3300046491 | Bacteria | 1927 |
| 402 | Ga0495594_0006237 | 3300046499 | Bacteria | 6129 |
| 403 | Ga0495594_0195505 | 3300046499 | Bacteria | 1152 |
| 404 | Ga0495608_0000250 | 3300046511 | Bacteria | 39000 |
| 405 | Ga0495608_0000688 | 3300046511 | Bacteria | 23406 |
| 406 | Ga0495608_0071797 | 3300046511 | Bacteria | 2258 |
| 407 | Ga0495610_0000071 | 3300046512 | Bacteria | 121210 |
| 408 | Ga0495610_0109727 | 3300046512 | Bacteria | 1224 |
| 409 | Ga0495618_0000059 | 3300046514 | Bacteria | 79623 |
| 410 | Ga0495618_0002700 | 3300046514 | Bacteria | 11310 |
| 411 | Ga0495628_0000022 | 3300046516 | Bacteria | 140362 |
| 412 | Ga0495630_0000758 | 3300046517 | Bacteria | 22647 |
| 413 | Ga0495630_0017622 | 3300046517 | Bacteria | 5235 |
| 414 | Ga0495631_0097145 | 3300046518 | Bacteria | 1268 |
| 415 | Ga0495637_0003841 | 3300046520 | Bacteria | 7883 |
| 416 | Ga0495637_0010181 | 3300046520 | Bacteria | 4557 |
| 417 | Ga0495637_0062181 | 3300046520 | Bacteria | 1529 |
| 418 | Ga0495643_0000053 | 3300046522 | Bacteria | 202031 |
| 419 | Ga0495648_0011071 | 3300046524 | Bacteria | 6830 |
| 420 | Ga0495648_0028063 | 3300046524 | Bacteria | 3754 |
| 421 | Ga0495666_0181014 | 3300046526 | Bacteria | 973 |
| 422 | Ga0495652_0000008 | 3300046529 | Bacteria | 343637 |
| 423 | Ga0495652_0029734 | 3300046529 | Bacteria | 4797 |
| 424 | Ga0495665_0113904 | 3300046531 | Bacteria | 1417 |
| 425 | Ga0495640_0000029 | 3300046533 | Bacteria | 79567 |
| 426 | Ga0495640_0026478 | 3300046533 | Bacteria | 4190 |
| 427 | Ga0495640_0252999 | 3300046533 | Bacteria | 1103 |
| 428 | Ga0495586_0006914 | 3300046535 | Bacteria | 6044 |
| 429 | Ga0495587_0000019 | 3300046536 | Bacteria | 161972 |
| 430 | Ga0495587_0000534 | 3300046536 | Bacteria | 26299 |
| 431 | Ga0495645_0000006 | 3300046543 | Bacteria | 382503 |
| 432 | Ga0495645_0001860 | 3300046543 | Bacteria | 14334 |
| 433 | Ga0495667_0000061 | 3300046559 | Bacteria | 94650 |
| 434 | Ga0495667_0000771 | 3300046559 | Bacteria | 20558 |
| 435 | Ga0495667_0057829 | 3300046559 | Bacteria | 2548 |
| 436 | Ga0495667_0135712 | 3300046559 | Bacteria | 1586 |
| 437 | Ga0495634_0001468 | 3300046642 | Bacteria | 20895 |
| 438 | Ga0495634_0089886 | 3300046642 | Bacteria | 1996 |
| 439 | Ga0495635_0000023 | 3300046663 | Bacteria | 153429 |
| 440 | Ga0495635_0003284 | 3300046663 | Bacteria | 11171 |
| 441 | Ga0495635_0172828 | 3300046663 | Bacteria | 1469 |
| 442 | Ga0495661_0160755 | 3300046665 | Bacteria | 1206 |
| 443 | Ga0495657_0000099 | 3300046675 | Bacteria | 76617 |
| 444 | Ga0495657_0001333 | 3300046675 | Bacteria | 21487 |
| 445 | Ga0495599_0000039 | 3300046678 | Bacteria | 98345 |
| 446 | Ga0495599_0012706 | 3300046678 | Bacteria | 5193 |
| 447 | Ga0495623_0000253 | 3300046679 | Bacteria | 34266 |
| 448 | Ga0495623_0000354 | 3300046679 | Bacteria | 30302 |
| 449 | Ga0495646_0000017 | 3300046680 | Bacteria | 123549 |
| 450 | Ga0495646_0002006 | 3300046680 | Bacteria | 12317 |
| 451 | Ga0495658_0000934 | 3300046683 | Bacteria | 15590 |
| 452 | Ga0495613_0002083 | 3300046689 | Bacteria | 15219 |
| 453 | Ga0495613_0006412 | 3300046689 | Bacteria | 8793 |
| 454 | Ga0495613_0123721 | 3300046689 | Bacteria | 1856 |
| 455 | Ga0495613_0354371 | 3300046689 | Bacteria | 1007 |
| 456 | Ga0495624_0021015 | 3300046690 | Bacteria | 4334 |
| 457 | Ga0495671_0000031 | 3300046692 | Bacteria | 202030 |
| 458 | Ga0495600_0000030 | 3300046809 | Bacteria | 89424 |
| 459 | Ga0495600_0001299 | 3300046809 | Bacteria | 13803 |
| 460 | Ga0495600_0173686 | 3300046809 | Bacteria | 1390 |
| 461 | Ga0495581_0064573 | 3300047315 | Bacteria | 2115 |
| 462 | Ga0495604_0000030 | 3300047317 | Bacteria | 138597 |
| 463 | Ga0495604_0003048 | 3300047317 | Bacteria | 13390 |
| 464 | Ga0495604_0168888 | 3300047317 | Bacteria | 1540 |
| 465 | Ga0495604_0234372 | 3300047317 | Bacteria | 1258 |
| 466 | Ga0495674_0000009 | 3300047319 | Bacteria | 310479 |
| 467 | Ga0495674_0003671 | 3300047319 | Bacteria | 14931 |
| 468 | Ga0495674_0140046 | 3300047319 | Bacteria | 2034 |
| 469 | Ga0495674_0416644 | 3300047319 | Bacteria | 1083 |
| 470 | Ga0495676_0392842 | 3300047321 | Bacteria | 921 |
| 471 | Ga0495680_0000359 | 3300047322 | Bacteria | 51000 |
| 472 | Ga0495680_0006916 | 3300047322 | Bacteria | 10469 |
| 473 | Ga0495680_0041419 | 3300047322 | Bacteria | 3663 |
| 474 | Ga0495680_0046009 | 3300047322 | Bacteria | 3443 |
| 475 | Ga0495680_0054186 | 3300047322 | Bacteria | 3116 |
| 476 | Ga0495680_0064110 | 3300047322 | Bacteria | 2819 |
| 477 | Ga0495675_0000056 | 3300047444 | Bacteria | 77625 |
| 478 | Ga0495675_0000892 | 3300047444 | Bacteria | 18258 |
| 479 | Ga0495675_0268368 | 3300047444 | Bacteria | 1020 |
| 480 | Ga0495681_0000228 | 3300047470 | Bacteria | 46877 |
| 481 | Ga0495681_0013181 | 3300047470 | Bacteria | 4813 |
| 482 | Ga0495684_0000056 | 3300047471 | Bacteria | 79718 |
| 483 | Ga0495684_0072844 | 3300047471 | Bacteria | 2610 |
| 484 | Ga0495686_0022395 | 3300047472 | Bacteria | 4182 |
| 485 | Ga0495686_0032905 | 3300047472 | Bacteria | 3351 |
| 486 | Ga0495686_0072533 | 3300047472 | Bacteria | 2117 |
| 487 | Ga0495593_0003363 | 3300047673 | Bacteria | 9582 |
| 488 | Ga0495602_0000006 | 3300048088 | Bacteria | 322593 |
| 489 | Ga0495602_0004679 | 3300048088 | Bacteria | 14292 |
| 490 | Ga0496100_0004090 | 3300048903 | Bacteria | 7692 |
| 491 | Ga0496100_0220870 | 3300048903 | Bacteria | 1390 |
| 492 | Ga0496101_0015051 | 3300048904 | Bacteria | 5206 |
| 493 | Ga0496101_0124197 | 3300048904 | Bacteria | 1954 |
| 494 | Ga0496101_0503107 | 3300048904 | Bacteria | 957 |
| 495 | Ga0496102_0013897 | 3300048905 | Bacteria | 6984 |
| 496 | Ga0496102_0063973 | 3300048905 | Bacteria | 3368 |
| 497 | Ga0496102_0063990 | 3300048905 | Bacteria | 3368 |
| 498 | Ga0496102_0086665 | 3300048905 | Bacteria | 2892 |
| 499 | Ga0496102_0260264 | 3300048905 | Bacteria | 1636 |
| 500 | Ga0496103_0026239 | 3300048906 | Bacteria | 3527 |
| 501 | Ga0496103_0080962 | 3300048906 | Bacteria | 2042 |
| 502 | Ga0496104_0000087 | 3300048907 | Bacteria | 89813 |
| 503 | Ga0496104_0077477 | 3300048907 | Bacteria | 3167 |
| 504 | Ga0496104_0122154 | 3300048907 | Bacteria | 2500 |
| 505 | Ga0496104_0181740 | 3300048907 | Bacteria | 2013 |
| 506 | Ga0496104_0346853 | 3300048907 | Bacteria | 1397 |
| 507 | Ga0496105_0012221 | 3300048908 | Bacteria | 6797 |
| 508 | Ga0496105_0016627 | 3300048908 | Bacteria | 5875 |
| 509 | Ga0496105_0103905 | 3300048908 | Bacteria | 2346 |
| 510 | Ga0496106_0026052 | 3300048909 | Bacteria | 4352 |
| 511 | Ga0496106_0059056 | 3300048909 | Bacteria | 2904 |
| 512 | Ga0496106_0116924 | 3300048909 | Bacteria | 2080 |
| 513 | Ga0496106_0371268 | 3300048909 | Bacteria | 1149 |
| 514 | Ga0496107_0014895 | 3300048910 | Bacteria | 5444 |
| 515 | Ga0496107_0035960 | 3300048910 | Bacteria | 3552 |
| 516 | Ga0496107_0075993 | 3300048910 | Bacteria | 2445 |
| 517 | Ga0496107_0088283 | 3300048910 | Bacteria | 2264 |
| 518 | Ga0496107_0122100 | 3300048910 | Bacteria | 1919 |
| 519 | Ga0496107_0201435 | 3300048910 | Bacteria | 1480 |
| 520 | Ga0496108_0022912 | 3300048911 | Bacteria | 5138 |
| 521 | Ga0496108_0032223 | 3300048911 | Bacteria | 4352 |
| 522 | Ga0496108_0047774 | 3300048911 | Bacteria | 3578 |
| 523 | Ga0496108_0062796 | 3300048911 | Bacteria | 3128 |
| 524 | Ga0496108_0131694 | 3300048911 | Bacteria | 2149 |
| 525 | Ga0496108_0170563 | 3300048911 | Bacteria | 1882 |
| 526 | Ga0496108_0427450 | 3300048911 | Bacteria | 1157 |
| 527 | Ga0496109_0026244 | 3300048912 | Bacteria | 5195 |
| 528 | Ga0496109_0249718 | 3300048912 | Bacteria | 1670 |
| 529 | Ga0496110_0006401 | 3300048913 | Bacteria | 9318 |
| 530 | Ga0496110_0029996 | 3300048913 | Bacteria | 4685 |
| 531 | Ga0496110_0033405 | 3300048913 | Bacteria | 4450 |
| 532 | Ga0496110_0055576 | 3300048913 | Bacteria | 3484 |
| 533 | Ga0496111_0003479 | 3300048914 | Bacteria | 9744 |
| 534 | Ga0496111_0107869 | 3300048914 | Bacteria | 2050 |
| 535 | Ga0496111_0203483 | 3300048914 | Bacteria | 1471 |
| 536 | Ga0496111_0288985 | 3300048914 | Bacteria | 1216 |
| 537 | Ga0496112_0049354 | 3300048915 | Bacteria | 4125 |
| 538 | Ga0496112_0090000 | 3300048915 | Bacteria | 3037 |
| 539 | Ga0496112_0105607 | 3300048915 | Bacteria | 2786 |
| 540 | Ga0496112_0107440 | 3300048915 | Bacteria | 2760 |
| 541 | Ga0496112_0233514 | 3300048915 | Bacteria | 1793 |
| 542 | Ga0496113_0027470 | 3300048916 | Bacteria | 4080 |
| 543 | Ga0496113_0051361 | 3300048916 | Bacteria | 3076 |
| 544 | Ga0496113_0079235 | 3300048916 | Bacteria | 2514 |
| 545 | Ga0496114_0010585 | 3300048917 | Bacteria | 7338 |
| 546 | Ga0496114_0101681 | 3300048917 | Bacteria | 2454 |
| 547 | Ga0496114_0136921 | 3300048917 | Bacteria | 2118 |
| 548 | Ga0496114_0155104 | 3300048917 | Bacteria | 1988 |
| 549 | Ga0496115_0004755 | 3300048918 | Bacteria | 9854 |
| 550 | Ga0496115_0075128 | 3300048918 | Bacteria | 2744 |
| 551 | Ga0496115_0152539 | 3300048918 | Bacteria | 1908 |
| 552 | Ga0496115_0159097 | 3300048918 | Bacteria | 1866 |
| 553 | Ga0496115_0183439 | 3300048918 | Bacteria | 1729 |
| 554 | Ga0496115_0195671 | 3300048918 | Bacteria | 1670 |
| 555 | Ga0496115_0293307 | 3300048918 | Bacteria | 1334 |
| 556 | Ga0496121_0055870 | 3300048924 | Bacteria | 3285 |
| 557 | Ga0496122_0060055 | 3300048925 | Bacteria | 2803 |
| 558 | Ga0496124_0005153 | 3300048927 | Bacteria | 14866 |
| 559 | Ga0496124_0069930 | 3300048927 | Bacteria | 2913 |
| 560 | Ga0496125_0002334 | 3300048928 | Bacteria | 24947 |
| 561 | Ga0496125_0112012 | 3300048928 | Bacteria | 1973 |
| 562 | Ga0496126_0055653 | 3300048929 | Bacteria | 3578 |
| 563 | Ga0495678_033720 | 3300049459 | Bacteria | 2112 |
| 564 | Ga0501335_000262 | 3300049551 | Bacteria | 3037 |
| 565 | Ga0501032_0003702 | 3300049569 | Bacteria | 11605 |
| 566 | Ga0501033_0000190 | 3300049570 | Bacteria | 58924 |
| 567 | Ga0501034_0000033 | 3300049571 | Bacteria | 243508 |
| 568 | Ga0501034_0006611 | 3300049571 | Bacteria | 12439 |
| 569 | Ga0501034_0122826 | 3300049571 | Bacteria | 2583 |
| 570 | Ga0501034_0271730 | 3300049571 | Bacteria | 1636 |
| 571 | Ga0501034_0491337 | 3300049571 | Bacteria | 1142 |
| 572 | Ga0501034_0500058 | 3300049571 | Bacteria | 1129 |
| 573 | Ga0501036_0470232 | 3300049572 | Bacteria | 1047 |
| 574 | Ga0501037_0001858 | 3300049573 | Bacteria | 15327 |
| 575 | Ga0501037_0315763 | 3300049573 | Bacteria | 1083 |
| 576 | Ga0501038_0009455 | 3300049574 | Bacteria | 8946 |
| 577 | Ga0501039_0012230 | 3300049575 | Bacteria | 6542 |
| 578 | Ga0501043_0170364 | 3300049579 | Bacteria | 1699 |
| 579 | Ga0501046_0004757 | 3300049580 | Bacteria | 12248 |
| 580 | Ga0501046_0390689 | 3300049580 | Bacteria | 1006 |
| 581 | Ga0501047_0000135 | 3300049581 | Bacteria | 89402 |
| 582 | Ga0501047_0437425 | 3300049581 | Bacteria | 1138 |
| 583 | Ga0501048_0093387 | 3300049582 | Bacteria | 2122 |
| 584 | Ga0501067_0000493 | 3300049583 | Bacteria | 21609 |
| 585 | Ga0501067_0003030 | 3300049583 | Bacteria | 9280 |
| 586 | Ga0501067_0009400 | 3300049583 | Bacteria | 5417 |
| 587 | Ga0501069_0059598 | 3300049585 | Bacteria | 2130 |
| 588 | Ga0501069_0079143 | 3300049585 | Bacteria | 1850 |
| 589 | Ga0501069_0133073 | 3300049585 | Bacteria | 1424 |
| 590 | Ga0501070_0023007 | 3300049586 | Bacteria | 5217 |
| 591 | Ga0501070_0076273 | 3300049586 | Bacteria | 2775 |
| 592 | Ga0501070_0085041 | 3300049586 | Bacteria | 2619 |
| 593 | Ga0501070_0128809 | 3300049586 | Bacteria | 2091 |
| 594 | Ga0501070_0291900 | 3300049586 | Bacteria | 1329 |
| 595 | Ga0501073_0009481 | 3300049589 | Bacteria | 7188 |
| 596 | Ga0501073_0072928 | 3300049589 | Bacteria | 2391 |
| 597 | Ga0501073_0081910 | 3300049589 | Bacteria | 2245 |
| 598 | Ga0501073_0187090 | 3300049589 | Bacteria | 1433 |
| 599 | Ga0501073_0187512 | 3300049589 | Bacteria | 1431 |
| 600 | Ga0501074_0032212 | 3300049590 | Bacteria | 3798 |
| 601 | Ga0501074_0106440 | 3300049590 | Bacteria | 2008 |
| 602 | Ga0501074_0128742 | 3300049590 | Bacteria | 1811 |
| 603 | Ga0501076_0057962 | 3300049592 | Bacteria | 3077 |
| 604 | Ga0501076_0097772 | 3300049592 | Bacteria | 2365 |
| 605 | Ga0501198_017496 | 3300049649 | Bacteria | 1116 |
| 606 | Ga0501223_001437 | 3300049663 | Bacteria | 5497 |
| 607 | Ga0501223_032088 | 3300049663 | Bacteria | 1022 |
| 608 | Ga0501235_001074 | 3300049669 | Bacteria | 5697 |
| 609 | Ga0501246_002189 | 3300049676 | Bacteria | 1539 |
| 610 | Ga0501249_000383 | 3300049679 | Bacteria | 11577 |
| 611 | Ga0501225_0000036 | 3300049705 | Bacteria | 46300 |
| 612 | Ga0501225_0002246 | 3300049705 | Bacteria | 5974 |
| 613 | Ga0501225_0016000 | 3300049705 | Bacteria | 2085 |
| 614 | Ga0501245_002332 | 3300049708 | Bacteria | 2529 |
| 615 | Ga0501079_0293130 | 3300049741 | Bacteria | 1272 |
| 616 | Ga0501080_0000002 | 3300049742 | Bacteria | 218492 |
| 617 | Ga0501080_0018946 | 3300049742 | Bacteria | 6375 |
| 618 | Ga0501080_0099017 | 3300049742 | Bacteria | 2705 |
| 619 | Ga0501080_0104845 | 3300049742 | Bacteria | 2622 |
| 620 | Ga0501080_0105330 | 3300049742 | Bacteria | 2615 |
| 621 | Ga0501083_0006206 | 3300049744 | Bacteria | 8476 |
| 622 | Ga0501083_0041091 | 3300049744 | Bacteria | 3137 |
| 623 | Ga0501083_0259803 | 3300049744 | Bacteria | 1130 |
| 624 | Ga0501264_006153 | 3300049761 | Bacteria | 1104 |
| 625 | Ga0501035_0000117 | 3300049822 | Bacteria | 96642 |
| 626 | Ga0501035_0001475 | 3300049822 | Bacteria | 24081 |
| 627 | Ga0501035_0004729 | 3300049822 | Bacteria | 12925 |
| 628 | Ga0501035_0184400 | 3300049822 | Bacteria | 1797 |
| 629 | Ga0501044_0000019 | 3300049823 | Bacteria | 223724 |
| 630 | Ga0501044_0034971 | 3300049823 | Bacteria | 5264 |
| 631 | Ga0501044_0044381 | 3300049823 | Bacteria | 4613 |
| 632 | Ga0501044_0099486 | 3300049823 | Bacteria | 2927 |
| 633 | Ga0501045_0021745 | 3300049824 | Bacteria | 4592 |
| 634 | nmdc:mga0k408_134665_c2 | 3300050493 | Bacteria | 1166 |
| 635 | nmdc:mga06z11_124217_c1 | 3300050494 | Bacteria | 1443 |
| 636 | nmdc:mga04h51_64539_c1 | 3300050495 | Bacteria | 1263 |
| 637 | nmdc:mga05p37_105730_c1 | 3300050507 | Bacteria | 3462 |
| 638 | nmdc:mga05p37_16673_c1 | 3300050507 | Bacteria | 8852 |
| 639 | nmdc:mga05p37_320917_c1 | 3300050507 | Bacteria | 1833 |
| 640 | nmdc:mga09592_215797_c1 | 3300050508 | Bacteria | 1662 |
| 641 | nmdc:mga09592_6297_c1 | 3300050508 | Bacteria | 9667 |
| 642 | nmdc:mga0qj67_251155_c1 | 3300050509 | Bacteria | 1435 |
| 643 | nmdc:mga0qj67_304120_c1 | 3300050509 | Bacteria | 1292 |
| 644 | nmdc:mga0qj67_6078_c1 | 3300050509 | Bacteria | 8847 |
| 645 | nmdc:mga06r32_165458_c1 | 3300050510 | Bacteria | 2194 |
| 646 | nmdc:mga06r32_19050_c1 | 3300050510 | Bacteria | 6293 |
| 647 | nmdc:mga06r32_549264_c1 | 3300050510 | Bacteria | 1129 |
| 648 | nmdc:mga08y16_47498_c1 | 3300050511 | Bacteria | 4493 |
| 649 | nmdc:mga08y16_5758_c1 | 3300050511 | Bacteria | 12971 |
| 650 | nmdc:mga08y16_612862_c1 | 3300050511 | Bacteria | 1096 |
| 651 | nmdc:mga0n895_188922_c1 | 3300050512 | Bacteria | 2091 |
| 652 | nmdc:mga0n895_35286_c1 | 3300050512 | Bacteria | 4820 |
| 653 | nmdc:mga0n895_421147_c1 | 3300050512 | Bacteria | 1350 |
| 654 | nmdc:mga0rr50_2490_c1 | 3300050513 | Bacteria | 10405 |
| 655 | nmdc:mga0rr50_539893_c1 | 3300050513 | Bacteria | 993 |
| 656 | nmdc:mga08x19_21112_c1 | 3300050514 | Bacteria | 4016 |
| 657 | nmdc:mga08x19_49663_c1 | 3300050514 | Bacteria | 2691 |
| 658 | nmdc:mga0a205_112_c1 | 3300050515 | Bacteria | 47837 |
| 659 | nmdc:mga0sz30_197175_c1 | 3300050516 | Bacteria | 894 |
| 660 | Ga0495601_0000007 | 3300053077 | Bacteria | 365972 |
| 661 | Ga0495601_0001707 | 3300053077 | Bacteria | 12125 |
| 662 | Ga0495601_0003610 | 3300053077 | Bacteria | 8897 |
| 663 | Ga0495601_0008011 | 3300053077 | Bacteria | 6225 |
| 664 | Ga0495601_0018690 | 3300053077 | Bacteria | 4219 |
| 665 | Ga0495601_0115499 | 3300053077 | Bacteria | 1740 |
| 666 | Ga0495601_0478852 | 3300053077 | Bacteria | 804 |
| 667 | Ga0495612_0000053 | 3300053078 | Bacteria | 52880 |
| 668 | Ga0495612_0001049 | 3300053078 | Bacteria | 11311 |
| 669 | Ga0495612_0004559 | 3300053078 | Bacteria | 5750 |
| 670 | Ga0495612_0006064 | 3300053078 | Bacteria | 4979 |
| 671 | Ga0495595_0000031 | 3300053084 | Bacteria | 89199 |
| 672 | Ga0495595_0000615 | 3300053084 | Bacteria | 13573 |
| 673 | Ga0495595_0017679 | 3300053084 | Bacteria | 3070 |
| 674 | Ga0495595_0040125 | 3300053084 | Bacteria | 2138 |
| 675 | Ga0495595_0141347 | 3300053084 | Bacteria | 1181 |
| 676 | Ga0495619_0000023 | 3300053085 | Bacteria | 182266 |
| 677 | Ga0495619_0000364 | 3300053085 | Bacteria | 31371 |
| 678 | Ga0495619_0000433 | 3300053085 | Bacteria | 28425 |
| 679 | Ga0495619_0004775 | 3300053085 | Bacteria | 8618 |
| 680 | Ga0495619_0029641 | 3300053085 | Bacteria | 3536 |
| 681 | Ga0495619_0053193 | 3300053085 | Bacteria | 2677 |
| 682 | Ga0500643_014759 | 3300053087 | Bacteria | 2701 |
| 683 | Ga0500643_016797 | 3300053087 | Bacteria | 2469 |
| 684 | Ga0500643_094058 | 3300053087 | Bacteria | 816 |
| 685 | Ga0500644_0002244 | 3300053088 | Bacteria | 4876 |
| 686 | Ga0500641_0002805 | 3300053096 | Bacteria | 6173 |
| 687 | Ga0500641_0016584 | 3300053096 | Bacteria | 2744 |
| 688 | Ga0500556_0000167 | 3300053104 | Bacteria | 53886 |
| 689 | Ga0500562_004450 | 3300053108 | Bacteria | 3546 |
| 690 | Ga0500595_000002 | 3300053119 | Bacteria | 1074388 |
| 691 | Ga0500621_064193 | 3300053126 | Bacteria | 1484 |
| 692 | Ga0500652_000493 | 3300053131 | Bacteria | 13857 |
| 693 | Ga0500652_120253 | 3300053131 | Bacteria | 1098 |
| 694 | Ga0500658_0169566 | 3300053134 | Bacteria | 991 |
| 695 | Ga0500559_0002459 | 3300053136 | Bacteria | 9585 |
| 696 | Ga0500559_0010930 | 3300053136 | Bacteria | 3889 |
| 697 | Ga0500622_0000748 | 3300053156 | Bacteria | 28318 |
| 698 | Ga0500601_003608 | 3300053737 | Unclassified | 1679 |
| 699 | Ga0501084_0043365 | 3300054114 | Bacteria | 3763 |
| 700 | Ga0501084_0126557 | 3300054114 | Bacteria | 2150 |
| 701 | Ga0501084_0141924 | 3300054114 | Bacteria | 2023 |
| 702 | Ga0501084_0278982 | 3300054114 | Bacteria | 1411 |
| 703 | Ga0501082_0007340 | 3300060353 | Bacteria | 9513 |
| 704 | Ga0501082_0071033 | 3300060353 | Bacteria | 2998 |
| 705 | Ga0501082_0179626 | 3300060353 | Bacteria | 1840 |
| 706 | Ga0501082_0193753 | 3300060353 | Bacteria | 1768 |
| 707 | Ga0501082_0273708 | 3300060353 | Bacteria | 1470 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046809 | Ga0495600_0173686 | Ga0495600_0173686_696_1379 | 214 |
| 2 | 3300048903 | Ga0496100_0220870 | Ga0496100_0220870_70_753 | 214 |
| 3 | 3300048904 | Ga0496101_0124197 | Ga0496101_0124197_52_735 | 214 |
| 4 | 3300048914 | Ga0496111_0203483 | Ga0496111_0203483_724_1407 | 214 |
| 5 | 3300025942 | Ga0207689_10487060 | Ga0207689_104870602 | 215 |
| 6 | 3300031239 | Ga0265328_10000087 | Ga0265328_1000008745 | 230 |
| 7 | 3300031242 | Ga0265329_10008674 | Ga0265329_100086746 | 230 |
| 8 | 3300031250 | Ga0265331_10000585 | Ga0265331_100005856 | 230 |
| 9 | 3300031344 | Ga0265316_10000423 | Ga0265316_1000042345 | 230 |
| 10 | 3300048910 | Ga0496107_0075993 | Ga0496107_0075993_371_1108 | 233 |
| 11 | 3300005535 | Ga0070684_100080641 | Ga0070684_1000806413 | 234 |
| 12 | 3300009545 | Ga0105237_10094800 | Ga0105237_100948002 | 234 |
| 13 | 3300009551 | Ga0105238_10160394 | Ga0105238_101603942 | 234 |
| 14 | 3300025914 | Ga0207671_10380559 | Ga0207671_103805592 | 234 |
| 15 | 3300025924 | Ga0207694_10236776 | Ga0207694_102367761 | 234 |
| 16 | 3300013307 | Ga0157372_10323707 | Ga0157372_103237072 | 235 |
| 17 | 3300049676 | Ga0501246_002189 | Ga0501246_002189_468_1184 | 238 |
| 18 | 3300009101 | Ga0105247_10040503 | Ga0105247_100405033 | 240 |
| 19 | 3300035115 | Ga0373941_0160623 | Ga0373941_0160623_33_794 | 240 |
| 20 | 3300048903 | Ga0496100_0004090 | Ga0496100_0004090_3757_4518 | 240 |
| 21 | 3300048904 | Ga0496101_0015051 | Ga0496101_0015051_1548_2309 | 240 |
| 22 | 3300048905 | Ga0496102_0063973 | Ga0496102_0063973_631_1392 | 240 |
| 23 | 3300048905 | Ga0496102_0086665 | Ga0496102_0086665_705_1466 | 240 |
| 24 | 3300048906 | Ga0496103_0026239 | Ga0496103_0026239_715_1476 | 240 |
| 25 | 3300048907 | Ga0496104_0077477 | Ga0496104_0077477_1205_1966 | 240 |
| 26 | 3300048907 | Ga0496104_0346853 | Ga0496104_0346853_12_773 | 240 |
| 27 | 3300048908 | Ga0496105_0103905 | Ga0496105_0103905_954_1715 | 240 |
| 28 | 3300048909 | Ga0496106_0059056 | Ga0496106_0059056_1251_2012 | 240 |
| 29 | 3300048910 | Ga0496107_0014895 | Ga0496107_0014895_1676_2437 | 240 |
| 30 | 3300048910 | Ga0496107_0122100 | Ga0496107_0122100_11_772 | 240 |
| 31 | 3300048910 | Ga0496107_0201435 | Ga0496107_0201435_19_780 | 240 |
| 32 | 3300048911 | Ga0496108_0022912 | Ga0496108_0022912_12_773 | 240 |
| 33 | 3300048911 | Ga0496108_0170563 | Ga0496108_0170563_519_1280 | 240 |
| 34 | 3300048912 | Ga0496109_0249718 | Ga0496109_0249718_890_1651 | 240 |
| 35 | 3300048913 | Ga0496110_0029996 | Ga0496110_0029996_2095_2856 | 240 |
| 36 | 3300048914 | Ga0496111_0107869 | Ga0496111_0107869_1251_2012 | 240 |
| 37 | 3300048915 | Ga0496112_0049354 | Ga0496112_0049354_2733_3494 | 240 |
| 38 | 3300048915 | Ga0496112_0233514 | Ga0496112_0233514_694_1455 | 240 |
| 39 | 3300048916 | Ga0496113_0051361 | Ga0496113_0051361_1977_2738 | 240 |
| 40 | 3300048917 | Ga0496114_0010585 | Ga0496114_0010585_5624_6385 | 240 |
| 41 | 3300048918 | Ga0496115_0195671 | Ga0496115_0195671_890_1651 | 240 |
| 42 | 3300048918 | Ga0496115_0293307 | Ga0496115_0293307_554_1315 | 240 |
| 43 | 3300049572 | Ga0501036_0470232 | Ga0501036_0470232_240_1022 | 240 |
| 44 | 3300053077 | Ga0495601_0478852 | Ga0495601_0478852_15_776 | 240 |
| 45 | 3300046459 | Ga0495629_0042163 | Ga0495629_0042163_201_1007 | 241 |
| 46 | 3300053737 | Ga0500601_003608 | Ga0500601_003608_437_1201 | 242 |
| 47 | 3300053104 | Ga0500556_0000167 | Ga0500556_0000167_50077_50874 | 245 |
| 48 | 3300005577 | Ga0068857_100109762 | Ga0068857_1001097622 | 246 |
| 49 | 3300026116 | Ga0207674_10157185 | Ga0207674_101571853 | 246 |
| 50 | 3300035241 | Ga0373961_0030359 | Ga0373961_0030359_310_1068 | 246 |
| 51 | 3300045051 | Ga0451576_0140632 | Ga0451576_0140632_600_1406 | 246 |
| 52 | 3300049586 | Ga0501070_0085041 | Ga0501070_0085041_1518_2276 | 246 |
| 53 | 3300006847 | Ga0075431_100100179 | Ga0075431_1001001792 | 248 |
| 54 | 3300049823 | Ga0501044_0044381 | Ga0501044_0044381_118_927 | 248 |
| 55 | iso_pu_bacteria | 2891088606 | 2891089941 | 248 |
| 56 | iso_pu_bacteria | 8002060224 | 8002061859 | 248 |
| 57 | 3300037068 | Ga0373925_0449614 | Ga0373925_0449614_173_946 | 249 |
| 58 | 3300005458 | Ga0070681_10019210 | Ga0070681_100192106 | 250 |
| 59 | 3300005530 | Ga0070679_100014161 | Ga0070679_1000141615 | 250 |
| 60 | 3300013104 | Ga0157370_10283515 | Ga0157370_102835152 | 250 |
| 61 | 3300025912 | Ga0207707_10008102 | Ga0207707_100081022 | 250 |
| 62 | 3300025921 | Ga0207652_10029320 | Ga0207652_100293201 | 250 |
| 63 | 3300025981 | Ga0207640_10283622 | Ga0207640_102836221 | 250 |
| 64 | 3300044694 | Ga0466963_0095765 | Ga0466963_0095765_387_1157 | 250 |
| 65 | 3300048904 | Ga0496101_0503107 | Ga0496101_0503107_94_882 | 250 |
| 66 | 3300048905 | Ga0496102_0260264 | Ga0496102_0260264_55_843 | 250 |
| 67 | 3300048909 | Ga0496106_0026052 | Ga0496106_0026052_1099_1887 | 250 |
| 68 | 3300048910 | Ga0496107_0088283 | Ga0496107_0088283_272_1060 | 250 |
| 69 | 3300048911 | Ga0496108_0047774 | Ga0496108_0047774_827_1615 | 250 |
| 70 | 3300048913 | Ga0496110_0055576 | Ga0496110_0055576_2547_3335 | 250 |
| 71 | 3300048915 | Ga0496112_0107440 | Ga0496112_0107440_1415_2203 | 250 |
| 72 | 3300048917 | Ga0496114_0155104 | Ga0496114_0155104_206_994 | 250 |
| 73 | 3300048918 | Ga0496115_0004755 | Ga0496115_0004755_5008_5796 | 250 |
| 74 | 3300049586 | Ga0501070_0128809 | Ga0501070_0128809_271_1062 | 250 |
| 75 | iso_pu_bacteria | 2599185156 | 2599331334 | 250 |
| 76 | iso_pu_bacteria | 2842922631 | 2842928178 | 250 |
| 77 | iso_pu_bacteria | 2889306138 | 2889312265 | 250 |
| 78 | iso_pu_bacteria | 2902330777 | 2902336001 | 250 |
| 79 | iso_pu_bacteria | 2902405164 | 2902407300 | 250 |
| 80 | 3300039447 | Ga0436361_0418519 | Ga0436361_0418519_224_1015 | 251 |
| 81 | iso_pu_bacteria | 2545555834 | 2545678883 | 251 |
| 82 | iso_pu_bacteria | 3003665799 | 3003668437 | 251 |
| 83 | iso_pu_bacteria | 641522639 | 641646556 | 251 |
| 84 | iso_pu_bacteria | 643348564 | 643604474 | 251 |
| 85 | 3300005295 | Ga0065707_10232668 | Ga0065707_102326682 | 252 |
| 86 | 3300005327 | Ga0070658_10074784 | Ga0070658_100747842 | 252 |
| 87 | 3300005327 | Ga0070658_10207048 | Ga0070658_102070481 | 252 |
| 88 | 3300005336 | Ga0070680_100010440 | Ga0070680_1000104408 | 252 |
| 89 | 3300005339 | Ga0070660_100133662 | Ga0070660_1001336623 | 252 |
| 90 | 3300005458 | Ga0070681_10355447 | Ga0070681_103554471 | 252 |
| 91 | 3300005530 | Ga0070679_100071061 | Ga0070679_1000710612 | 252 |
| 92 | 3300005530 | Ga0070679_100090176 | Ga0070679_1000901763 | 252 |
| 93 | 3300005530 | Ga0070679_100272100 | Ga0070679_1002721002 | 252 |
| 94 | 3300005563 | Ga0068855_100040468 | Ga0068855_1000404682 | 252 |
| 95 | 3300005563 | Ga0068855_100053478 | Ga0068855_1000534784 | 252 |
| 96 | 3300005614 | Ga0068856_100365364 | Ga0068856_1003653642 | 252 |
| 97 | 3300006195 | Ga0075366_10145078 | Ga0075366_101450782 | 252 |
| 98 | 3300006844 | Ga0075428_100208507 | Ga0075428_1002085072 | 252 |
| 99 | 3300006846 | Ga0075430_100266169 | Ga0075430_1002661692 | 252 |
| 100 | 3300006846 | Ga0075430_100362983 | Ga0075430_1003629832 | 252 |
| 101 | 3300006847 | Ga0075431_100388789 | Ga0075431_1003887891 | 252 |
| 102 | 3300006852 | Ga0075433_10026584 | Ga0075433_100265844 | 252 |
| 103 | 3300006880 | Ga0075429_100275512 | Ga0075429_1002755122 | 252 |
| 104 | 3300009093 | Ga0105240_10024091 | Ga0105240_100240918 | 252 |
| 105 | 3300009147 | Ga0114129_10125652 | Ga0114129_101256524 | 252 |
| 106 | 3300013306 | Ga0163162_10539032 | Ga0163162_105390322 | 252 |
| 107 | 3300025909 | Ga0207705_10076088 | Ga0207705_100760882 | 252 |
| 108 | 3300025909 | Ga0207705_10126975 | Ga0207705_101269753 | 252 |
| 109 | 3300025913 | Ga0207695_10051868 | Ga0207695_100518682 | 252 |
| 110 | 3300025917 | Ga0207660_10073511 | Ga0207660_100735112 | 252 |
| 111 | 3300025917 | Ga0207660_10285680 | Ga0207660_102856801 | 252 |
| 112 | 3300025917 | Ga0207660_10436646 | Ga0207660_104366462 | 252 |
| 113 | 3300025921 | Ga0207652_10160213 | Ga0207652_101602132 | 252 |
| 114 | 3300025921 | Ga0207652_10275026 | Ga0207652_102750262 | 252 |
| 115 | 3300025924 | Ga0207694_10105985 | Ga0207694_101059853 | 252 |
| 116 | 3300025941 | Ga0207711_10502391 | Ga0207711_105023912 | 252 |
| 117 | 3300025944 | Ga0207661_10286278 | Ga0207661_102862782 | 252 |
| 118 | 3300025949 | Ga0207667_10197621 | Ga0207667_101976212 | 252 |
| 119 | 3300025949 | Ga0207667_10640506 | Ga0207667_106405061 | 252 |
| 120 | 3300028794 | Ga0307515_10001215 | Ga0307515_1000121563 | 252 |
| 121 | 3300028800 | Ga0265338_10022980 | Ga0265338_100229803 | 252 |
| 122 | 3300028800 | Ga0265338_10169730 | Ga0265338_101697302 | 252 |
| 123 | 3300031235 | Ga0265330_10030052 | Ga0265330_100300522 | 252 |
| 124 | 3300031239 | Ga0265328_10060414 | Ga0265328_100604143 | 252 |
| 125 | 3300031249 | Ga0265339_10013815 | Ga0265339_100138155 | 252 |
| 126 | 3300031250 | Ga0265331_10000007 | Ga0265331_10000007204 | 252 |
| 127 | 3300031595 | Ga0265313_10000115 | Ga0265313_1000011523 | 252 |
| 128 | 3300031712 | Ga0265342_10000763 | Ga0265342_100007633 | 252 |
| 129 | 3300035118 | Ga0373954_0068508 | Ga0373954_0068508_66_863 | 252 |
| 130 | 3300035119 | Ga0373956_0004635 | Ga0373956_0004635_2433_3230 | 252 |
| 131 | 3300035172 | Ga0373955_0011098 | Ga0373955_0011098_1253_2050 | 252 |
| 132 | 3300035410 | Ga0373924_0006213 | Ga0373924_0006213_673_1470 | 252 |
| 133 | 3300035724 | Ga0373933_0028451 | Ga0373933_0028451_1185_1982 | 252 |
| 134 | 3300037312 | Ga0395899_0002072 | Ga0395899_0002072_4801_5598 | 252 |
| 135 | 3300037418 | Ga0395900_0001691 | Ga0395900_0001691_9179_9976 | 252 |
| 136 | 3300037418 | Ga0395900_0002324 | Ga0395900_0002324_16570_17367 | 252 |
| 137 | 3300037466 | Ga0395898_0004548 | Ga0395898_0004548_13824_14621 | 252 |
| 138 | 3300037466 | Ga0395898_0009208 | Ga0395898_0009208_2284_3081 | 252 |
| 139 | 3300037466 | Ga0395898_0042046 | Ga0395898_0042046_1224_2021 | 252 |
| 140 | 3300037466 | Ga0395898_0164347 | Ga0395898_0164347_403_1200 | 252 |
| 141 | 3300037471 | Ga0395905_0001088 | Ga0395905_0001088_15402_16211 | 252 |
| 142 | 3300037471 | Ga0395905_0027361 | Ga0395905_0027361_3228_4037 | 252 |
| 143 | 3300037471 | Ga0395905_0038658 | Ga0395905_0038658_3637_4446 | 252 |
| 144 | 3300037853 | Ga0436364_1065930 | Ga0436364_1065930_176_970 | 252 |
| 145 | 3300038443 | Ga0395901_0080700 | Ga0395901_0080700_1103_1900 | 252 |
| 146 | 3300038443 | Ga0395901_0083715 | Ga0395901_0083715_130_927 | 252 |
| 147 | 3300038443 | Ga0395901_0123735 | Ga0395901_0123735_745_1542 | 252 |
| 148 | 3300039437 | Ga0436365_1523457 | Ga0436365_1523457_22_816 | 252 |
| 149 | 3300039437 | Ga0436365_1884774 | Ga0436365_1884774_1129_1923 | 252 |
| 150 | 3300044684 | Ga0466966_0092610 | Ga0466966_0092610_68_865 | 252 |
| 151 | 3300044694 | Ga0466963_0016707 | Ga0466963_0016707_2802_3599 | 252 |
| 152 | 3300044842 | Ga0466957_0387863 | Ga0466957_0387863_117_914 | 252 |
| 153 | 3300045049 | Ga0466959_0117710 | Ga0466959_0117710_1072_1869 | 252 |
| 154 | 3300045976 | Ga0466967_0269413 | Ga0466967_0269413_440_1237 | 252 |
| 155 | 3300045976 | Ga0466967_0293779 | Ga0466967_0293779_390_1160 | 252 |
| 156 | 3300045976 | Ga0466967_0344499 | Ga0466967_0344499_430_1227 | 252 |
| 157 | 3300046559 | Ga0495667_0057829 | Ga0495667_0057829_811_1608 | 252 |
| 158 | 3300047322 | Ga0495680_0064110 | Ga0495680_0064110_1963_2760 | 252 |
| 159 | 3300047444 | Ga0495675_0268368 | Ga0495675_0268368_134_931 | 252 |
| 160 | 3300048911 | Ga0496108_0062796 | Ga0496108_0062796_848_1642 | 252 |
| 161 | 3300048913 | Ga0496110_0006401 | Ga0496110_0006401_2962_3756 | 252 |
| 162 | 3300048914 | Ga0496111_0003479 | Ga0496111_0003479_6121_6915 | 252 |
| 163 | 3300048915 | Ga0496112_0105607 | Ga0496112_0105607_1420_2214 | 252 |
| 164 | 3300048917 | Ga0496114_0136921 | Ga0496114_0136921_397_1194 | 252 |
| 165 | 3300049585 | Ga0501069_0059598 | Ga0501069_0059598_1276_2073 | 252 |
| 166 | 3300049585 | Ga0501069_0133073 | Ga0501069_0133073_558_1355 | 252 |
| 167 | 3300049586 | Ga0501070_0076273 | Ga0501070_0076273_1848_2645 | 252 |
| 168 | 3300049589 | Ga0501073_0081910 | Ga0501073_0081910_716_1513 | 252 |
| 169 | 3300049590 | Ga0501074_0128742 | Ga0501074_0128742_206_1003 | 252 |
| 170 | 3300049592 | Ga0501076_0097772 | Ga0501076_0097772_283_1080 | 252 |
| 171 | 3300049741 | Ga0501079_0293130 | Ga0501079_0293130_328_1125 | 252 |
| 172 | 3300049742 | Ga0501080_0018946 | Ga0501080_0018946_2587_3384 | 252 |
| 173 | 3300049742 | Ga0501080_0104845 | Ga0501080_0104845_1031_1828 | 252 |
| 174 | 3300049744 | Ga0501083_0259803 | Ga0501083_0259803_265_1062 | 252 |
| 175 | 3300049822 | Ga0501035_0004729 | Ga0501035_0004729_6887_7684 | 252 |
| 176 | 3300049823 | Ga0501044_0034971 | Ga0501044_0034971_234_1031 | 252 |
| 177 | 3300049823 | Ga0501044_0099486 | Ga0501044_0099486_1422_2219 | 252 |
| 178 | 3300050507 | nmdc:mga05p37_105730_c1 | nmdc:mga05p37_105730_c1_2451_3245 | 252 |
| 179 | 3300050508 | nmdc:mga09592_215797_c1 | nmdc:mga09592_215797_c1_173_967 | 252 |
| 180 | 3300050509 | nmdc:mga0qj67_251155_c1 | nmdc:mga0qj67_251155_c1_79_873 | 252 |
| 181 | 3300050509 | nmdc:mga0qj67_304120_c1 | nmdc:mga0qj67_304120_c1_165_962 | 252 |
| 182 | 3300050510 | nmdc:mga06r32_549264_c1 | nmdc:mga06r32_549264_c1_69_866 | 252 |
| 183 | 3300050511 | nmdc:mga08y16_47498_c1 | nmdc:mga08y16_47498_c1_2114_2908 | 252 |
| 184 | 3300050511 | nmdc:mga08y16_612862_c1 | nmdc:mga08y16_612862_c1_99_896 | 252 |
| 185 | 3300053077 | Ga0495601_0018690 | Ga0495601_0018690_1224_2021 | 252 |
| 186 | 3300053084 | Ga0495595_0040125 | Ga0495595_0040125_587_1384 | 252 |
| 187 | 3300053085 | Ga0495619_0004775 | Ga0495619_0004775_2876_3673 | 252 |
| 188 | 3300053087 | Ga0500643_014759 | Ga0500643_014759_1632_2429 | 252 |
| 189 | 3300053088 | Ga0500644_0002244 | Ga0500644_0002244_1197_2006 | 252 |
| 190 | 3300053096 | Ga0500641_0002805 | Ga0500641_0002805_4173_4985 | 252 |
| 191 | 3300053096 | Ga0500641_0016584 | Ga0500641_0016584_1579_2376 | 252 |
| 192 | 3300053119 | Ga0500595_000002 | Ga0500595_000002_100146_100943 | 252 |
| 193 | 3300053126 | Ga0500621_064193 | Ga0500621_064193_583_1425 | 252 |
| 194 | 3300053131 | Ga0500652_000493 | Ga0500652_000493_4618_5400 | 252 |
| 195 | 3300053136 | Ga0500559_0002459 | Ga0500559_0002459_16_825 | 252 |
| 196 | 3300053156 | Ga0500622_0000748 | Ga0500622_0000748_9790_10599 | 252 |
| 197 | iso_pu_bacteria | 2671180139 | 2671695185 | 252 |
| 198 | iso_pu_bacteria | 2828305725 | 2828309691 | 252 |
| 199 | iso_pu_bacteria | 2919679072 | 2919679981 | 252 |
| 200 | 3300005329 | Ga0070683_100372946 | Ga0070683_1003729462 | 253 |
| 201 | 3300005335 | Ga0070666_10012760 | Ga0070666_100127602 | 253 |
| 202 | 3300005337 | Ga0070682_100012105 | Ga0070682_1000121054 | 253 |
| 203 | 3300005337 | Ga0070682_100058723 | Ga0070682_1000587232 | 253 |
| 204 | 3300005338 | Ga0068868_100016541 | Ga0068868_1000165414 | 253 |
| 205 | 3300005339 | Ga0070660_100217926 | Ga0070660_1002179262 | 253 |
| 206 | 3300005340 | Ga0070689_100123406 | Ga0070689_1001234061 | 253 |
| 207 | 3300005355 | Ga0070671_100424108 | Ga0070671_1004241081 | 253 |
| 208 | 3300005356 | Ga0070674_100256515 | Ga0070674_1002565152 | 253 |
| 209 | 3300005364 | Ga0070673_100538415 | Ga0070673_1005384151 | 253 |
| 210 | 3300005366 | Ga0070659_100008759 | Ga0070659_1000087596 | 253 |
| 211 | 3300005366 | Ga0070659_100343138 | Ga0070659_1003431382 | 253 |
| 212 | 3300005366 | Ga0070659_100446356 | Ga0070659_1004463562 | 253 |
| 213 | 3300005367 | Ga0070667_100036594 | Ga0070667_1000365945 | 253 |
| 214 | 3300005367 | Ga0070667_100046824 | Ga0070667_1000468241 | 253 |
| 215 | 3300005435 | Ga0070714_100111798 | Ga0070714_1001117981 | 253 |
| 216 | 3300005436 | Ga0070713_100001334 | Ga0070713_10000133410 | 253 |
| 217 | 3300005436 | Ga0070713_100010460 | Ga0070713_1000104606 | 253 |
| 218 | 3300005436 | Ga0070713_100022406 | Ga0070713_1000224064 | 253 |
| 219 | 3300005436 | Ga0070713_100546771 | Ga0070713_1005467712 | 253 |
| 220 | 3300005437 | Ga0070710_10034315 | Ga0070710_100343152 | 253 |
| 221 | 3300005437 | Ga0070710_10060442 | Ga0070710_100604422 | 253 |
| 222 | 3300005437 | Ga0070710_10198065 | Ga0070710_101980651 | 253 |
| 223 | 3300005440 | Ga0070705_100111701 | Ga0070705_1001117012 | 253 |
| 224 | 3300005444 | Ga0070694_100201447 | Ga0070694_1002014472 | 253 |
| 225 | 3300005455 | Ga0070663_100033099 | Ga0070663_1000330994 | 253 |
| 226 | 3300005455 | Ga0070663_100140935 | Ga0070663_1001409352 | 253 |
| 227 | 3300005456 | Ga0070678_100283137 | Ga0070678_1002831372 | 253 |
| 228 | 3300005457 | Ga0070662_100342898 | Ga0070662_1003428982 | 253 |
| 229 | 3300005458 | Ga0070681_10014737 | Ga0070681_100147372 | 253 |
| 230 | 3300005468 | Ga0070707_100545999 | Ga0070707_1005459991 | 253 |
| 231 | 3300005530 | Ga0070679_100072922 | Ga0070679_1000729223 | 253 |
| 232 | 3300005535 | Ga0070684_100085934 | Ga0070684_1000859344 | 253 |
| 233 | 3300005539 | Ga0068853_100012299 | Ga0068853_1000122993 | 253 |
| 234 | 3300005545 | Ga0070695_100113809 | Ga0070695_1001138093 | 253 |
| 235 | 3300005545 | Ga0070695_100120402 | Ga0070695_1001204022 | 253 |
| 236 | 3300005546 | Ga0070696_100074129 | Ga0070696_1000741292 | 253 |
| 237 | 3300005547 | Ga0070693_100080219 | Ga0070693_1000802192 | 253 |
| 238 | 3300005548 | Ga0070665_100263611 | Ga0070665_1002636112 | 253 |
| 239 | 3300005564 | Ga0070664_100350466 | Ga0070664_1003504662 | 253 |
| 240 | 3300005615 | Ga0070702_100008860 | Ga0070702_1000088602 | 253 |
| 241 | 3300005615 | Ga0070702_100281733 | Ga0070702_1002817331 | 253 |
| 242 | 3300005618 | Ga0068864_100577944 | Ga0068864_1005779441 | 253 |
| 243 | 3300005718 | Ga0068866_10006292 | Ga0068866_100062925 | 253 |
| 244 | 3300005842 | Ga0068858_100075971 | Ga0068858_1000759713 | 253 |
| 245 | 3300005842 | Ga0068858_100082519 | Ga0068858_1000825194 | 253 |
| 246 | 3300005843 | Ga0068860_100252508 | Ga0068860_1002525082 | 253 |
| 247 | 3300005937 | Ga0081455_10006367 | Ga0081455_100063675 | 253 |
| 248 | 3300006028 | Ga0070717_10010099 | Ga0070717_100100996 | 253 |
| 249 | 3300006028 | Ga0070717_10144372 | Ga0070717_101443721 | 253 |
| 250 | 3300006028 | Ga0070717_10149331 | Ga0070717_101493313 | 253 |
| 251 | 3300006058 | Ga0075432_10005920 | Ga0075432_100059205 | 253 |
| 252 | 3300006163 | Ga0070715_10016048 | Ga0070715_100160484 | 253 |
| 253 | 3300006175 | Ga0070712_100011837 | Ga0070712_1000118372 | 253 |
| 254 | 3300006178 | Ga0075367_10101239 | Ga0075367_101012392 | 253 |
| 255 | 3300006237 | Ga0097621_100078050 | Ga0097621_1000780503 | 253 |
| 256 | 3300006358 | Ga0068871_100134061 | Ga0068871_1001340612 | 253 |
| 257 | 3300006358 | Ga0068871_100275488 | Ga0068871_1002754882 | 253 |
| 258 | 3300006844 | Ga0075428_100040128 | Ga0075428_1000401286 | 253 |
| 259 | 3300006846 | Ga0075430_100008514 | Ga0075430_1000085141 | 253 |
| 260 | 3300006847 | Ga0075431_100003469 | Ga0075431_10000346912 | 253 |
| 261 | 3300006847 | Ga0075431_100054811 | Ga0075431_1000548114 | 253 |
| 262 | 3300006852 | Ga0075433_10000381 | Ga0075433_1000038113 | 253 |
| 263 | 3300006852 | Ga0075433_10439198 | Ga0075433_104391982 | 253 |
| 264 | 3300006871 | Ga0075434_100003667 | Ga0075434_10000366714 | 253 |
| 265 | 3300006871 | Ga0075434_100414545 | Ga0075434_1004145452 | 253 |
| 266 | 3300006880 | Ga0075429_100002836 | Ga0075429_10000283610 | 253 |
| 267 | 3300006914 | Ga0075436_100028198 | Ga0075436_1000281982 | 253 |
| 268 | 3300007076 | Ga0075435_100106840 | Ga0075435_1001068402 | 253 |
| 269 | 3300009094 | Ga0111539_10003115 | Ga0111539_1000311511 | 253 |
| 270 | 3300009098 | Ga0105245_10047623 | Ga0105245_100476232 | 253 |
| 271 | 3300009098 | Ga0105245_10098913 | Ga0105245_100989132 | 253 |
| 272 | 3300009101 | Ga0105247_10236596 | Ga0105247_102365962 | 253 |
| 273 | 3300009147 | Ga0114129_10018648 | Ga0114129_100186484 | 253 |
| 274 | 3300009148 | Ga0105243_10009745 | Ga0105243_100097453 | 253 |
| 275 | 3300009148 | Ga0105243_10050314 | Ga0105243_100503143 | 253 |
| 276 | 3300009148 | Ga0105243_10779916 | Ga0105243_107799161 | 253 |
| 277 | 3300009174 | Ga0105241_10142191 | Ga0105241_101421912 | 253 |
| 278 | 3300009545 | Ga0105237_10022531 | Ga0105237_100225316 | 253 |
| 279 | 3300010375 | Ga0105239_10155328 | Ga0105239_101553282 | 253 |
| 280 | 3300011119 | Ga0105246_10047511 | Ga0105246_100475112 | 253 |
| 281 | 3300011119 | Ga0105246_10094682 | Ga0105246_100946821 | 253 |
| 282 | 3300011119 | Ga0105246_10270913 | Ga0105246_102709132 | 253 |
| 283 | 3300012477 | Ga0157336_1005365 | Ga0157336_10053651 | 253 |
| 284 | 3300012512 | Ga0157327_1001340 | Ga0157327_10013401 | 253 |
| 285 | 3300013102 | Ga0157371_10066651 | Ga0157371_100666513 | 253 |
| 286 | 3300013296 | Ga0157374_10056485 | Ga0157374_100564852 | 253 |
| 287 | 3300013296 | Ga0157374_10207808 | Ga0157374_102078082 | 253 |
| 288 | 3300013297 | Ga0157378_10157005 | Ga0157378_101570053 | 253 |
| 289 | 3300013297 | Ga0157378_10237158 | Ga0157378_102371582 | 253 |
| 290 | 3300013306 | Ga0163162_10507502 | Ga0163162_105075022 | 253 |
| 291 | 3300013308 | Ga0157375_10062711 | Ga0157375_100627114 | 253 |
| 292 | 3300013308 | Ga0157375_10111621 | Ga0157375_101116212 | 253 |
| 293 | 3300013308 | Ga0157375_10211693 | Ga0157375_102116932 | 253 |
| 294 | 3300014968 | Ga0157379_10092458 | Ga0157379_100924583 | 253 |
| 295 | 3300014968 | Ga0157379_10408390 | Ga0157379_104083902 | 253 |
| 296 | 3300014969 | Ga0157376_10143604 | Ga0157376_101436042 | 253 |
| 297 | 3300021377 | Ga0213874_10049336 | Ga0213874_100493361 | 253 |
| 298 | 3300025898 | Ga0207692_10017186 | Ga0207692_100171864 | 253 |
| 299 | 3300025898 | Ga0207692_10079013 | Ga0207692_100790132 | 253 |
| 300 | 3300025898 | Ga0207692_10091747 | Ga0207692_100917472 | 253 |
| 301 | 3300025900 | Ga0207710_10006645 | Ga0207710_100066451 | 253 |
| 302 | 3300025900 | Ga0207710_10069449 | Ga0207710_100694492 | 253 |
| 303 | 3300025903 | Ga0207680_10003367 | Ga0207680_100033672 | 253 |
| 304 | 3300025904 | Ga0207647_10046405 | Ga0207647_100464052 | 253 |
| 305 | 3300025905 | Ga0207685_10003024 | Ga0207685_100030244 | 253 |
| 306 | 3300025906 | Ga0207699_10002350 | Ga0207699_100023505 | 253 |
| 307 | 3300025907 | Ga0207645_10049701 | Ga0207645_100497012 | 253 |
| 308 | 3300025907 | Ga0207645_10218904 | Ga0207645_102189042 | 253 |
| 309 | 3300025911 | Ga0207654_10012053 | Ga0207654_100120534 | 253 |
| 310 | 3300025911 | Ga0207654_10213604 | Ga0207654_102136042 | 253 |
| 311 | 3300025912 | Ga0207707_10168105 | Ga0207707_101681052 | 253 |
| 312 | 3300025912 | Ga0207707_10196483 | Ga0207707_101964832 | 253 |
| 313 | 3300025914 | Ga0207671_10058380 | Ga0207671_100583801 | 253 |
| 314 | 3300025915 | Ga0207693_10012596 | Ga0207693_100125967 | 253 |
| 315 | 3300025916 | Ga0207663_10031210 | Ga0207663_100312102 | 253 |
| 316 | 3300025916 | Ga0207663_10099009 | Ga0207663_100990092 | 253 |
| 317 | 3300025919 | Ga0207657_10114435 | Ga0207657_101144353 | 253 |
| 318 | 3300025919 | Ga0207657_10205037 | Ga0207657_102050372 | 253 |
| 319 | 3300025921 | Ga0207652_10060507 | Ga0207652_100605072 | 253 |
| 320 | 3300025924 | Ga0207694_10226115 | Ga0207694_102261152 | 253 |
| 321 | 3300025926 | Ga0207659_10247545 | Ga0207659_102475452 | 253 |
| 322 | 3300025928 | Ga0207700_10001704 | Ga0207700_100017047 | 253 |
| 323 | 3300025928 | Ga0207700_10080569 | Ga0207700_100805692 | 253 |
| 324 | 3300025929 | Ga0207664_10003652 | Ga0207664_100036523 | 253 |
| 325 | 3300025931 | Ga0207644_10292448 | Ga0207644_102924481 | 253 |
| 326 | 3300025932 | Ga0207690_10011868 | Ga0207690_100118685 | 253 |
| 327 | 3300025932 | Ga0207690_10136120 | Ga0207690_101361202 | 253 |
| 328 | 3300025933 | Ga0207706_10013231 | Ga0207706_100132311 | 253 |
| 329 | 3300025934 | Ga0207686_10126220 | Ga0207686_101262202 | 253 |
| 330 | 3300025936 | Ga0207670_10024593 | Ga0207670_100245933 | 253 |
| 331 | 3300025937 | Ga0207669_10145742 | Ga0207669_101457422 | 253 |
| 332 | 3300025938 | Ga0207704_10277794 | Ga0207704_102777942 | 253 |
| 333 | 3300025939 | Ga0207665_10001096 | Ga0207665_100010962 | 253 |
| 334 | 3300025939 | Ga0207665_10079067 | Ga0207665_100790673 | 253 |
| 335 | 3300025941 | Ga0207711_10049726 | Ga0207711_100497262 | 253 |
| 336 | 3300025944 | Ga0207661_10040178 | Ga0207661_100401782 | 253 |
| 337 | 3300025945 | Ga0207679_10010041 | Ga0207679_100100416 | 253 |
| 338 | 3300025945 | Ga0207679_10124061 | Ga0207679_101240612 | 253 |
| 339 | 3300025972 | Ga0207668_10085410 | Ga0207668_100854102 | 253 |
| 340 | 3300025972 | Ga0207668_10237479 | Ga0207668_102374792 | 253 |
| 341 | 3300025981 | Ga0207640_10151336 | Ga0207640_101513362 | 253 |
| 342 | 3300026023 | Ga0207677_10016714 | Ga0207677_100167141 | 253 |
| 343 | 3300026041 | Ga0207639_10006047 | Ga0207639_100060474 | 253 |
| 344 | 3300026067 | Ga0207678_10002916 | Ga0207678_100029167 | 253 |
| 345 | 3300026067 | Ga0207678_10012097 | Ga0207678_100120974 | 253 |
| 346 | 3300026067 | Ga0207678_10061279 | Ga0207678_100612791 | 253 |
| 347 | 3300026075 | Ga0207708_10043682 | Ga0207708_100436822 | 253 |
| 348 | 3300026078 | Ga0207702_10282914 | Ga0207702_102829141 | 253 |
| 349 | 3300026095 | Ga0207676_10012407 | Ga0207676_100124072 | 253 |
| 350 | 3300026121 | Ga0207683_10011732 | Ga0207683_100117324 | 253 |
| 351 | 3300026121 | Ga0207683_10019514 | Ga0207683_100195146 | 253 |
| 352 | 3300027907 | Ga0207428_10000776 | Ga0207428_1000077624 | 253 |
| 353 | 3300028379 | Ga0268266_10016436 | Ga0268266_100164366 | 253 |
| 354 | 3300028556 | Ga0265337_1018756 | Ga0265337_10187562 | 253 |
| 355 | 3300031239 | Ga0265328_10019206 | Ga0265328_100192062 | 253 |
| 356 | 3300031239 | Ga0265328_10020256 | Ga0265328_100202561 | 253 |
| 357 | 3300031241 | Ga0265325_10000006 | Ga0265325_10000006227 | 253 |
| 358 | 3300031241 | Ga0265325_10030103 | Ga0265325_100301032 | 253 |
| 359 | 3300031249 | Ga0265339_10029619 | Ga0265339_100296193 | 253 |
| 360 | 3300031249 | Ga0265339_10167686 | Ga0265339_101676861 | 253 |
| 361 | 3300031665 | Ga0316575_10090114 | Ga0316575_100901142 | 253 |
| 362 | 3300031727 | Ga0316576_10005920 | Ga0316576_100059206 | 253 |
| 363 | 3300031727 | Ga0316576_10084976 | Ga0316576_100849762 | 253 |
| 364 | 3300032133 | Ga0316583_10000647 | Ga0316583_100006474 | 253 |
| 365 | 3300035083 | Ga0373926_0010240 | Ga0373926_0010240_1852_2652 | 253 |
| 366 | 3300035090 | Ga0373949_0009779 | Ga0373949_0009779_871_1671 | 253 |
| 367 | 3300035092 | Ga0373952_0021629 | Ga0373952_0021629_131_931 | 253 |
| 368 | 3300035111 | Ga0373923_0149719 | Ga0373923_0149719_18_818 | 253 |
| 369 | 3300035112 | Ga0373932_0075721 | Ga0373932_0075721_52_852 | 253 |
| 370 | 3300035114 | Ga0373939_0021458 | Ga0373939_0021458_366_1166 | 253 |
| 371 | 3300035115 | Ga0373941_0006526 | Ga0373941_0006526_289_1089 | 253 |
| 372 | 3300035116 | Ga0373945_0077005 | Ga0373945_0077005_424_1224 | 253 |
| 373 | 3300035119 | Ga0373956_0056408 | Ga0373956_0056408_163_963 | 253 |
| 374 | 3300035121 | Ga0373960_0051821 | Ga0373960_0051821_348_1148 | 253 |
| 375 | 3300035171 | Ga0373946_0006988 | Ga0373946_0006988_1032_1832 | 253 |
| 376 | 3300035171 | Ga0373946_0077086 | Ga0373946_0077086_558_1358 | 253 |
| 377 | 3300035172 | Ga0373955_0001327 | Ga0373955_0001327_5126_5926 | 253 |
| 378 | 3300035241 | Ga0373961_0017473 | Ga0373961_0017473_1000_1800 | 253 |
| 379 | 3300035242 | Ga0373962_0040675 | Ga0373962_0040675_191_991 | 253 |
| 380 | 3300035398 | Ga0316574_0000075 | Ga0316574_0000075_18096_18893 | 253 |
| 381 | 3300035410 | Ga0373924_0006015 | Ga0373924_0006015_2200_3000 | 253 |
| 382 | 3300035691 | Ga0373931_0049261 | Ga0373931_0049261_192_992 | 253 |
| 383 | 3300035691 | Ga0373931_0050069 | Ga0373931_0050069_218_1018 | 253 |
| 384 | 3300035692 | Ga0373935_0061327 | Ga0373935_0061327_67_867 | 253 |
| 385 | 3300035692 | Ga0373935_0070231 | Ga0373935_0070231_84_896 | 253 |
| 386 | 3300035695 | Ga0373927_0001008 | Ga0373927_0001008_15341_16153 | 253 |
| 387 | 3300035695 | Ga0373927_0010512 | Ga0373927_0010512_4608_5408 | 253 |
| 388 | 3300035724 | Ga0373933_0010010 | Ga0373933_0010010_2524_3324 | 253 |
| 389 | 3300035725 | Ga0373947_0022516 | Ga0373947_0022516_730_1530 | 253 |
| 390 | 3300036401 | Ga0373937_0009181 | Ga0373937_0009181_5033_5833 | 253 |
| 391 | 3300036401 | Ga0373937_0037169 | Ga0373937_0037169_968_1768 | 253 |
| 392 | 3300036712 | Ga0316584_0087795 | Ga0316584_0087795_1341_2138 | 253 |
| 393 | 3300037068 | Ga0373925_0005243 | Ga0373925_0005243_7796_8596 | 253 |
| 394 | 3300039450 | Ga0436363_1287891 | Ga0436363_1287891_2578_3375 | 253 |
| 395 | 3300045049 | Ga0466959_0053100 | Ga0466959_0053100_1403_2200 | 253 |
| 396 | 3300046454 | Ga0495592_0030192 | Ga0495592_0030192_2650_3450 | 253 |
| 397 | 3300046455 | Ga0495603_0040512 | Ga0495603_0040512_596_1396 | 253 |
| 398 | 3300046455 | Ga0495603_0072991 | Ga0495603_0072991_1007_1807 | 253 |
| 399 | 3300046459 | Ga0495629_0003499 | Ga0495629_0003499_1272_2072 | 253 |
| 400 | 3300046459 | Ga0495629_0021025 | Ga0495629_0021025_1032_1832 | 253 |
| 401 | 3300046461 | Ga0495641_0037402 | Ga0495641_0037402_840_1640 | 253 |
| 402 | 3300046461 | Ga0495641_0110901 | Ga0495641_0110901_349_1149 | 253 |
| 403 | 3300046462 | Ga0495651_0009161 | Ga0495651_0009161_1435_2235 | 253 |
| 404 | 3300046463 | Ga0495653_0004086 | Ga0495653_0004086_1212_2012 | 253 |
| 405 | 3300046473 | Ga0495582_0006763 | Ga0495582_0006763_1148_1948 | 253 |
| 406 | 3300046473 | Ga0495582_0327595 | Ga0495582_0327595_48_848 | 253 |
| 407 | 3300046475 | Ga0495639_0053255 | Ga0495639_0053255_646_1446 | 253 |
| 408 | 3300046475 | Ga0495639_0191680 | Ga0495639_0191680_115_915 | 253 |
| 409 | 3300046477 | Ga0495664_0022796 | Ga0495664_0022796_764_1564 | 253 |
| 410 | 3300046499 | Ga0495594_0006237 | Ga0495594_0006237_76_876 | 253 |
| 411 | 3300046499 | Ga0495594_0195505 | Ga0495594_0195505_30_830 | 253 |
| 412 | 3300046511 | Ga0495608_0000688 | Ga0495608_0000688_14125_14925 | 253 |
| 413 | 3300046514 | Ga0495618_0002700 | Ga0495618_0002700_6971_7771 | 253 |
| 414 | 3300046517 | Ga0495630_0017622 | Ga0495630_0017622_1035_1835 | 253 |
| 415 | 3300046520 | Ga0495637_0062181 | Ga0495637_0062181_89_889 | 253 |
| 416 | 3300046526 | Ga0495666_0181014 | Ga0495666_0181014_107_907 | 253 |
| 417 | 3300046529 | Ga0495652_0029734 | Ga0495652_0029734_1028_1828 | 253 |
| 418 | 3300046531 | Ga0495665_0113904 | Ga0495665_0113904_206_1006 | 253 |
| 419 | 3300046533 | Ga0495640_0026478 | Ga0495640_0026478_735_1535 | 253 |
| 420 | 3300046533 | Ga0495640_0252999 | Ga0495640_0252999_229_1029 | 253 |
| 421 | 3300046535 | Ga0495586_0006914 | Ga0495586_0006914_3294_4094 | 253 |
| 422 | 3300046536 | Ga0495587_0000534 | Ga0495587_0000534_16978_17778 | 253 |
| 423 | 3300046543 | Ga0495645_0001860 | Ga0495645_0001860_4655_5455 | 253 |
| 424 | 3300046559 | Ga0495667_0000771 | Ga0495667_0000771_10901_11701 | 253 |
| 425 | 3300046559 | Ga0495667_0135712 | Ga0495667_0135712_282_1082 | 253 |
| 426 | 3300046663 | Ga0495635_0003284 | Ga0495635_0003284_6343_7143 | 253 |
| 427 | 3300046675 | Ga0495657_0001333 | Ga0495657_0001333_10912_11712 | 253 |
| 428 | 3300046678 | Ga0495599_0012706 | Ga0495599_0012706_2522_3322 | 253 |
| 429 | 3300046679 | Ga0495623_0000354 | Ga0495623_0000354_16980_17780 | 253 |
| 430 | 3300046680 | Ga0495646_0002006 | Ga0495646_0002006_2650_3450 | 253 |
| 431 | 3300046683 | Ga0495658_0000934 | Ga0495658_0000934_11614_12414 | 253 |
| 432 | 3300046689 | Ga0495613_0002083 | Ga0495613_0002083_5062_5862 | 253 |
| 433 | 3300046809 | Ga0495600_0001299 | Ga0495600_0001299_4138_4938 | 253 |
| 434 | 3300047315 | Ga0495581_0064573 | Ga0495581_0064573_25_825 | 253 |
| 435 | 3300047317 | Ga0495604_0003048 | Ga0495604_0003048_10591_11391 | 253 |
| 436 | 3300047317 | Ga0495604_0234372 | Ga0495604_0234372_166_966 | 253 |
| 437 | 3300047319 | Ga0495674_0003671 | Ga0495674_0003671_2750_3550 | 253 |
| 438 | 3300047319 | Ga0495674_0140046 | Ga0495674_0140046_974_1774 | 253 |
| 439 | 3300047321 | Ga0495676_0392842 | Ga0495676_0392842_64_864 | 253 |
| 440 | 3300047322 | Ga0495680_0006916 | Ga0495680_0006916_1487_2287 | 253 |
| 441 | 3300047322 | Ga0495680_0041419 | Ga0495680_0041419_2286_3086 | 253 |
| 442 | 3300047322 | Ga0495680_0046009 | Ga0495680_0046009_784_1584 | 253 |
| 443 | 3300047444 | Ga0495675_0000892 | Ga0495675_0000892_12678_13478 | 253 |
| 444 | 3300047471 | Ga0495684_0072844 | Ga0495684_0072844_1187_1987 | 253 |
| 445 | 3300048088 | Ga0495602_0004679 | Ga0495602_0004679_5011_5811 | 253 |
| 446 | 3300048905 | Ga0496102_0013897 | Ga0496102_0013897_1739_2539 | 253 |
| 447 | 3300048905 | Ga0496102_0063990 | Ga0496102_0063990_2455_3255 | 253 |
| 448 | 3300048906 | Ga0496103_0080962 | Ga0496103_0080962_876_1676 | 253 |
| 449 | 3300048907 | Ga0496104_0000087 | Ga0496104_0000087_57051_57851 | 253 |
| 450 | 3300048907 | Ga0496104_0122154 | Ga0496104_0122154_803_1603 | 253 |
| 451 | 3300048907 | Ga0496104_0181740 | Ga0496104_0181740_92_892 | 253 |
| 452 | 3300048908 | Ga0496105_0012221 | Ga0496105_0012221_3040_3840 | 253 |
| 453 | 3300048908 | Ga0496105_0016627 | Ga0496105_0016627_1643_2443 | 253 |
| 454 | 3300048909 | Ga0496106_0116924 | Ga0496106_0116924_116_916 | 253 |
| 455 | 3300048909 | Ga0496106_0371268 | Ga0496106_0371268_229_1029 | 253 |
| 456 | 3300048910 | Ga0496107_0035960 | Ga0496107_0035960_793_1593 | 253 |
| 457 | 3300048911 | Ga0496108_0032223 | Ga0496108_0032223_2052_2852 | 253 |
| 458 | 3300048911 | Ga0496108_0131694 | Ga0496108_0131694_475_1275 | 253 |
| 459 | 3300048911 | Ga0496108_0427450 | Ga0496108_0427450_220_1020 | 253 |
| 460 | 3300048915 | Ga0496112_0090000 | Ga0496112_0090000_58_858 | 253 |
| 461 | 3300048916 | Ga0496113_0027470 | Ga0496113_0027470_969_1769 | 253 |
| 462 | 3300048917 | Ga0496114_0101681 | Ga0496114_0101681_1291_2091 | 253 |
| 463 | 3300048918 | Ga0496115_0075128 | Ga0496115_0075128_1361_2161 | 253 |
| 464 | 3300048918 | Ga0496115_0152539 | Ga0496115_0152539_170_970 | 253 |
| 465 | 3300048918 | Ga0496115_0159097 | Ga0496115_0159097_357_1157 | 253 |
| 466 | 3300048918 | Ga0496115_0183439 | Ga0496115_0183439_102_902 | 253 |
| 467 | 3300049569 | Ga0501032_0003702 | Ga0501032_0003702_7538_8335 | 253 |
| 468 | 3300049571 | Ga0501034_0000033 | Ga0501034_0000033_130084_130881 | 253 |
| 469 | 3300049571 | Ga0501034_0122826 | Ga0501034_0122826_1662_2468 | 253 |
| 470 | 3300049571 | Ga0501034_0271730 | Ga0501034_0271730_768_1574 | 253 |
| 471 | 3300049573 | Ga0501037_0001858 | Ga0501037_0001858_615_1412 | 253 |
| 472 | 3300049574 | Ga0501038_0009455 | Ga0501038_0009455_2506_3303 | 253 |
| 473 | 3300049575 | Ga0501039_0012230 | Ga0501039_0012230_2964_3761 | 253 |
| 474 | 3300049579 | Ga0501043_0170364 | Ga0501043_0170364_526_1323 | 253 |
| 475 | 3300049580 | Ga0501046_0004757 | Ga0501046_0004757_10341_11138 | 253 |
| 476 | 3300049581 | Ga0501047_0000135 | Ga0501047_0000135_81148_81945 | 253 |
| 477 | 3300049582 | Ga0501048_0093387 | Ga0501048_0093387_364_1161 | 253 |
| 478 | 3300049583 | Ga0501067_0000493 | Ga0501067_0000493_4030_4836 | 253 |
| 479 | 3300049583 | Ga0501067_0003030 | Ga0501067_0003030_907_1704 | 253 |
| 480 | 3300049583 | Ga0501067_0009400 | Ga0501067_0009400_2776_3582 | 253 |
| 481 | 3300049585 | Ga0501069_0079143 | Ga0501069_0079143_922_1728 | 253 |
| 482 | 3300049586 | Ga0501070_0023007 | Ga0501070_0023007_3318_4115 | 253 |
| 483 | 3300049589 | Ga0501073_0009481 | Ga0501073_0009481_5192_5989 | 253 |
| 484 | 3300049589 | Ga0501073_0072928 | Ga0501073_0072928_1180_1986 | 253 |
| 485 | 3300049590 | Ga0501074_0032212 | Ga0501074_0032212_562_1368 | 253 |
| 486 | 3300049590 | Ga0501074_0106440 | Ga0501074_0106440_604_1410 | 253 |
| 487 | 3300049592 | Ga0501076_0057962 | Ga0501076_0057962_305_1111 | 253 |
| 488 | 3300049742 | Ga0501080_0000002 | Ga0501080_0000002_180838_181635 | 253 |
| 489 | 3300049742 | Ga0501080_0099017 | Ga0501080_0099017_1405_2211 | 253 |
| 490 | 3300049742 | Ga0501080_0105330 | Ga0501080_0105330_1049_1846 | 253 |
| 491 | 3300049744 | Ga0501083_0006206 | Ga0501083_0006206_3503_4309 | 253 |
| 492 | 3300049744 | Ga0501083_0041091 | Ga0501083_0041091_1514_2320 | 253 |
| 493 | 3300049822 | Ga0501035_0000117 | Ga0501035_0000117_74139_74936 | 253 |
| 494 | 3300049822 | Ga0501035_0184400 | Ga0501035_0184400_806_1612 | 253 |
| 495 | 3300049823 | Ga0501044_0000019 | Ga0501044_0000019_130079_130876 | 253 |
| 496 | 3300049824 | Ga0501045_0021745 | Ga0501045_0021745_3571_4368 | 253 |
| 497 | 3300050494 | nmdc:mga06z11_124217_c1 | nmdc:mga06z11_124217_c1_174_971 | 253 |
| 498 | 3300050507 | nmdc:mga05p37_16673_c1 | nmdc:mga05p37_16673_c1_291_1091 | 253 |
| 499 | 3300050508 | nmdc:mga09592_6297_c1 | nmdc:mga09592_6297_c1_2735_3535 | 253 |
| 500 | 3300050509 | nmdc:mga0qj67_6078_c1 | nmdc:mga0qj67_6078_c1_291_1091 | 253 |
| 501 | 3300050510 | nmdc:mga06r32_165458_c1 | nmdc:mga06r32_165458_c1_249_1046 | 253 |
| 502 | 3300050510 | nmdc:mga06r32_19050_c1 | nmdc:mga06r32_19050_c1_5238_6038 | 253 |
| 503 | 3300050511 | nmdc:mga08y16_5758_c1 | nmdc:mga08y16_5758_c1_4747_5547 | 253 |
| 504 | 3300050512 | nmdc:mga0n895_421147_c1 | nmdc:mga0n895_421147_c1_341_1168 | 253 |
| 505 | 3300050513 | nmdc:mga0rr50_2490_c1 | nmdc:mga0rr50_2490_c1_1116_1916 | 253 |
| 506 | 3300050513 | nmdc:mga0rr50_539893_c1 | nmdc:mga0rr50_539893_c1_20_820 | 253 |
| 507 | 3300050514 | nmdc:mga08x19_49663_c1 | nmdc:mga08x19_49663_c1_469_1269 | 253 |
| 508 | 3300050515 | nmdc:mga0a205_112_c1 | nmdc:mga0a205_112_c1_20783_21583 | 253 |
| 509 | 3300053077 | Ga0495601_0001707 | Ga0495601_0001707_607_1407 | 253 |
| 510 | 3300053077 | Ga0495601_0003610 | Ga0495601_0003610_2678_3478 | 253 |
| 511 | 3300053077 | Ga0495601_0008011 | Ga0495601_0008011_2670_3470 | 253 |
| 512 | 3300053078 | Ga0495612_0001049 | Ga0495612_0001049_9129_9929 | 253 |
| 513 | 3300053078 | Ga0495612_0004559 | Ga0495612_0004559_4097_4897 | 253 |
| 514 | 3300053078 | Ga0495612_0006064 | Ga0495612_0006064_4029_4829 | 253 |
| 515 | 3300053084 | Ga0495595_0000615 | Ga0495595_0000615_4580_5380 | 253 |
| 516 | 3300053084 | Ga0495595_0017679 | Ga0495595_0017679_57_857 | 253 |
| 517 | 3300053084 | Ga0495595_0141347 | Ga0495595_0141347_26_826 | 253 |
| 518 | 3300053085 | Ga0495619_0000364 | Ga0495619_0000364_22190_22990 | 253 |
| 519 | 3300053085 | Ga0495619_0000433 | Ga0495619_0000433_14106_14906 | 253 |
| 520 | 3300053085 | Ga0495619_0029641 | Ga0495619_0029641_2455_3255 | 253 |
| 521 | 3300053085 | Ga0495619_0053193 | Ga0495619_0053193_1795_2595 | 253 |
| 522 | 3300053087 | Ga0500643_016797 | Ga0500643_016797_895_1710 | 253 |
| 523 | 3300054114 | Ga0501084_0043365 | Ga0501084_0043365_2281_3087 | 253 |
| 524 | 3300054114 | Ga0501084_0126557 | Ga0501084_0126557_372_1178 | 253 |
| 525 | 3300054114 | Ga0501084_0141924 | Ga0501084_0141924_1179_1985 | 253 |
| 526 | 3300060353 | Ga0501082_0007340 | Ga0501082_0007340_3241_4038 | 253 |
| 527 | 3300060353 | Ga0501082_0071033 | Ga0501082_0071033_1045_1851 | 253 |
| 528 | 3300060353 | Ga0501082_0179626 | Ga0501082_0179626_661_1467 | 253 |
| 529 | 3300003659 | JGI25404J52841_10012620 | JGI25404J52841_100126202 | 254 |
| 530 | 3300005367 | Ga0070667_100203743 | Ga0070667_1002037431 | 254 |
| 531 | 3300005539 | Ga0068853_100340757 | Ga0068853_1003407572 | 254 |
| 532 | 3300005719 | Ga0068861_100159895 | Ga0068861_1001598952 | 254 |
| 533 | 3300005842 | Ga0068858_100066767 | Ga0068858_1000667674 | 254 |
| 534 | 3300005983 | Ga0081540_1000092 | Ga0081540_100009221 | 254 |
| 535 | 3300006042 | Ga0075368_10113374 | Ga0075368_101133741 | 254 |
| 536 | 3300006048 | Ga0075363_100035266 | Ga0075363_1000352663 | 254 |
| 537 | 3300006237 | Ga0097621_100111963 | Ga0097621_1001119632 | 254 |
| 538 | 3300006353 | Ga0075370_10292180 | Ga0075370_102921802 | 254 |
| 539 | 3300006358 | Ga0068871_100122289 | Ga0068871_1001222893 | 254 |
| 540 | 3300009098 | Ga0105245_10051168 | Ga0105245_100511683 | 254 |
| 541 | 3300009147 | Ga0114129_10687566 | Ga0114129_106875662 | 254 |
| 542 | 3300009176 | Ga0105242_10045782 | Ga0105242_100457826 | 254 |
| 543 | 3300009551 | Ga0105238_10244566 | Ga0105238_102445662 | 254 |
| 544 | 3300011119 | Ga0105246_10216768 | Ga0105246_102167682 | 254 |
| 545 | 3300025927 | Ga0207687_10005912 | Ga0207687_100059127 | 254 |
| 546 | 3300025986 | Ga0207658_10123273 | Ga0207658_101232732 | 254 |
| 547 | 3300026035 | Ga0207703_10066839 | Ga0207703_100668392 | 254 |
| 548 | 3300026116 | Ga0207674_10044393 | Ga0207674_100443934 | 254 |
| 549 | 3300026118 | Ga0207675_100367329 | Ga0207675_1003673292 | 254 |
| 550 | 3300027866 | Ga0209813_10012654 | Ga0209813_100126543 | 254 |
| 551 | 3300031241 | Ga0265325_10051855 | Ga0265325_100518553 | 254 |
| 552 | 3300031456 | Ga0307513_10163272 | Ga0307513_101632723 | 254 |
| 553 | 3300031730 | Ga0307516_10067237 | Ga0307516_100672372 | 254 |
| 554 | 3300046511 | Ga0495608_0071797 | Ga0495608_0071797_668_1474 | 254 |
| 555 | 3300049571 | Ga0501034_0500058 | Ga0501034_0500058_56_865 | 254 |
| 556 | 3300049586 | Ga0501070_0291900 | Ga0501070_0291900_494_1303 | 254 |
| 557 | 3300049589 | Ga0501073_0187090 | Ga0501073_0187090_559_1368 | 254 |
| 558 | 3300049649 | Ga0501198_017496 | Ga0501198_017496_204_968 | 254 |
| 559 | 3300049663 | Ga0501223_032088 | Ga0501223_032088_28_792 | 254 |
| 560 | 3300049679 | Ga0501249_000383 | Ga0501249_000383_3747_4511 | 254 |
| 561 | 3300050493 | nmdc:mga0k408_134665_c2 | nmdc:mga0k408_134665_c2_310_1110 | 254 |
| 562 | 3300050495 | nmdc:mga04h51_64539_c1 | nmdc:mga04h51_64539_c1_31_834 | 254 |
| 563 | 3300053087 | Ga0500643_094058 | Ga0500643_094058_19_783 | 254 |
| 564 | 3300053131 | Ga0500652_120253 | Ga0500652_120253_158_958 | 254 |
| 565 | 3300054114 | Ga0501084_0278982 | Ga0501084_0278982_177_986 | 254 |
| 566 | iso_pu_bacteria | 2917554339 | 2917555384 | 254 |
| 567 | 3300006914 | Ga0075436_100002343 | Ga0075436_1000023433 | 255 |
| 568 | 3300031235 | Ga0265330_10046342 | Ga0265330_100463423 | 255 |
| 569 | 3300031239 | Ga0265328_10034280 | Ga0265328_100342802 | 255 |
| 570 | 3300031249 | Ga0265339_10032332 | Ga0265339_100323323 | 255 |
| 571 | 3300031595 | Ga0265313_10001555 | Ga0265313_100015553 | 255 |
| 572 | 3300031712 | Ga0265342_10013987 | Ga0265342_100139872 | 255 |
| 573 | 3300035170 | Ga0373943_0108900 | Ga0373943_0108900_322_1128 | 255 |
| 574 | 3300035410 | Ga0373924_0117042 | Ga0373924_0117042_214_1026 | 255 |
| 575 | 3300039437 | Ga0436365_1213299 | Ga0436365_1213299_1459_2262 | 255 |
| 576 | 3300046476 | Ga0495662_0079961 | Ga0495662_0079961_227_1033 | 255 |
| 577 | 3300046642 | Ga0495634_0089886 | Ga0495634_0089886_969_1775 | 255 |
| 578 | 3300046689 | Ga0495613_0354371 | Ga0495613_0354371_149_955 | 255 |
| 579 | 3300047317 | Ga0495604_0168888 | Ga0495604_0168888_497_1303 | 255 |
| 580 | 3300047472 | Ga0495686_0032905 | Ga0495686_0032905_1757_2524 | 255 |
| 581 | 3300049571 | Ga0501034_0491337 | Ga0501034_0491337_44_889 | 255 |
| 582 | 3300049573 | Ga0501037_0315763 | Ga0501037_0315763_220_1050 | 255 |
| 583 | 3300049581 | Ga0501047_0437425 | Ga0501047_0437425_14_859 | 255 |
| 584 | 3300049589 | Ga0501073_0187512 | Ga0501073_0187512_390_1235 | 255 |
| 585 | 3300050514 | nmdc:mga08x19_21112_c1 | nmdc:mga08x19_21112_c1_2284_3084 | 255 |
| 586 | 3300053077 | Ga0495601_0115499 | Ga0495601_0115499_404_1210 | 255 |
| 587 | 3300053136 | Ga0500559_0010930 | Ga0500559_0010930_2201_2968 | 255 |
| 588 | 3300005336 | Ga0070680_100344497 | Ga0070680_1003444972 | 256 |
| 589 | 3300005530 | Ga0070679_100220086 | Ga0070679_1002200862 | 256 |
| 590 | 3300025917 | Ga0207660_10167178 | Ga0207660_101671782 | 256 |
| 591 | 3300025921 | Ga0207652_10053749 | Ga0207652_100537492 | 256 |
| 592 | 3300025939 | Ga0207665_10197896 | Ga0207665_101978962 | 256 |
| 593 | 3300031239 | Ga0265328_10000410 | Ga0265328_1000041013 | 256 |
| 594 | 3300031456 | Ga0307513_10048768 | Ga0307513_100487686 | 256 |
| 595 | 3300031728 | Ga0316578_10006902 | Ga0316578_100069024 | 256 |
| 596 | 3300035111 | Ga0373923_0011828 | Ga0373923_0011828_1243_2046 | 256 |
| 597 | 3300035113 | Ga0373936_0006091 | Ga0373936_0006091_2946_3749 | 256 |
| 598 | 3300035116 | Ga0373945_0005656 | Ga0373945_0005656_1415_2218 | 256 |
| 599 | 3300035117 | Ga0373953_0013803 | Ga0373953_0013803_205_1008 | 256 |
| 600 | 3300035118 | Ga0373954_0029504 | Ga0373954_0029504_879_1694 | 256 |
| 601 | 3300035119 | Ga0373956_0042918 | Ga0373956_0042918_867_1670 | 256 |
| 602 | 3300035120 | Ga0373957_0022515 | Ga0373957_0022515_1228_2031 | 256 |
| 603 | 3300035171 | Ga0373946_0007704 | Ga0373946_0007704_1304_2107 | 256 |
| 604 | 3300035172 | Ga0373955_0002179 | Ga0373955_0002179_6257_7060 | 256 |
| 605 | 3300035398 | Ga0316574_0000154 | Ga0316574_0000154_1742_2554 | 256 |
| 606 | 3300035410 | Ga0373924_0021735 | Ga0373924_0021735_112_915 | 256 |
| 607 | 3300035692 | Ga0373935_0000006 | Ga0373935_0000006_31615_32418 | 256 |
| 608 | 3300035724 | Ga0373933_0004844 | Ga0373933_0004844_2400_3203 | 256 |
| 609 | 3300035725 | Ga0373947_0004133 | Ga0373947_0004133_7234_8037 | 256 |
| 610 | 3300036401 | Ga0373937_0000124 | Ga0373937_0000124_1464_2267 | 256 |
| 611 | 3300036401 | Ga0373937_0144541 | Ga0373937_0144541_1307_2122 | 256 |
| 612 | 3300036712 | Ga0316584_0003492 | Ga0316584_0003492_3089_3901 | 256 |
| 613 | 3300037068 | Ga0373925_0000210 | Ga0373925_0000210_43811_44614 | 256 |
| 614 | 3300046454 | Ga0495592_0000020 | Ga0495592_0000020_68141_68944 | 256 |
| 615 | 3300046459 | Ga0495629_0006124 | Ga0495629_0006124_5416_6219 | 256 |
| 616 | 3300046462 | Ga0495651_0001410 | Ga0495651_0001410_10875_11678 | 256 |
| 617 | 3300046463 | Ga0495653_0000046 | Ga0495653_0000046_71854_72657 | 256 |
| 618 | 3300046473 | Ga0495582_0054771 | Ga0495582_0054771_1168_1971 | 256 |
| 619 | 3300046476 | Ga0495662_0000709 | Ga0495662_0000709_3427_4230 | 256 |
| 620 | 3300046477 | Ga0495664_0000017 | Ga0495664_0000017_71795_72598 | 256 |
| 621 | 3300046511 | Ga0495608_0000250 | Ga0495608_0000250_31063_31866 | 256 |
| 622 | 3300046514 | Ga0495618_0000059 | Ga0495618_0000059_71776_72579 | 256 |
| 623 | 3300046516 | Ga0495628_0000022 | Ga0495628_0000022_44941_45744 | 256 |
| 624 | 3300046517 | Ga0495630_0000758 | Ga0495630_0000758_15874_16677 | 256 |
| 625 | 3300046529 | Ga0495652_0000008 | Ga0495652_0000008_297894_298697 | 256 |
| 626 | 3300046533 | Ga0495640_0000029 | Ga0495640_0000029_7116_7919 | 256 |
| 627 | 3300046536 | Ga0495587_0000019 | Ga0495587_0000019_89537_90340 | 256 |
| 628 | 3300046543 | Ga0495645_0000006 | Ga0495645_0000006_116683_117486 | 256 |
| 629 | 3300046559 | Ga0495667_0000061 | Ga0495667_0000061_22235_23038 | 256 |
| 630 | 3300046642 | Ga0495634_0001468 | Ga0495634_0001468_16956_17759 | 256 |
| 631 | 3300046663 | Ga0495635_0000023 | Ga0495635_0000023_89769_90572 | 256 |
| 632 | 3300046663 | Ga0495635_0172828 | Ga0495635_0172828_294_1109 | 256 |
| 633 | 3300046675 | Ga0495657_0000099 | Ga0495657_0000099_69901_70704 | 256 |
| 634 | 3300046678 | Ga0495599_0000039 | Ga0495599_0000039_7357_8160 | 256 |
| 635 | 3300046679 | Ga0495623_0000253 | Ga0495623_0000253_26311_27114 | 256 |
| 636 | 3300046680 | Ga0495646_0000017 | Ga0495646_0000017_30861_31664 | 256 |
| 637 | 3300046689 | Ga0495613_0006412 | Ga0495613_0006412_7099_7902 | 256 |
| 638 | 3300046689 | Ga0495613_0123721 | Ga0495613_0123721_990_1805 | 256 |
| 639 | 3300046690 | Ga0495624_0021015 | Ga0495624_0021015_797_1600 | 256 |
| 640 | 3300046809 | Ga0495600_0000030 | Ga0495600_0000030_17078_17881 | 256 |
| 641 | 3300047317 | Ga0495604_0000030 | Ga0495604_0000030_92726_93529 | 256 |
| 642 | 3300047319 | Ga0495674_0000009 | Ga0495674_0000009_264608_265411 | 256 |
| 643 | 3300047319 | Ga0495674_0416644 | Ga0495674_0416644_96_911 | 256 |
| 644 | 3300047322 | Ga0495680_0000359 | Ga0495680_0000359_7123_7926 | 256 |
| 645 | 3300047322 | Ga0495680_0054186 | Ga0495680_0054186_1005_1820 | 256 |
| 646 | 3300047444 | Ga0495675_0000056 | Ga0495675_0000056_23246_24049 | 256 |
| 647 | 3300047471 | Ga0495684_0000056 | Ga0495684_0000056_7145_7948 | 256 |
| 648 | 3300047673 | Ga0495593_0003363 | Ga0495593_0003363_2398_3201 | 256 |
| 649 | 3300048088 | Ga0495602_0000006 | Ga0495602_0000006_71745_72548 | 256 |
| 650 | 3300050512 | nmdc:mga0n895_35286_c1 | nmdc:mga0n895_35286_c1_3471_4274 | 256 |
| 651 | 3300053077 | Ga0495601_0000007 | Ga0495601_0000007_293510_294313 | 256 |
| 652 | 3300053078 | Ga0495612_0000053 | Ga0495612_0000053_44941_45744 | 256 |
| 653 | 3300053084 | Ga0495595_0000031 | Ga0495595_0000031_59426_60229 | 256 |
| 654 | 3300053085 | Ga0495619_0000023 | Ga0495619_0000023_93639_94442 | 256 |
| 655 | iso_pu_bacteria | 3003930520 | 3003933457 | 256 |
| 656 | 3300005435 | Ga0070714_100026165 | Ga0070714_1000261655 | 257 |
| 657 | 3300025230 | Ga0209563_101940 | Ga0209563_1019403 | 257 |
| 658 | 3300031239 | Ga0265328_10014176 | Ga0265328_100141765 | 257 |
| 659 | 3300031250 | Ga0265331_10003778 | Ga0265331_100037783 | 257 |
| 660 | 3300049570 | Ga0501033_0000190 | Ga0501033_0000190_42054_42884 | 257 |
| 661 | 3300049571 | Ga0501034_0006611 | Ga0501034_0006611_11336_12154 | 257 |
| 662 | 3300049580 | Ga0501046_0390689 | Ga0501046_0390689_131_943 | 257 |
| 663 | 3300049822 | Ga0501035_0001475 | Ga0501035_0001475_9205_10035 | 257 |
| 664 | 3300060353 | Ga0501082_0193753 | Ga0501082_0193753_645_1457 | 257 |
| 665 | 3300060353 | Ga0501082_0273708 | Ga0501082_0273708_257_1162 | 257 |
| 666 | 3300003775 | Ga0055524_1009044 | Ga0055524_10090443 | 258 |
| 667 | 3300005445 | Ga0070708_100170066 | Ga0070708_1001700663 | 258 |
| 668 | 3300006186 | Ga0075369_10099478 | Ga0075369_100994782 | 258 |
| 669 | 3300006871 | Ga0075434_100139490 | Ga0075434_1001394905 | 258 |
| 670 | 3300007076 | Ga0075435_100124241 | Ga0075435_1001242412 | 258 |
| 671 | 3300050512 | nmdc:mga0n895_188922_c1 | nmdc:mga0n895_188922_c1_1177_2019 | 258 |
| 672 | 3300050516 | nmdc:mga0sz30_197175_c1 | nmdc:mga0sz30_197175_c1_60_872 | 258 |
| 673 | 3300053134 | Ga0500658_0169566 | Ga0500658_0169566_147_965 | 258 |
| 674 | iso_pu_bacteria | 2919709256 | 2919713166 | 258 |
| 675 | 3300053108 | Ga0500562_004450 | Ga0500562_004450_141_920 | 259 |
| 676 | 3300005289 | Ga0065704_10011146 | Ga0065704_100111463 | 261 |
| 677 | 3300005295 | Ga0065707_10086855 | Ga0065707_100868551 | 261 |
| 678 | 3300005353 | Ga0070669_100366078 | Ga0070669_1003660782 | 261 |
| 679 | 3300009978 | Ga0105148_100072 | Ga0105148_10007211 | 261 |
| 680 | 3300014326 | Ga0157380_10145983 | Ga0157380_101459832 | 261 |
| 681 | 3300025923 | Ga0207681_10184656 | Ga0207681_101846562 | 261 |
| 682 | 3300025925 | Ga0207650_10331237 | Ga0207650_103312372 | 261 |
| 683 | 3300025931 | Ga0207644_10052826 | Ga0207644_100528262 | 261 |
| 684 | 3300048912 | Ga0496109_0026244 | Ga0496109_0026244_4109_4894 | 261 |
| 685 | 3300048916 | Ga0496113_0079235 | Ga0496113_0079235_1348_2133 | 261 |
| 686 | 3300048927 | Ga0496124_0069930 | Ga0496124_0069930_396_1181 | 261 |
| 687 | 3300049551 | Ga0501335_000262 | Ga0501335_000262_1053_1838 | 261 |
| 688 | 3300049663 | Ga0501223_001437 | Ga0501223_001437_4052_4837 | 261 |
| 689 | 3300049669 | Ga0501235_001074 | Ga0501235_001074_2183_2968 | 261 |
| 690 | 3300049705 | Ga0501225_0000036 | Ga0501225_0000036_20644_21429 | 261 |
| 691 | 3300049705 | Ga0501225_0002246 | Ga0501225_0002246_4997_5782 | 261 |
| 692 | 3300049705 | Ga0501225_0016000 | Ga0501225_0016000_299_1084 | 261 |
| 693 | 3300049708 | Ga0501245_002332 | Ga0501245_002332_1537_2322 | 261 |
| 694 | 3300049761 | Ga0501264_006153 | Ga0501264_006153_205_990 | 261 |
| 695 | 3300009147 | Ga0114129_10270134 | Ga0114129_102701343 | 262 |
| 696 | 3300046452 | Ga0495617_024550 | Ga0495617_024550_1080_1874 | 262 |
| 697 | 3300046453 | Ga0495627_000132 | Ga0495627_000132_27114_27905 | 262 |
| 698 | 3300046453 | Ga0495627_004439 | Ga0495627_004439_2817_3611 | 262 |
| 699 | 3300046491 | Ga0495584_0059196 | Ga0495584_0059196_776_1567 | 262 |
| 700 | 3300046512 | Ga0495610_0000071 | Ga0495610_0000071_873_1667 | 262 |
| 701 | 3300046512 | Ga0495610_0109727 | Ga0495610_0109727_189_980 | 262 |
| 702 | 3300046518 | Ga0495631_0097145 | Ga0495631_0097145_40_834 | 262 |
| 703 | 3300046520 | Ga0495637_0003841 | Ga0495637_0003841_5861_6655 | 262 |
| 704 | 3300046520 | Ga0495637_0010181 | Ga0495637_0010181_2557_3348 | 262 |
| 705 | 3300046522 | Ga0495643_0000053 | Ga0495643_0000053_74801_75592 | 262 |
| 706 | 3300046524 | Ga0495648_0011071 | Ga0495648_0011071_5638_6429 | 262 |
| 707 | 3300046524 | Ga0495648_0028063 | Ga0495648_0028063_2175_2966 | 262 |
| 708 | 3300046665 | Ga0495661_0160755 | Ga0495661_0160755_45_839 | 262 |
| 709 | 3300046692 | Ga0495671_0000031 | Ga0495671_0000031_126439_127230 | 262 |
| 710 | 3300047470 | Ga0495681_0000228 | Ga0495681_0000228_18735_19529 | 262 |
| 711 | 3300047470 | Ga0495681_0013181 | Ga0495681_0013181_2909_3700 | 262 |
| 712 | 3300047472 | Ga0495686_0022395 | Ga0495686_0022395_362_1156 | 262 |
| 713 | 3300047472 | Ga0495686_0072533 | Ga0495686_0072533_805_1596 | 262 |
| 714 | 3300048928 | Ga0496125_0112012 | Ga0496125_0112012_311_1102 | 262 |
| 715 | 3300049459 | Ga0495678_033720 | Ga0495678_033720_845_1639 | 262 |
| 716 | 3300050507 | nmdc:mga05p37_320917_c1 | nmdc:mga05p37_320917_c1_657_1448 | 262 |
| 717 | 2162886007 | SwRhRL2b_contig_3148643 | SwRhRL2b_0994.00006710 | 263 |
| 718 | 3300048913 | Ga0496110_0033405 | Ga0496110_0033405_57_848 | 263 |
| 719 | 3300048914 | Ga0496111_0288985 | Ga0496111_0288985_365_1156 | 263 |
| 720 | 3300048924 | Ga0496121_0055870 | Ga0496121_0055870_922_1713 | 263 |
| 721 | 3300048925 | Ga0496122_0060055 | Ga0496122_0060055_1974_2765 | 263 |
| 722 | 3300048927 | Ga0496124_0005153 | Ga0496124_0005153_3603_4394 | 263 |
| 723 | 3300048928 | Ga0496125_0002334 | Ga0496125_0002334_11361_12152 | 263 |
| 724 | 3300048929 | Ga0496126_0055653 | Ga0496126_0055653_1457_2248 | 263 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b9v-assembly1.cif.gz_A | crystal structure of a new diphosphatase from the phnp family | 0.9461 | 1 | 256 |
| 3qh8-assembly1.cif.gz_A | crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data | 0.944 | 2 | 256 |
| 6b9v-assembly1.cif.gz_B | crystal structure of a new diphosphatase from the phnp family | 0.9384 | 3 | 257 |
| 6b9v-assembly1.cif.gz_A | crystal structure of a new diphosphatase from the phnp family | 0.9208 | 1 | 256 |
| 6b9v-assembly1.cif.gz_B | crystal structure of a new diphosphatase from the phnp family | 0.9168 | 3 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3py6A00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9447 | 2 | 256 | 3.60.15.10 |
| 3py6A00 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9131 | 2 | 256 | 3.60.15.10 |
| af_C4J9M0_89_373_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9046 | 1 | 256 | 3.60.15.10 |
| af_O74545_3_299_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9045 | 2 | 256 | 3.60.15.10 |
| af_I1K3H5_2_307_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8891 | 3 | 257 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A520HQX3-F1-model_v4 | MBL fold metallo-hydrolase | 0.9987 | 5 | 121 |
GO:0016787
|
| AF-A0A431JRA6-F1-model_v4 | deleted | 0.998 | 41 | 252 |
|
| AF-A0A520IMV3-F1-model_v4 | MBL fold metallo-hydrolase | 0.9974 | 5 | 141 |
GO:0016787
|
| AF-A0A2W5EPR2-F1-model_v4 | deleted | 0.9972 | 5 | 99 |
|
| AF-A0A4Q3CD66-F1-model_v4 | MBL fold metallo-hydrolase | 0.9967 | 102 | 256 |
GO:0016787
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar