F477586

General Info

Members Datasets Scaffolds Average Seq Length
724 367 707 265

Family's Representative Sequence

Representative Sequence 3300060353|Ga0501082_0273708|Ga0501082_0273708_257_1162
Length 301
Sequence MSATLRVTVLGCGSSPGVPRIGNDWGACDPNEPRNRRLRCSILLERMEEGGVTRALVDTGPDVREQLLAAKVGTLDGVVYTHSHADHTHGIDDLRAFWQNTKRLVDVYADAMTFDRLNAAFGYCFAAPPGSSYPPILKHRPIAAGTPFAIDGAGGLLTVVPFAQVHGDIETLGLRVGAFAYSCDVSGLSDTAQSVLRGLDVWIVDALRYHPHPSHFSVNESLQWIDRVKPKHAVLTHMHIDLDYQTLRRTLPTGVEPAYDGMRIEAAAVRPERMSGFASRTVSGCVPSKITRQFRPAAFAA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
3 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
4 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
5 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
6 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
7 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
8 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
9 2902330777 Methylobacterium sp. 2A Isolate Unclassified
10 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
11 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
12 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
13 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
14 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
15 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
16 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
98 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
110 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
165 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
166 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
167 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
185 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
201 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
205 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
208 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
227 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
241 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
242 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
243 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
244 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
245 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
246 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
247 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
250 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
254 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
268 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
275 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
282 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
283 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
284 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
285 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
286 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
287 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
288 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
289 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
290 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
291 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
292 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
295 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
296 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
297 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
302 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
316 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
321 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
322 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
323 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
324 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
325 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
326 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
330 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
335 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
336 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
352 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
353 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
354 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
355 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
356 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
357 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
358 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
359 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
360 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
361 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
362 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
363 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
364 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
365 641522639 Methylobacterium sp. 4-46 Isolate Nodule
366 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
367 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.51
Metatranscriptomes 0.14
Isolates 2.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.14
Nodule 0.41
Rhizoplane 9.25
Rhizosphere 82.46
Stem 0
Stem Tuber 0
Unclassified 3.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3148643 2162886007 Bacteria 925
2 JGI25404J52841_10012620 3300003659 Bacteria 1831
3 Ga0055524_1009044 3300003775 Bacteria 4087
4 Ga0065704_10011146 3300005289 Bacteria 3784
5 Ga0065707_10086855 3300005295 Bacteria 5274
6 Ga0065707_10232668 3300005295 Bacteria 1175
7 Ga0070658_10074784 3300005327 Bacteria 2778
8 Ga0070658_10207048 3300005327 Bacteria 1656
9 Ga0070683_100372946 3300005329 Unclassified 1359
10 Ga0070666_10012760 3300005335 Bacteria 5312
11 Ga0070680_100010440 3300005336 Bacteria 7161
12 Ga0070680_100344497 3300005336 Bacteria 1267
13 Ga0070682_100012105 3300005337 Bacteria 4937
14 Ga0070682_100058723 3300005337 Bacteria 2427
15 Ga0068868_100016541 3300005338 Bacteria 5481
16 Ga0070660_100133662 3300005339 Bacteria 1987
17 Ga0070660_100217926 3300005339 Bacteria 1551
18 Ga0070689_100123406 3300005340 Bacteria 2071
19 Ga0070669_100366078 3300005353 Bacteria 1173
20 Ga0070671_100424108 3300005355 Bacteria 1139
21 Ga0070674_100256515 3300005356 Bacteria 1376
22 Ga0070673_100538415 3300005364 Bacteria 1060
23 Ga0070659_100008759 3300005366 Bacteria 7406
24 Ga0070659_100343138 3300005366 Bacteria 1252
25 Ga0070659_100446356 3300005366 Bacteria 1097
26 Ga0070667_100036594 3300005367 Bacteria 4115
27 Ga0070667_100046824 3300005367 Bacteria 3638
28 Ga0070667_100203743 3300005367 Bacteria 1756
29 Ga0070714_100026165 3300005435 Bacteria 4820
30 Ga0070714_100111798 3300005435 Bacteria 2420
31 Ga0070713_100001334 3300005436 Bacteria 15775
32 Ga0070713_100010460 3300005436 Bacteria 6700
33 Ga0070713_100022406 3300005436 Bacteria 4882
34 Ga0070713_100546771 3300005436 Bacteria 1096
35 Ga0070710_10034315 3300005437 Bacteria 2760
36 Ga0070710_10060442 3300005437 Bacteria 2156
37 Ga0070710_10198065 3300005437 Bacteria 1266
38 Ga0070705_100111701 3300005440 Bacteria 1747
39 Ga0070694_100201447 3300005444 Bacteria 1484
40 Ga0070708_100170066 3300005445 Bacteria 2034
41 Ga0070663_100033099 3300005455 Bacteria 3568
42 Ga0070663_100140935 3300005455 Bacteria 1841
43 Ga0070678_100283137 3300005456 Bacteria 1403
44 Ga0070662_100342898 3300005457 Bacteria 1223
45 Ga0070681_10014737 3300005458 Bacteria 7772
46 Ga0070681_10019210 3300005458 Bacteria 6840
47 Ga0070681_10355447 3300005458 Bacteria 1375
48 Ga0070707_100545999 3300005468 Bacteria 1121
49 Ga0070679_100014161 3300005530 Bacteria 7651
50 Ga0070679_100071061 3300005530 Bacteria 3471
51 Ga0070679_100072922 3300005530 Bacteria 3425
52 Ga0070679_100090176 3300005530 Bacteria 3054
53 Ga0070679_100220086 3300005530 Bacteria 1860
54 Ga0070679_100272100 3300005530 Bacteria 1648
55 Ga0070684_100080641 3300005535 Bacteria 2879
56 Ga0070684_100085934 3300005535 Bacteria 2791
57 Ga0068853_100012299 3300005539 Bacteria 6960
58 Ga0068853_100340757 3300005539 Bacteria 1393
59 Ga0070695_100113809 3300005545 Bacteria 1840
60 Ga0070695_100120402 3300005545 Bacteria 1795
61 Ga0070696_100074129 3300005546 Bacteria 2399
62 Ga0070693_100080219 3300005547 Bacteria 1944
63 Ga0070665_100263611 3300005548 Bacteria 1724
64 Ga0068855_100040468 3300005563 Bacteria 5532
65 Ga0068855_100053478 3300005563 Bacteria 4750
66 Ga0070664_100350466 3300005564 Bacteria 1343
67 Ga0068857_100109762 3300005577 Bacteria 2479
68 Ga0068856_100365364 3300005614 Bacteria 1462
69 Ga0070702_100008860 3300005615 Bacteria 4895
70 Ga0070702_100281733 3300005615 Bacteria 1142
71 Ga0068864_100577944 3300005618 Bacteria 1088
72 Ga0068866_10006292 3300005718 Bacteria 4943
73 Ga0068861_100159895 3300005719 Bacteria 1857
74 Ga0068858_100066767 3300005842 Bacteria 3331
75 Ga0068858_100075971 3300005842 Bacteria 3121
76 Ga0068858_100082519 3300005842 Bacteria 2988
77 Ga0068860_100252508 3300005843 Bacteria 1718
78 Ga0081455_10006367 3300005937 Bacteria 12673
79 Ga0081540_1000092 3300005983 Bacteria 94188
80 Ga0070717_10010099 3300006028 Bacteria 7109
81 Ga0070717_10144372 3300006028 Bacteria 2055
82 Ga0070717_10149331 3300006028 Bacteria 2021
83 Ga0075368_10113374 3300006042 Bacteria 1119
84 Ga0075363_100035266 3300006048 Bacteria 2617
85 Ga0075432_10005920 3300006058 Bacteria 4160
86 Ga0070715_10016048 3300006163 Bacteria 2806
87 Ga0070712_100011837 3300006175 Bacteria 5542
88 Ga0075367_10101239 3300006178 Bacteria 1761
89 Ga0075369_10099478 3300006186 Bacteria 1304
90 Ga0075366_10145078 3300006195 Bacteria 1436
91 Ga0097621_100078050 3300006237 Bacteria 2750
92 Ga0097621_100111963 3300006237 Bacteria 2307
93 Ga0075370_10292180 3300006353 Bacteria 969
94 Ga0068871_100122289 3300006358 Bacteria 2200
95 Ga0068871_100134061 3300006358 Bacteria 2102
96 Ga0068871_100275488 3300006358 Bacteria 1470
97 Ga0075428_100040128 3300006844 Bacteria 5151
98 Ga0075428_100208507 3300006844 Bacteria 2112
99 Ga0075430_100008514 3300006846 Bacteria 8664
100 Ga0075430_100266169 3300006846 Bacteria 1419
101 Ga0075430_100362983 3300006846 Bacteria 1196
102 Ga0075431_100003469 3300006847 Bacteria 15291
103 Ga0075431_100054811 3300006847 Bacteria 4112
104 Ga0075431_100100179 3300006847 Bacteria 2989
105 Ga0075431_100388789 3300006847 Bacteria 1398
106 Ga0075433_10000381 3300006852 Bacteria 28058
107 Ga0075433_10026584 3300006852 Bacteria 4902
108 Ga0075433_10439198 3300006852 Bacteria 1150
109 Ga0075434_100003667 3300006871 Bacteria 13720
110 Ga0075434_100139490 3300006871 Bacteria 2444
111 Ga0075434_100414545 3300006871 Bacteria 1368
112 Ga0075429_100002836 3300006880 Bacteria 14660
113 Ga0075429_100275512 3300006880 Bacteria 1473
114 Ga0075436_100002343 3300006914 Bacteria 13078
115 Ga0075436_100028198 3300006914 Bacteria 3862
116 Ga0075435_100106840 3300007076 Bacteria 2324
117 Ga0075435_100124241 3300007076 Bacteria 2156
118 Ga0105240_10024091 3300009093 Bacteria 8036
119 Ga0111539_10003115 3300009094 Bacteria 21974
120 Ga0105245_10047623 3300009098 Bacteria 3832
121 Ga0105245_10051168 3300009098 Bacteria 3703
122 Ga0105245_10098913 3300009098 Bacteria 2696
123 Ga0105247_10040503 3300009101 Bacteria 2848
124 Ga0105247_10236596 3300009101 Bacteria 1242
125 Ga0114129_10018648 3300009147 Bacteria 9879
126 Ga0114129_10125652 3300009147 Bacteria 3527
127 Ga0114129_10270134 3300009147 Bacteria 2275
128 Ga0114129_10687566 3300009147 Bacteria 1316
129 Ga0105243_10009745 3300009148 Bacteria 7316
130 Ga0105243_10050314 3300009148 Bacteria 3291
131 Ga0105243_10779916 3300009148 Bacteria 940
132 Ga0105241_10142191 3300009174 Bacteria 1955
133 Ga0105242_10045782 3300009176 Bacteria 3547
134 Ga0105237_10022531 3300009545 Bacteria 6462
135 Ga0105237_10094800 3300009545 Bacteria 2973
136 Ga0105238_10160394 3300009551 Bacteria 2224
137 Ga0105238_10244566 3300009551 Bacteria 1772
138 Ga0105148_100072 3300009978 Bacteria 15543
139 Ga0105239_10155328 3300010375 Bacteria 2555
140 Ga0105246_10047511 3300011119 Bacteria 2931
141 Ga0105246_10094682 3300011119 Bacteria 2161
142 Ga0105246_10216768 3300011119 Bacteria 1497
143 Ga0105246_10270913 3300011119 Bacteria 1357
144 Ga0157336_1005365 3300012477 Bacteria 843
145 Ga0157327_1001340 3300012512 Bacteria 1523
146 Ga0157371_10066651 3300013102 Bacteria 2549
147 Ga0157370_10283515 3300013104 Bacteria 1530
148 Ga0157374_10056485 3300013296 Bacteria 3665
149 Ga0157374_10207808 3300013296 Bacteria 1919
150 Ga0157378_10157005 3300013297 Bacteria 2124
151 Ga0157378_10237158 3300013297 Bacteria 1741
152 Ga0163162_10507502 3300013306 Bacteria 1336
153 Ga0163162_10539032 3300013306 Bacteria 1296
154 Ga0157372_10323707 3300013307 Bacteria 1795
155 Ga0157375_10062711 3300013308 Bacteria 3695
156 Ga0157375_10111621 3300013308 Bacteria 2833
157 Ga0157375_10211693 3300013308 Bacteria 2096
158 Ga0157380_10145983 3300014326 Bacteria 2039
159 Ga0157379_10092458 3300014968 Bacteria 2713
160 Ga0157379_10408390 3300014968 Bacteria 1249
161 Ga0157376_10143604 3300014969 Bacteria 2144
162 Ga0213874_10049336 3300021377 Bacteria 1286
163 Ga0209563_101940 3300025230 Bacteria 4990
164 Ga0207692_10017186 3300025898 Bacteria 3221
165 Ga0207692_10079013 3300025898 Bacteria 1754
166 Ga0207692_10091747 3300025898 Bacteria 1649
167 Ga0207710_10006645 3300025900 Bacteria 4930
168 Ga0207710_10069449 3300025900 Bacteria 1613
169 Ga0207680_10003367 3300025903 Bacteria 7532
170 Ga0207647_10046405 3300025904 Bacteria 2708
171 Ga0207685_10003024 3300025905 Bacteria 3996
172 Ga0207699_10002350 3300025906 Bacteria 8939
173 Ga0207645_10049701 3300025907 Bacteria 2678
174 Ga0207645_10218904 3300025907 Bacteria 1255
175 Ga0207705_10076088 3300025909 Bacteria 2439
176 Ga0207705_10126975 3300025909 Bacteria 1896
177 Ga0207654_10012053 3300025911 Bacteria 4423
178 Ga0207654_10213604 3300025911 Bacteria 1276
179 Ga0207707_10008102 3300025912 Bacteria 9123
180 Ga0207707_10168105 3300025912 Bacteria 1916
181 Ga0207707_10196483 3300025912 Bacteria 1759
182 Ga0207695_10051868 3300025913 Bacteria 4303
183 Ga0207671_10058380 3300025914 Bacteria 2860
184 Ga0207671_10380559 3300025914 Bacteria 1121
185 Ga0207693_10012596 3300025915 Bacteria 6832
186 Ga0207663_10031210 3300025916 Bacteria 3151
187 Ga0207663_10099009 3300025916 Bacteria 1954
188 Ga0207660_10073511 3300025917 Bacteria 2493
189 Ga0207660_10167178 3300025917 Bacteria 1701
190 Ga0207660_10285680 3300025917 Bacteria 1310
191 Ga0207660_10436646 3300025917 Bacteria 1057
192 Ga0207657_10114435 3300025919 Bacteria 2225
193 Ga0207657_10205037 3300025919 Bacteria 1584
194 Ga0207652_10029320 3300025921 Bacteria 4600
195 Ga0207652_10053749 3300025921 Bacteria 3460
196 Ga0207652_10060507 3300025921 Bacteria 3267
197 Ga0207652_10160213 3300025921 Bacteria 2017
198 Ga0207652_10275026 3300025921 Bacteria 1519
199 Ga0207681_10184656 3300025923 Bacteria 1591
200 Ga0207694_10105985 3300025924 Bacteria 2232
201 Ga0207694_10226115 3300025924 Bacteria 1527
202 Ga0207694_10236776 3300025924 Bacteria 1491
203 Ga0207650_10331237 3300025925 Bacteria 1249
204 Ga0207659_10247545 3300025926 Bacteria 1445
205 Ga0207687_10005912 3300025927 Bacteria 8097
206 Ga0207700_10001704 3300025928 Bacteria 12483
207 Ga0207700_10080569 3300025928 Bacteria 2539
208 Ga0207664_10003652 3300025929 Bacteria 10310
209 Ga0207644_10052826 3300025931 Bacteria 2922
210 Ga0207644_10292448 3300025931 Bacteria 1310
211 Ga0207690_10011868 3300025932 Bacteria 5209
212 Ga0207690_10136120 3300025932 Bacteria 1804
213 Ga0207706_10013231 3300025933 Bacteria 7505
214 Ga0207686_10126220 3300025934 Bacteria 1749
215 Ga0207670_10024593 3300025936 Bacteria 3766
216 Ga0207669_10145742 3300025937 Bacteria 1651
217 Ga0207704_10277794 3300025938 Bacteria 1272
218 Ga0207665_10001096 3300025939 Bacteria 18237
219 Ga0207665_10079067 3300025939 Bacteria 2260
220 Ga0207665_10197896 3300025939 Bacteria 1463
221 Ga0207711_10049726 3300025941 Bacteria 3589
222 Ga0207711_10502391 3300025941 Bacteria 1130
223 Ga0207689_10487060 3300025942 Bacteria 1033
224 Ga0207661_10040178 3300025944 Bacteria 3676
225 Ga0207661_10286278 3300025944 Bacteria 1474
226 Ga0207679_10010041 3300025945 Bacteria 6084
227 Ga0207679_10124061 3300025945 Bacteria 2061
228 Ga0207667_10197621 3300025949 Bacteria 2063
229 Ga0207667_10640506 3300025949 Bacteria 1069
230 Ga0207668_10085410 3300025972 Bacteria 2303
231 Ga0207668_10237479 3300025972 Bacteria 1473
232 Ga0207640_10151336 3300025981 Bacteria 1705
233 Ga0207640_10283622 3300025981 Bacteria 1302
234 Ga0207658_10123273 3300025986 Bacteria 2070
235 Ga0207677_10016714 3300026023 Bacteria 4354
236 Ga0207703_10066839 3300026035 Bacteria 2958
237 Ga0207639_10006047 3300026041 Bacteria 8212
238 Ga0207678_10002916 3300026067 Bacteria 15510
239 Ga0207678_10012097 3300026067 Bacteria 7577
240 Ga0207678_10061279 3300026067 Bacteria 3236
241 Ga0207708_10043682 3300026075 Bacteria 3415
242 Ga0207702_10282914 3300026078 Bacteria 1569
243 Ga0207676_10012407 3300026095 Bacteria 6105
244 Ga0207674_10044393 3300026116 Bacteria 4577
245 Ga0207674_10157185 3300026116 Bacteria 2229
246 Ga0207675_100367329 3300026118 Bacteria 1413
247 Ga0207683_10011732 3300026121 Bacteria 7479
248 Ga0207683_10019514 3300026121 Bacteria 5789
249 Ga0209813_10012654 3300027866 Bacteria 2236
250 Ga0207428_10000776 3300027907 Bacteria 36258
251 Ga0268266_10016436 3300028379 Bacteria 6324
252 Ga0265337_1018756 3300028556 Bacteria 2191
253 Ga0307515_10001215 3300028794 Bacteria 58879
254 Ga0265338_10022980 3300028800 Bacteria 6429
255 Ga0265338_10169730 3300028800 Bacteria 1675
256 Ga0265330_10030052 3300031235 Bacteria 2441
257 Ga0265330_10046342 3300031235 Bacteria 1916
258 Ga0265328_10000087 3300031239 Bacteria 47641
259 Ga0265328_10000410 3300031239 Bacteria 20044
260 Ga0265328_10014176 3300031239 Bacteria 3142
261 Ga0265328_10019206 3300031239 Bacteria 2628
262 Ga0265328_10020256 3300031239 Bacteria 2547
263 Ga0265328_10034280 3300031239 Bacteria 1880
264 Ga0265328_10060414 3300031239 Bacteria 1391
265 Ga0265325_10000006 3300031241 Bacteria 255758
266 Ga0265325_10030103 3300031241 Bacteria 2913
267 Ga0265325_10051855 3300031241 Bacteria 2108
268 Ga0265329_10008674 3300031242 Bacteria 3839
269 Ga0265339_10013815 3300031249 Bacteria 4886
270 Ga0265339_10029619 3300031249 Bacteria 3105
271 Ga0265339_10032332 3300031249 Bacteria 2951
272 Ga0265339_10167686 3300031249 Bacteria 1101
273 Ga0265331_10000007 3300031250 Bacteria 331074
274 Ga0265331_10000585 3300031250 Bacteria 32602
275 Ga0265331_10003778 3300031250 Bacteria 9605
276 Ga0265316_10000423 3300031344 Bacteria 48244
277 Ga0307513_10048768 3300031456 Bacteria 4592
278 Ga0307513_10163272 3300031456 Bacteria 2116
279 Ga0265313_10000115 3300031595 Bacteria 81365
280 Ga0265313_10001555 3300031595 Bacteria 21310
281 Ga0316575_10090114 3300031665 Bacteria 1242
282 Ga0265342_10000763 3300031712 Bacteria 32827
283 Ga0265342_10013987 3300031712 Bacteria 5346
284 Ga0316576_10005920 3300031727 Bacteria 7549
285 Ga0316576_10084976 3300031727 Bacteria 2352
286 Ga0316578_10006902 3300031728 Bacteria 5645
287 Ga0307516_10067237 3300031730 Bacteria 3454
288 Ga0316583_10000647 3300032133 Bacteria 10673
289 Ga0373926_0010240 3300035083 Bacteria 3139
290 Ga0373949_0009779 3300035090 Bacteria 2099
291 Ga0373952_0021629 3300035092 Bacteria 1359
292 Ga0373923_0011828 3300035111 Bacteria 3212
293 Ga0373923_0149719 3300035111 Bacteria 1059
294 Ga0373932_0075721 3300035112 Bacteria 1053
295 Ga0373936_0006091 3300035113 Bacteria 4544
296 Ga0373939_0021458 3300035114 Bacteria 1768
297 Ga0373941_0006526 3300035115 Bacteria 2816
298 Ga0373941_0160623 3300035115 Bacteria 831
299 Ga0373945_0005656 3300035116 Bacteria 4009
300 Ga0373945_0077005 3300035116 Bacteria 1272
301 Ga0373953_0013803 3300035117 Bacteria 2892
302 Ga0373954_0029504 3300035118 Bacteria 2526
303 Ga0373954_0068508 3300035118 Bacteria 1683
304 Ga0373956_0004635 3300035119 Bacteria 5496
305 Ga0373956_0042918 3300035119 Bacteria 2012
306 Ga0373956_0056408 3300035119 Bacteria 1773
307 Ga0373957_0022515 3300035120 Bacteria 2246
308 Ga0373960_0051821 3300035121 Bacteria 1220
309 Ga0373943_0108900 3300035170 Bacteria 1459
310 Ga0373946_0006988 3300035171 Bacteria 4113
311 Ga0373946_0007704 3300035171 Bacteria 3945
312 Ga0373946_0077086 3300035171 Bacteria 1452
313 Ga0373955_0001327 3300035172 Bacteria 10492
314 Ga0373955_0002179 3300035172 Bacteria 8483
315 Ga0373955_0011098 3300035172 Bacteria 4280
316 Ga0373961_0017473 3300035241 Bacteria 1861
317 Ga0373961_0030359 3300035241 Bacteria 1503
318 Ga0373962_0040675 3300035242 Bacteria 1308
319 Ga0316574_0000075 3300035398 Bacteria 27326
320 Ga0316574_0000154 3300035398 Bacteria 22281
321 Ga0373924_0006015 3300035410 Bacteria 4328
322 Ga0373924_0006213 3300035410 Bacteria 4272
323 Ga0373924_0021735 3300035410 Bacteria 2503
324 Ga0373924_0117042 3300035410 Bacteria 1155
325 Ga0373931_0049261 3300035691 Bacteria 2236
326 Ga0373931_0050069 3300035691 Bacteria 2222
327 Ga0373935_0000006 3300035692 Bacteria 121726
328 Ga0373935_0061327 3300035692 Bacteria 2407
329 Ga0373935_0070231 3300035692 Bacteria 2257
330 Ga0373927_0001008 3300035695 Bacteria 21456
331 Ga0373927_0010512 3300035695 Bacteria 6169
332 Ga0373933_0004844 3300035724 Bacteria 7352
333 Ga0373933_0010010 3300035724 Bacteria 5191
334 Ga0373933_0028451 3300035724 Bacteria 3224
335 Ga0373947_0004133 3300035725 Bacteria 8533
336 Ga0373947_0022516 3300035725 Bacteria 3655
337 Ga0373937_0000124 3300036401 Bacteria 73933
338 Ga0373937_0009181 3300036401 Bacteria 8582
339 Ga0373937_0037169 3300036401 Bacteria 4437
340 Ga0373937_0144541 3300036401 Bacteria 2226
341 Ga0316584_0003492 3300036712 Bacteria 10237
342 Ga0316584_0087795 3300036712 Bacteria 2328
343 Ga0373925_0000210 3300037068 Bacteria 63621
344 Ga0373925_0005243 3300037068 Bacteria 9685
345 Ga0373925_0449614 3300037068 Bacteria 1055
346 Ga0395899_0002072 3300037312 Bacteria 16480
347 Ga0395900_0001691 3300037418 Bacteria 25639
348 Ga0395900_0002324 3300037418 Bacteria 21074
349 Ga0395898_0004548 3300037466 Bacteria 15139
350 Ga0395898_0009208 3300037466 Bacteria 10388
351 Ga0395898_0042046 3300037466 Bacteria 4511
352 Ga0395898_0164347 3300037466 Bacteria 2123
353 Ga0395905_0001088 3300037471 Bacteria 34174
354 Ga0395905_0027361 3300037471 Bacteria 5377
355 Ga0395905_0038658 3300037471 Bacteria 4476
356 Ga0436364_1065930 3300037853 Bacteria 1234
357 Ga0395901_0080700 3300038443 Bacteria 3397
358 Ga0395901_0083715 3300038443 Bacteria 3334
359 Ga0395901_0123735 3300038443 Bacteria 2718
360 Ga0436365_1213299 3300039437 Bacteria 7836
361 Ga0436365_1523457 3300039437 Bacteria 981
362 Ga0436365_1884774 3300039437 Bacteria 9036
363 Ga0436361_0418519 3300039447 Bacteria 1230
364 Ga0436363_1287891 3300039450 Bacteria 5234
365 Ga0466966_0092610 3300044684 Bacteria 1875
366 Ga0466963_0016707 3300044694 Bacteria 4566
367 Ga0466963_0095765 3300044694 Bacteria 2027
368 Ga0466957_0387863 3300044842 Bacteria 953
369 Ga0466959_0053100 3300045049 Bacteria 2964
370 Ga0466959_0117710 3300045049 Bacteria 1891
371 Ga0451576_0140632 3300045051 Bacteria 2517
372 Ga0466967_0269413 3300045976 Bacteria 1631
373 Ga0466967_0293779 3300045976 Bacteria 1562
374 Ga0466967_0344499 3300045976 Bacteria 1442
375 Ga0495617_024550 3300046452 Bacteria 2034
376 Ga0495627_000132 3300046453 Bacteria 90039
377 Ga0495627_004439 3300046453 Bacteria 5872
378 Ga0495592_0000020 3300046454 Bacteria 140576
379 Ga0495592_0030192 3300046454 Bacteria 4099
380 Ga0495603_0040512 3300046455 Bacteria 2788
381 Ga0495603_0072991 3300046455 Bacteria 2016
382 Ga0495629_0003499 3300046459 Bacteria 11873
383 Ga0495629_0006124 3300046459 Bacteria 8936
384 Ga0495629_0021025 3300046459 Bacteria 4656
385 Ga0495629_0042163 3300046459 Bacteria 3208
386 Ga0495641_0037402 3300046461 Bacteria 2275
387 Ga0495641_0110901 3300046461 Bacteria 1224
388 Ga0495651_0001410 3300046462 Bacteria 18660
389 Ga0495651_0009161 3300046462 Bacteria 7598
390 Ga0495653_0000046 3300046463 Bacteria 113893
391 Ga0495653_0004086 3300046463 Bacteria 11805
392 Ga0495582_0006763 3300046473 Bacteria 6376
393 Ga0495582_0054771 3300046473 Bacteria 2199
394 Ga0495582_0327595 3300046473 Bacteria 881
395 Ga0495639_0053255 3300046475 Bacteria 1843
396 Ga0495639_0191680 3300046475 Bacteria 998
397 Ga0495662_0000709 3300046476 Bacteria 15836
398 Ga0495662_0079961 3300046476 Bacteria 1590
399 Ga0495664_0000017 3300046477 Bacteria 172210
400 Ga0495664_0022796 3300046477 Bacteria 3632
401 Ga0495584_0059196 3300046491 Bacteria 1927
402 Ga0495594_0006237 3300046499 Bacteria 6129
403 Ga0495594_0195505 3300046499 Bacteria 1152
404 Ga0495608_0000250 3300046511 Bacteria 39000
405 Ga0495608_0000688 3300046511 Bacteria 23406
406 Ga0495608_0071797 3300046511 Bacteria 2258
407 Ga0495610_0000071 3300046512 Bacteria 121210
408 Ga0495610_0109727 3300046512 Bacteria 1224
409 Ga0495618_0000059 3300046514 Bacteria 79623
410 Ga0495618_0002700 3300046514 Bacteria 11310
411 Ga0495628_0000022 3300046516 Bacteria 140362
412 Ga0495630_0000758 3300046517 Bacteria 22647
413 Ga0495630_0017622 3300046517 Bacteria 5235
414 Ga0495631_0097145 3300046518 Bacteria 1268
415 Ga0495637_0003841 3300046520 Bacteria 7883
416 Ga0495637_0010181 3300046520 Bacteria 4557
417 Ga0495637_0062181 3300046520 Bacteria 1529
418 Ga0495643_0000053 3300046522 Bacteria 202031
419 Ga0495648_0011071 3300046524 Bacteria 6830
420 Ga0495648_0028063 3300046524 Bacteria 3754
421 Ga0495666_0181014 3300046526 Bacteria 973
422 Ga0495652_0000008 3300046529 Bacteria 343637
423 Ga0495652_0029734 3300046529 Bacteria 4797
424 Ga0495665_0113904 3300046531 Bacteria 1417
425 Ga0495640_0000029 3300046533 Bacteria 79567
426 Ga0495640_0026478 3300046533 Bacteria 4190
427 Ga0495640_0252999 3300046533 Bacteria 1103
428 Ga0495586_0006914 3300046535 Bacteria 6044
429 Ga0495587_0000019 3300046536 Bacteria 161972
430 Ga0495587_0000534 3300046536 Bacteria 26299
431 Ga0495645_0000006 3300046543 Bacteria 382503
432 Ga0495645_0001860 3300046543 Bacteria 14334
433 Ga0495667_0000061 3300046559 Bacteria 94650
434 Ga0495667_0000771 3300046559 Bacteria 20558
435 Ga0495667_0057829 3300046559 Bacteria 2548
436 Ga0495667_0135712 3300046559 Bacteria 1586
437 Ga0495634_0001468 3300046642 Bacteria 20895
438 Ga0495634_0089886 3300046642 Bacteria 1996
439 Ga0495635_0000023 3300046663 Bacteria 153429
440 Ga0495635_0003284 3300046663 Bacteria 11171
441 Ga0495635_0172828 3300046663 Bacteria 1469
442 Ga0495661_0160755 3300046665 Bacteria 1206
443 Ga0495657_0000099 3300046675 Bacteria 76617
444 Ga0495657_0001333 3300046675 Bacteria 21487
445 Ga0495599_0000039 3300046678 Bacteria 98345
446 Ga0495599_0012706 3300046678 Bacteria 5193
447 Ga0495623_0000253 3300046679 Bacteria 34266
448 Ga0495623_0000354 3300046679 Bacteria 30302
449 Ga0495646_0000017 3300046680 Bacteria 123549
450 Ga0495646_0002006 3300046680 Bacteria 12317
451 Ga0495658_0000934 3300046683 Bacteria 15590
452 Ga0495613_0002083 3300046689 Bacteria 15219
453 Ga0495613_0006412 3300046689 Bacteria 8793
454 Ga0495613_0123721 3300046689 Bacteria 1856
455 Ga0495613_0354371 3300046689 Bacteria 1007
456 Ga0495624_0021015 3300046690 Bacteria 4334
457 Ga0495671_0000031 3300046692 Bacteria 202030
458 Ga0495600_0000030 3300046809 Bacteria 89424
459 Ga0495600_0001299 3300046809 Bacteria 13803
460 Ga0495600_0173686 3300046809 Bacteria 1390
461 Ga0495581_0064573 3300047315 Bacteria 2115
462 Ga0495604_0000030 3300047317 Bacteria 138597
463 Ga0495604_0003048 3300047317 Bacteria 13390
464 Ga0495604_0168888 3300047317 Bacteria 1540
465 Ga0495604_0234372 3300047317 Bacteria 1258
466 Ga0495674_0000009 3300047319 Bacteria 310479
467 Ga0495674_0003671 3300047319 Bacteria 14931
468 Ga0495674_0140046 3300047319 Bacteria 2034
469 Ga0495674_0416644 3300047319 Bacteria 1083
470 Ga0495676_0392842 3300047321 Bacteria 921
471 Ga0495680_0000359 3300047322 Bacteria 51000
472 Ga0495680_0006916 3300047322 Bacteria 10469
473 Ga0495680_0041419 3300047322 Bacteria 3663
474 Ga0495680_0046009 3300047322 Bacteria 3443
475 Ga0495680_0054186 3300047322 Bacteria 3116
476 Ga0495680_0064110 3300047322 Bacteria 2819
477 Ga0495675_0000056 3300047444 Bacteria 77625
478 Ga0495675_0000892 3300047444 Bacteria 18258
479 Ga0495675_0268368 3300047444 Bacteria 1020
480 Ga0495681_0000228 3300047470 Bacteria 46877
481 Ga0495681_0013181 3300047470 Bacteria 4813
482 Ga0495684_0000056 3300047471 Bacteria 79718
483 Ga0495684_0072844 3300047471 Bacteria 2610
484 Ga0495686_0022395 3300047472 Bacteria 4182
485 Ga0495686_0032905 3300047472 Bacteria 3351
486 Ga0495686_0072533 3300047472 Bacteria 2117
487 Ga0495593_0003363 3300047673 Bacteria 9582
488 Ga0495602_0000006 3300048088 Bacteria 322593
489 Ga0495602_0004679 3300048088 Bacteria 14292
490 Ga0496100_0004090 3300048903 Bacteria 7692
491 Ga0496100_0220870 3300048903 Bacteria 1390
492 Ga0496101_0015051 3300048904 Bacteria 5206
493 Ga0496101_0124197 3300048904 Bacteria 1954
494 Ga0496101_0503107 3300048904 Bacteria 957
495 Ga0496102_0013897 3300048905 Bacteria 6984
496 Ga0496102_0063973 3300048905 Bacteria 3368
497 Ga0496102_0063990 3300048905 Bacteria 3368
498 Ga0496102_0086665 3300048905 Bacteria 2892
499 Ga0496102_0260264 3300048905 Bacteria 1636
500 Ga0496103_0026239 3300048906 Bacteria 3527
501 Ga0496103_0080962 3300048906 Bacteria 2042
502 Ga0496104_0000087 3300048907 Bacteria 89813
503 Ga0496104_0077477 3300048907 Bacteria 3167
504 Ga0496104_0122154 3300048907 Bacteria 2500
505 Ga0496104_0181740 3300048907 Bacteria 2013
506 Ga0496104_0346853 3300048907 Bacteria 1397
507 Ga0496105_0012221 3300048908 Bacteria 6797
508 Ga0496105_0016627 3300048908 Bacteria 5875
509 Ga0496105_0103905 3300048908 Bacteria 2346
510 Ga0496106_0026052 3300048909 Bacteria 4352
511 Ga0496106_0059056 3300048909 Bacteria 2904
512 Ga0496106_0116924 3300048909 Bacteria 2080
513 Ga0496106_0371268 3300048909 Bacteria 1149
514 Ga0496107_0014895 3300048910 Bacteria 5444
515 Ga0496107_0035960 3300048910 Bacteria 3552
516 Ga0496107_0075993 3300048910 Bacteria 2445
517 Ga0496107_0088283 3300048910 Bacteria 2264
518 Ga0496107_0122100 3300048910 Bacteria 1919
519 Ga0496107_0201435 3300048910 Bacteria 1480
520 Ga0496108_0022912 3300048911 Bacteria 5138
521 Ga0496108_0032223 3300048911 Bacteria 4352
522 Ga0496108_0047774 3300048911 Bacteria 3578
523 Ga0496108_0062796 3300048911 Bacteria 3128
524 Ga0496108_0131694 3300048911 Bacteria 2149
525 Ga0496108_0170563 3300048911 Bacteria 1882
526 Ga0496108_0427450 3300048911 Bacteria 1157
527 Ga0496109_0026244 3300048912 Bacteria 5195
528 Ga0496109_0249718 3300048912 Bacteria 1670
529 Ga0496110_0006401 3300048913 Bacteria 9318
530 Ga0496110_0029996 3300048913 Bacteria 4685
531 Ga0496110_0033405 3300048913 Bacteria 4450
532 Ga0496110_0055576 3300048913 Bacteria 3484
533 Ga0496111_0003479 3300048914 Bacteria 9744
534 Ga0496111_0107869 3300048914 Bacteria 2050
535 Ga0496111_0203483 3300048914 Bacteria 1471
536 Ga0496111_0288985 3300048914 Bacteria 1216
537 Ga0496112_0049354 3300048915 Bacteria 4125
538 Ga0496112_0090000 3300048915 Bacteria 3037
539 Ga0496112_0105607 3300048915 Bacteria 2786
540 Ga0496112_0107440 3300048915 Bacteria 2760
541 Ga0496112_0233514 3300048915 Bacteria 1793
542 Ga0496113_0027470 3300048916 Bacteria 4080
543 Ga0496113_0051361 3300048916 Bacteria 3076
544 Ga0496113_0079235 3300048916 Bacteria 2514
545 Ga0496114_0010585 3300048917 Bacteria 7338
546 Ga0496114_0101681 3300048917 Bacteria 2454
547 Ga0496114_0136921 3300048917 Bacteria 2118
548 Ga0496114_0155104 3300048917 Bacteria 1988
549 Ga0496115_0004755 3300048918 Bacteria 9854
550 Ga0496115_0075128 3300048918 Bacteria 2744
551 Ga0496115_0152539 3300048918 Bacteria 1908
552 Ga0496115_0159097 3300048918 Bacteria 1866
553 Ga0496115_0183439 3300048918 Bacteria 1729
554 Ga0496115_0195671 3300048918 Bacteria 1670
555 Ga0496115_0293307 3300048918 Bacteria 1334
556 Ga0496121_0055870 3300048924 Bacteria 3285
557 Ga0496122_0060055 3300048925 Bacteria 2803
558 Ga0496124_0005153 3300048927 Bacteria 14866
559 Ga0496124_0069930 3300048927 Bacteria 2913
560 Ga0496125_0002334 3300048928 Bacteria 24947
561 Ga0496125_0112012 3300048928 Bacteria 1973
562 Ga0496126_0055653 3300048929 Bacteria 3578
563 Ga0495678_033720 3300049459 Bacteria 2112
564 Ga0501335_000262 3300049551 Bacteria 3037
565 Ga0501032_0003702 3300049569 Bacteria 11605
566 Ga0501033_0000190 3300049570 Bacteria 58924
567 Ga0501034_0000033 3300049571 Bacteria 243508
568 Ga0501034_0006611 3300049571 Bacteria 12439
569 Ga0501034_0122826 3300049571 Bacteria 2583
570 Ga0501034_0271730 3300049571 Bacteria 1636
571 Ga0501034_0491337 3300049571 Bacteria 1142
572 Ga0501034_0500058 3300049571 Bacteria 1129
573 Ga0501036_0470232 3300049572 Bacteria 1047
574 Ga0501037_0001858 3300049573 Bacteria 15327
575 Ga0501037_0315763 3300049573 Bacteria 1083
576 Ga0501038_0009455 3300049574 Bacteria 8946
577 Ga0501039_0012230 3300049575 Bacteria 6542
578 Ga0501043_0170364 3300049579 Bacteria 1699
579 Ga0501046_0004757 3300049580 Bacteria 12248
580 Ga0501046_0390689 3300049580 Bacteria 1006
581 Ga0501047_0000135 3300049581 Bacteria 89402
582 Ga0501047_0437425 3300049581 Bacteria 1138
583 Ga0501048_0093387 3300049582 Bacteria 2122
584 Ga0501067_0000493 3300049583 Bacteria 21609
585 Ga0501067_0003030 3300049583 Bacteria 9280
586 Ga0501067_0009400 3300049583 Bacteria 5417
587 Ga0501069_0059598 3300049585 Bacteria 2130
588 Ga0501069_0079143 3300049585 Bacteria 1850
589 Ga0501069_0133073 3300049585 Bacteria 1424
590 Ga0501070_0023007 3300049586 Bacteria 5217
591 Ga0501070_0076273 3300049586 Bacteria 2775
592 Ga0501070_0085041 3300049586 Bacteria 2619
593 Ga0501070_0128809 3300049586 Bacteria 2091
594 Ga0501070_0291900 3300049586 Bacteria 1329
595 Ga0501073_0009481 3300049589 Bacteria 7188
596 Ga0501073_0072928 3300049589 Bacteria 2391
597 Ga0501073_0081910 3300049589 Bacteria 2245
598 Ga0501073_0187090 3300049589 Bacteria 1433
599 Ga0501073_0187512 3300049589 Bacteria 1431
600 Ga0501074_0032212 3300049590 Bacteria 3798
601 Ga0501074_0106440 3300049590 Bacteria 2008
602 Ga0501074_0128742 3300049590 Bacteria 1811
603 Ga0501076_0057962 3300049592 Bacteria 3077
604 Ga0501076_0097772 3300049592 Bacteria 2365
605 Ga0501198_017496 3300049649 Bacteria 1116
606 Ga0501223_001437 3300049663 Bacteria 5497
607 Ga0501223_032088 3300049663 Bacteria 1022
608 Ga0501235_001074 3300049669 Bacteria 5697
609 Ga0501246_002189 3300049676 Bacteria 1539
610 Ga0501249_000383 3300049679 Bacteria 11577
611 Ga0501225_0000036 3300049705 Bacteria 46300
612 Ga0501225_0002246 3300049705 Bacteria 5974
613 Ga0501225_0016000 3300049705 Bacteria 2085
614 Ga0501245_002332 3300049708 Bacteria 2529
615 Ga0501079_0293130 3300049741 Bacteria 1272
616 Ga0501080_0000002 3300049742 Bacteria 218492
617 Ga0501080_0018946 3300049742 Bacteria 6375
618 Ga0501080_0099017 3300049742 Bacteria 2705
619 Ga0501080_0104845 3300049742 Bacteria 2622
620 Ga0501080_0105330 3300049742 Bacteria 2615
621 Ga0501083_0006206 3300049744 Bacteria 8476
622 Ga0501083_0041091 3300049744 Bacteria 3137
623 Ga0501083_0259803 3300049744 Bacteria 1130
624 Ga0501264_006153 3300049761 Bacteria 1104
625 Ga0501035_0000117 3300049822 Bacteria 96642
626 Ga0501035_0001475 3300049822 Bacteria 24081
627 Ga0501035_0004729 3300049822 Bacteria 12925
628 Ga0501035_0184400 3300049822 Bacteria 1797
629 Ga0501044_0000019 3300049823 Bacteria 223724
630 Ga0501044_0034971 3300049823 Bacteria 5264
631 Ga0501044_0044381 3300049823 Bacteria 4613
632 Ga0501044_0099486 3300049823 Bacteria 2927
633 Ga0501045_0021745 3300049824 Bacteria 4592
634 nmdc:mga0k408_134665_c2 3300050493 Bacteria 1166
635 nmdc:mga06z11_124217_c1 3300050494 Bacteria 1443
636 nmdc:mga04h51_64539_c1 3300050495 Bacteria 1263
637 nmdc:mga05p37_105730_c1 3300050507 Bacteria 3462
638 nmdc:mga05p37_16673_c1 3300050507 Bacteria 8852
639 nmdc:mga05p37_320917_c1 3300050507 Bacteria 1833
640 nmdc:mga09592_215797_c1 3300050508 Bacteria 1662
641 nmdc:mga09592_6297_c1 3300050508 Bacteria 9667
642 nmdc:mga0qj67_251155_c1 3300050509 Bacteria 1435
643 nmdc:mga0qj67_304120_c1 3300050509 Bacteria 1292
644 nmdc:mga0qj67_6078_c1 3300050509 Bacteria 8847
645 nmdc:mga06r32_165458_c1 3300050510 Bacteria 2194
646 nmdc:mga06r32_19050_c1 3300050510 Bacteria 6293
647 nmdc:mga06r32_549264_c1 3300050510 Bacteria 1129
648 nmdc:mga08y16_47498_c1 3300050511 Bacteria 4493
649 nmdc:mga08y16_5758_c1 3300050511 Bacteria 12971
650 nmdc:mga08y16_612862_c1 3300050511 Bacteria 1096
651 nmdc:mga0n895_188922_c1 3300050512 Bacteria 2091
652 nmdc:mga0n895_35286_c1 3300050512 Bacteria 4820
653 nmdc:mga0n895_421147_c1 3300050512 Bacteria 1350
654 nmdc:mga0rr50_2490_c1 3300050513 Bacteria 10405
655 nmdc:mga0rr50_539893_c1 3300050513 Bacteria 993
656 nmdc:mga08x19_21112_c1 3300050514 Bacteria 4016
657 nmdc:mga08x19_49663_c1 3300050514 Bacteria 2691
658 nmdc:mga0a205_112_c1 3300050515 Bacteria 47837
659 nmdc:mga0sz30_197175_c1 3300050516 Bacteria 894
660 Ga0495601_0000007 3300053077 Bacteria 365972
661 Ga0495601_0001707 3300053077 Bacteria 12125
662 Ga0495601_0003610 3300053077 Bacteria 8897
663 Ga0495601_0008011 3300053077 Bacteria 6225
664 Ga0495601_0018690 3300053077 Bacteria 4219
665 Ga0495601_0115499 3300053077 Bacteria 1740
666 Ga0495601_0478852 3300053077 Bacteria 804
667 Ga0495612_0000053 3300053078 Bacteria 52880
668 Ga0495612_0001049 3300053078 Bacteria 11311
669 Ga0495612_0004559 3300053078 Bacteria 5750
670 Ga0495612_0006064 3300053078 Bacteria 4979
671 Ga0495595_0000031 3300053084 Bacteria 89199
672 Ga0495595_0000615 3300053084 Bacteria 13573
673 Ga0495595_0017679 3300053084 Bacteria 3070
674 Ga0495595_0040125 3300053084 Bacteria 2138
675 Ga0495595_0141347 3300053084 Bacteria 1181
676 Ga0495619_0000023 3300053085 Bacteria 182266
677 Ga0495619_0000364 3300053085 Bacteria 31371
678 Ga0495619_0000433 3300053085 Bacteria 28425
679 Ga0495619_0004775 3300053085 Bacteria 8618
680 Ga0495619_0029641 3300053085 Bacteria 3536
681 Ga0495619_0053193 3300053085 Bacteria 2677
682 Ga0500643_014759 3300053087 Bacteria 2701
683 Ga0500643_016797 3300053087 Bacteria 2469
684 Ga0500643_094058 3300053087 Bacteria 816
685 Ga0500644_0002244 3300053088 Bacteria 4876
686 Ga0500641_0002805 3300053096 Bacteria 6173
687 Ga0500641_0016584 3300053096 Bacteria 2744
688 Ga0500556_0000167 3300053104 Bacteria 53886
689 Ga0500562_004450 3300053108 Bacteria 3546
690 Ga0500595_000002 3300053119 Bacteria 1074388
691 Ga0500621_064193 3300053126 Bacteria 1484
692 Ga0500652_000493 3300053131 Bacteria 13857
693 Ga0500652_120253 3300053131 Bacteria 1098
694 Ga0500658_0169566 3300053134 Bacteria 991
695 Ga0500559_0002459 3300053136 Bacteria 9585
696 Ga0500559_0010930 3300053136 Bacteria 3889
697 Ga0500622_0000748 3300053156 Bacteria 28318
698 Ga0500601_003608 3300053737 Unclassified 1679
699 Ga0501084_0043365 3300054114 Bacteria 3763
700 Ga0501084_0126557 3300054114 Bacteria 2150
701 Ga0501084_0141924 3300054114 Bacteria 2023
702 Ga0501084_0278982 3300054114 Bacteria 1411
703 Ga0501082_0007340 3300060353 Bacteria 9513
704 Ga0501082_0071033 3300060353 Bacteria 2998
705 Ga0501082_0179626 3300060353 Bacteria 1840
706 Ga0501082_0193753 3300060353 Bacteria 1768
707 Ga0501082_0273708 3300060353 Bacteria 1470

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046809 Ga0495600_0173686 Ga0495600_0173686_696_1379 214
2 3300048903 Ga0496100_0220870 Ga0496100_0220870_70_753 214
3 3300048904 Ga0496101_0124197 Ga0496101_0124197_52_735 214
4 3300048914 Ga0496111_0203483 Ga0496111_0203483_724_1407 214
5 3300025942 Ga0207689_10487060 Ga0207689_104870602 215
6 3300031239 Ga0265328_10000087 Ga0265328_1000008745 230
7 3300031242 Ga0265329_10008674 Ga0265329_100086746 230
8 3300031250 Ga0265331_10000585 Ga0265331_100005856 230
9 3300031344 Ga0265316_10000423 Ga0265316_1000042345 230
10 3300048910 Ga0496107_0075993 Ga0496107_0075993_371_1108 233
11 3300005535 Ga0070684_100080641 Ga0070684_1000806413 234
12 3300009545 Ga0105237_10094800 Ga0105237_100948002 234
13 3300009551 Ga0105238_10160394 Ga0105238_101603942 234
14 3300025914 Ga0207671_10380559 Ga0207671_103805592 234
15 3300025924 Ga0207694_10236776 Ga0207694_102367761 234
16 3300013307 Ga0157372_10323707 Ga0157372_103237072 235
17 3300049676 Ga0501246_002189 Ga0501246_002189_468_1184 238
18 3300009101 Ga0105247_10040503 Ga0105247_100405033 240
19 3300035115 Ga0373941_0160623 Ga0373941_0160623_33_794 240
20 3300048903 Ga0496100_0004090 Ga0496100_0004090_3757_4518 240
21 3300048904 Ga0496101_0015051 Ga0496101_0015051_1548_2309 240
22 3300048905 Ga0496102_0063973 Ga0496102_0063973_631_1392 240
23 3300048905 Ga0496102_0086665 Ga0496102_0086665_705_1466 240
24 3300048906 Ga0496103_0026239 Ga0496103_0026239_715_1476 240
25 3300048907 Ga0496104_0077477 Ga0496104_0077477_1205_1966 240
26 3300048907 Ga0496104_0346853 Ga0496104_0346853_12_773 240
27 3300048908 Ga0496105_0103905 Ga0496105_0103905_954_1715 240
28 3300048909 Ga0496106_0059056 Ga0496106_0059056_1251_2012 240
29 3300048910 Ga0496107_0014895 Ga0496107_0014895_1676_2437 240
30 3300048910 Ga0496107_0122100 Ga0496107_0122100_11_772 240
31 3300048910 Ga0496107_0201435 Ga0496107_0201435_19_780 240
32 3300048911 Ga0496108_0022912 Ga0496108_0022912_12_773 240
33 3300048911 Ga0496108_0170563 Ga0496108_0170563_519_1280 240
34 3300048912 Ga0496109_0249718 Ga0496109_0249718_890_1651 240
35 3300048913 Ga0496110_0029996 Ga0496110_0029996_2095_2856 240
36 3300048914 Ga0496111_0107869 Ga0496111_0107869_1251_2012 240
37 3300048915 Ga0496112_0049354 Ga0496112_0049354_2733_3494 240
38 3300048915 Ga0496112_0233514 Ga0496112_0233514_694_1455 240
39 3300048916 Ga0496113_0051361 Ga0496113_0051361_1977_2738 240
40 3300048917 Ga0496114_0010585 Ga0496114_0010585_5624_6385 240
41 3300048918 Ga0496115_0195671 Ga0496115_0195671_890_1651 240
42 3300048918 Ga0496115_0293307 Ga0496115_0293307_554_1315 240
43 3300049572 Ga0501036_0470232 Ga0501036_0470232_240_1022 240
44 3300053077 Ga0495601_0478852 Ga0495601_0478852_15_776 240
45 3300046459 Ga0495629_0042163 Ga0495629_0042163_201_1007 241
46 3300053737 Ga0500601_003608 Ga0500601_003608_437_1201 242
47 3300053104 Ga0500556_0000167 Ga0500556_0000167_50077_50874 245
48 3300005577 Ga0068857_100109762 Ga0068857_1001097622 246
49 3300026116 Ga0207674_10157185 Ga0207674_101571853 246
50 3300035241 Ga0373961_0030359 Ga0373961_0030359_310_1068 246
51 3300045051 Ga0451576_0140632 Ga0451576_0140632_600_1406 246
52 3300049586 Ga0501070_0085041 Ga0501070_0085041_1518_2276 246
53 3300006847 Ga0075431_100100179 Ga0075431_1001001792 248
54 3300049823 Ga0501044_0044381 Ga0501044_0044381_118_927 248
55 iso_pu_bacteria 2891088606 2891089941 248
56 iso_pu_bacteria 8002060224 8002061859 248
57 3300037068 Ga0373925_0449614 Ga0373925_0449614_173_946 249
58 3300005458 Ga0070681_10019210 Ga0070681_100192106 250
59 3300005530 Ga0070679_100014161 Ga0070679_1000141615 250
60 3300013104 Ga0157370_10283515 Ga0157370_102835152 250
61 3300025912 Ga0207707_10008102 Ga0207707_100081022 250
62 3300025921 Ga0207652_10029320 Ga0207652_100293201 250
63 3300025981 Ga0207640_10283622 Ga0207640_102836221 250
64 3300044694 Ga0466963_0095765 Ga0466963_0095765_387_1157 250
65 3300048904 Ga0496101_0503107 Ga0496101_0503107_94_882 250
66 3300048905 Ga0496102_0260264 Ga0496102_0260264_55_843 250
67 3300048909 Ga0496106_0026052 Ga0496106_0026052_1099_1887 250
68 3300048910 Ga0496107_0088283 Ga0496107_0088283_272_1060 250
69 3300048911 Ga0496108_0047774 Ga0496108_0047774_827_1615 250
70 3300048913 Ga0496110_0055576 Ga0496110_0055576_2547_3335 250
71 3300048915 Ga0496112_0107440 Ga0496112_0107440_1415_2203 250
72 3300048917 Ga0496114_0155104 Ga0496114_0155104_206_994 250
73 3300048918 Ga0496115_0004755 Ga0496115_0004755_5008_5796 250
74 3300049586 Ga0501070_0128809 Ga0501070_0128809_271_1062 250
75 iso_pu_bacteria 2599185156 2599331334 250
76 iso_pu_bacteria 2842922631 2842928178 250
77 iso_pu_bacteria 2889306138 2889312265 250
78 iso_pu_bacteria 2902330777 2902336001 250
79 iso_pu_bacteria 2902405164 2902407300 250
80 3300039447 Ga0436361_0418519 Ga0436361_0418519_224_1015 251
81 iso_pu_bacteria 2545555834 2545678883 251
82 iso_pu_bacteria 3003665799 3003668437 251
83 iso_pu_bacteria 641522639 641646556 251
84 iso_pu_bacteria 643348564 643604474 251
85 3300005295 Ga0065707_10232668 Ga0065707_102326682 252
86 3300005327 Ga0070658_10074784 Ga0070658_100747842 252
87 3300005327 Ga0070658_10207048 Ga0070658_102070481 252
88 3300005336 Ga0070680_100010440 Ga0070680_1000104408 252
89 3300005339 Ga0070660_100133662 Ga0070660_1001336623 252
90 3300005458 Ga0070681_10355447 Ga0070681_103554471 252
91 3300005530 Ga0070679_100071061 Ga0070679_1000710612 252
92 3300005530 Ga0070679_100090176 Ga0070679_1000901763 252
93 3300005530 Ga0070679_100272100 Ga0070679_1002721002 252
94 3300005563 Ga0068855_100040468 Ga0068855_1000404682 252
95 3300005563 Ga0068855_100053478 Ga0068855_1000534784 252
96 3300005614 Ga0068856_100365364 Ga0068856_1003653642 252
97 3300006195 Ga0075366_10145078 Ga0075366_101450782 252
98 3300006844 Ga0075428_100208507 Ga0075428_1002085072 252
99 3300006846 Ga0075430_100266169 Ga0075430_1002661692 252
100 3300006846 Ga0075430_100362983 Ga0075430_1003629832 252
101 3300006847 Ga0075431_100388789 Ga0075431_1003887891 252
102 3300006852 Ga0075433_10026584 Ga0075433_100265844 252
103 3300006880 Ga0075429_100275512 Ga0075429_1002755122 252
104 3300009093 Ga0105240_10024091 Ga0105240_100240918 252
105 3300009147 Ga0114129_10125652 Ga0114129_101256524 252
106 3300013306 Ga0163162_10539032 Ga0163162_105390322 252
107 3300025909 Ga0207705_10076088 Ga0207705_100760882 252
108 3300025909 Ga0207705_10126975 Ga0207705_101269753 252
109 3300025913 Ga0207695_10051868 Ga0207695_100518682 252
110 3300025917 Ga0207660_10073511 Ga0207660_100735112 252
111 3300025917 Ga0207660_10285680 Ga0207660_102856801 252
112 3300025917 Ga0207660_10436646 Ga0207660_104366462 252
113 3300025921 Ga0207652_10160213 Ga0207652_101602132 252
114 3300025921 Ga0207652_10275026 Ga0207652_102750262 252
115 3300025924 Ga0207694_10105985 Ga0207694_101059853 252
116 3300025941 Ga0207711_10502391 Ga0207711_105023912 252
117 3300025944 Ga0207661_10286278 Ga0207661_102862782 252
118 3300025949 Ga0207667_10197621 Ga0207667_101976212 252
119 3300025949 Ga0207667_10640506 Ga0207667_106405061 252
120 3300028794 Ga0307515_10001215 Ga0307515_1000121563 252
121 3300028800 Ga0265338_10022980 Ga0265338_100229803 252
122 3300028800 Ga0265338_10169730 Ga0265338_101697302 252
123 3300031235 Ga0265330_10030052 Ga0265330_100300522 252
124 3300031239 Ga0265328_10060414 Ga0265328_100604143 252
125 3300031249 Ga0265339_10013815 Ga0265339_100138155 252
126 3300031250 Ga0265331_10000007 Ga0265331_10000007204 252
127 3300031595 Ga0265313_10000115 Ga0265313_1000011523 252
128 3300031712 Ga0265342_10000763 Ga0265342_100007633 252
129 3300035118 Ga0373954_0068508 Ga0373954_0068508_66_863 252
130 3300035119 Ga0373956_0004635 Ga0373956_0004635_2433_3230 252
131 3300035172 Ga0373955_0011098 Ga0373955_0011098_1253_2050 252
132 3300035410 Ga0373924_0006213 Ga0373924_0006213_673_1470 252
133 3300035724 Ga0373933_0028451 Ga0373933_0028451_1185_1982 252
134 3300037312 Ga0395899_0002072 Ga0395899_0002072_4801_5598 252
135 3300037418 Ga0395900_0001691 Ga0395900_0001691_9179_9976 252
136 3300037418 Ga0395900_0002324 Ga0395900_0002324_16570_17367 252
137 3300037466 Ga0395898_0004548 Ga0395898_0004548_13824_14621 252
138 3300037466 Ga0395898_0009208 Ga0395898_0009208_2284_3081 252
139 3300037466 Ga0395898_0042046 Ga0395898_0042046_1224_2021 252
140 3300037466 Ga0395898_0164347 Ga0395898_0164347_403_1200 252
141 3300037471 Ga0395905_0001088 Ga0395905_0001088_15402_16211 252
142 3300037471 Ga0395905_0027361 Ga0395905_0027361_3228_4037 252
143 3300037471 Ga0395905_0038658 Ga0395905_0038658_3637_4446 252
144 3300037853 Ga0436364_1065930 Ga0436364_1065930_176_970 252
145 3300038443 Ga0395901_0080700 Ga0395901_0080700_1103_1900 252
146 3300038443 Ga0395901_0083715 Ga0395901_0083715_130_927 252
147 3300038443 Ga0395901_0123735 Ga0395901_0123735_745_1542 252
148 3300039437 Ga0436365_1523457 Ga0436365_1523457_22_816 252
149 3300039437 Ga0436365_1884774 Ga0436365_1884774_1129_1923 252
150 3300044684 Ga0466966_0092610 Ga0466966_0092610_68_865 252
151 3300044694 Ga0466963_0016707 Ga0466963_0016707_2802_3599 252
152 3300044842 Ga0466957_0387863 Ga0466957_0387863_117_914 252
153 3300045049 Ga0466959_0117710 Ga0466959_0117710_1072_1869 252
154 3300045976 Ga0466967_0269413 Ga0466967_0269413_440_1237 252
155 3300045976 Ga0466967_0293779 Ga0466967_0293779_390_1160 252
156 3300045976 Ga0466967_0344499 Ga0466967_0344499_430_1227 252
157 3300046559 Ga0495667_0057829 Ga0495667_0057829_811_1608 252
158 3300047322 Ga0495680_0064110 Ga0495680_0064110_1963_2760 252
159 3300047444 Ga0495675_0268368 Ga0495675_0268368_134_931 252
160 3300048911 Ga0496108_0062796 Ga0496108_0062796_848_1642 252
161 3300048913 Ga0496110_0006401 Ga0496110_0006401_2962_3756 252
162 3300048914 Ga0496111_0003479 Ga0496111_0003479_6121_6915 252
163 3300048915 Ga0496112_0105607 Ga0496112_0105607_1420_2214 252
164 3300048917 Ga0496114_0136921 Ga0496114_0136921_397_1194 252
165 3300049585 Ga0501069_0059598 Ga0501069_0059598_1276_2073 252
166 3300049585 Ga0501069_0133073 Ga0501069_0133073_558_1355 252
167 3300049586 Ga0501070_0076273 Ga0501070_0076273_1848_2645 252
168 3300049589 Ga0501073_0081910 Ga0501073_0081910_716_1513 252
169 3300049590 Ga0501074_0128742 Ga0501074_0128742_206_1003 252
170 3300049592 Ga0501076_0097772 Ga0501076_0097772_283_1080 252
171 3300049741 Ga0501079_0293130 Ga0501079_0293130_328_1125 252
172 3300049742 Ga0501080_0018946 Ga0501080_0018946_2587_3384 252
173 3300049742 Ga0501080_0104845 Ga0501080_0104845_1031_1828 252
174 3300049744 Ga0501083_0259803 Ga0501083_0259803_265_1062 252
175 3300049822 Ga0501035_0004729 Ga0501035_0004729_6887_7684 252
176 3300049823 Ga0501044_0034971 Ga0501044_0034971_234_1031 252
177 3300049823 Ga0501044_0099486 Ga0501044_0099486_1422_2219 252
178 3300050507 nmdc:mga05p37_105730_c1 nmdc:mga05p37_105730_c1_2451_3245 252
179 3300050508 nmdc:mga09592_215797_c1 nmdc:mga09592_215797_c1_173_967 252
180 3300050509 nmdc:mga0qj67_251155_c1 nmdc:mga0qj67_251155_c1_79_873 252
181 3300050509 nmdc:mga0qj67_304120_c1 nmdc:mga0qj67_304120_c1_165_962 252
182 3300050510 nmdc:mga06r32_549264_c1 nmdc:mga06r32_549264_c1_69_866 252
183 3300050511 nmdc:mga08y16_47498_c1 nmdc:mga08y16_47498_c1_2114_2908 252
184 3300050511 nmdc:mga08y16_612862_c1 nmdc:mga08y16_612862_c1_99_896 252
185 3300053077 Ga0495601_0018690 Ga0495601_0018690_1224_2021 252
186 3300053084 Ga0495595_0040125 Ga0495595_0040125_587_1384 252
187 3300053085 Ga0495619_0004775 Ga0495619_0004775_2876_3673 252
188 3300053087 Ga0500643_014759 Ga0500643_014759_1632_2429 252
189 3300053088 Ga0500644_0002244 Ga0500644_0002244_1197_2006 252
190 3300053096 Ga0500641_0002805 Ga0500641_0002805_4173_4985 252
191 3300053096 Ga0500641_0016584 Ga0500641_0016584_1579_2376 252
192 3300053119 Ga0500595_000002 Ga0500595_000002_100146_100943 252
193 3300053126 Ga0500621_064193 Ga0500621_064193_583_1425 252
194 3300053131 Ga0500652_000493 Ga0500652_000493_4618_5400 252
195 3300053136 Ga0500559_0002459 Ga0500559_0002459_16_825 252
196 3300053156 Ga0500622_0000748 Ga0500622_0000748_9790_10599 252
197 iso_pu_bacteria 2671180139 2671695185 252
198 iso_pu_bacteria 2828305725 2828309691 252
199 iso_pu_bacteria 2919679072 2919679981 252
200 3300005329 Ga0070683_100372946 Ga0070683_1003729462 253
201 3300005335 Ga0070666_10012760 Ga0070666_100127602 253
202 3300005337 Ga0070682_100012105 Ga0070682_1000121054 253
203 3300005337 Ga0070682_100058723 Ga0070682_1000587232 253
204 3300005338 Ga0068868_100016541 Ga0068868_1000165414 253
205 3300005339 Ga0070660_100217926 Ga0070660_1002179262 253
206 3300005340 Ga0070689_100123406 Ga0070689_1001234061 253
207 3300005355 Ga0070671_100424108 Ga0070671_1004241081 253
208 3300005356 Ga0070674_100256515 Ga0070674_1002565152 253
209 3300005364 Ga0070673_100538415 Ga0070673_1005384151 253
210 3300005366 Ga0070659_100008759 Ga0070659_1000087596 253
211 3300005366 Ga0070659_100343138 Ga0070659_1003431382 253
212 3300005366 Ga0070659_100446356 Ga0070659_1004463562 253
213 3300005367 Ga0070667_100036594 Ga0070667_1000365945 253
214 3300005367 Ga0070667_100046824 Ga0070667_1000468241 253
215 3300005435 Ga0070714_100111798 Ga0070714_1001117981 253
216 3300005436 Ga0070713_100001334 Ga0070713_10000133410 253
217 3300005436 Ga0070713_100010460 Ga0070713_1000104606 253
218 3300005436 Ga0070713_100022406 Ga0070713_1000224064 253
219 3300005436 Ga0070713_100546771 Ga0070713_1005467712 253
220 3300005437 Ga0070710_10034315 Ga0070710_100343152 253
221 3300005437 Ga0070710_10060442 Ga0070710_100604422 253
222 3300005437 Ga0070710_10198065 Ga0070710_101980651 253
223 3300005440 Ga0070705_100111701 Ga0070705_1001117012 253
224 3300005444 Ga0070694_100201447 Ga0070694_1002014472 253
225 3300005455 Ga0070663_100033099 Ga0070663_1000330994 253
226 3300005455 Ga0070663_100140935 Ga0070663_1001409352 253
227 3300005456 Ga0070678_100283137 Ga0070678_1002831372 253
228 3300005457 Ga0070662_100342898 Ga0070662_1003428982 253
229 3300005458 Ga0070681_10014737 Ga0070681_100147372 253
230 3300005468 Ga0070707_100545999 Ga0070707_1005459991 253
231 3300005530 Ga0070679_100072922 Ga0070679_1000729223 253
232 3300005535 Ga0070684_100085934 Ga0070684_1000859344 253
233 3300005539 Ga0068853_100012299 Ga0068853_1000122993 253
234 3300005545 Ga0070695_100113809 Ga0070695_1001138093 253
235 3300005545 Ga0070695_100120402 Ga0070695_1001204022 253
236 3300005546 Ga0070696_100074129 Ga0070696_1000741292 253
237 3300005547 Ga0070693_100080219 Ga0070693_1000802192 253
238 3300005548 Ga0070665_100263611 Ga0070665_1002636112 253
239 3300005564 Ga0070664_100350466 Ga0070664_1003504662 253
240 3300005615 Ga0070702_100008860 Ga0070702_1000088602 253
241 3300005615 Ga0070702_100281733 Ga0070702_1002817331 253
242 3300005618 Ga0068864_100577944 Ga0068864_1005779441 253
243 3300005718 Ga0068866_10006292 Ga0068866_100062925 253
244 3300005842 Ga0068858_100075971 Ga0068858_1000759713 253
245 3300005842 Ga0068858_100082519 Ga0068858_1000825194 253
246 3300005843 Ga0068860_100252508 Ga0068860_1002525082 253
247 3300005937 Ga0081455_10006367 Ga0081455_100063675 253
248 3300006028 Ga0070717_10010099 Ga0070717_100100996 253
249 3300006028 Ga0070717_10144372 Ga0070717_101443721 253
250 3300006028 Ga0070717_10149331 Ga0070717_101493313 253
251 3300006058 Ga0075432_10005920 Ga0075432_100059205 253
252 3300006163 Ga0070715_10016048 Ga0070715_100160484 253
253 3300006175 Ga0070712_100011837 Ga0070712_1000118372 253
254 3300006178 Ga0075367_10101239 Ga0075367_101012392 253
255 3300006237 Ga0097621_100078050 Ga0097621_1000780503 253
256 3300006358 Ga0068871_100134061 Ga0068871_1001340612 253
257 3300006358 Ga0068871_100275488 Ga0068871_1002754882 253
258 3300006844 Ga0075428_100040128 Ga0075428_1000401286 253
259 3300006846 Ga0075430_100008514 Ga0075430_1000085141 253
260 3300006847 Ga0075431_100003469 Ga0075431_10000346912 253
261 3300006847 Ga0075431_100054811 Ga0075431_1000548114 253
262 3300006852 Ga0075433_10000381 Ga0075433_1000038113 253
263 3300006852 Ga0075433_10439198 Ga0075433_104391982 253
264 3300006871 Ga0075434_100003667 Ga0075434_10000366714 253
265 3300006871 Ga0075434_100414545 Ga0075434_1004145452 253
266 3300006880 Ga0075429_100002836 Ga0075429_10000283610 253
267 3300006914 Ga0075436_100028198 Ga0075436_1000281982 253
268 3300007076 Ga0075435_100106840 Ga0075435_1001068402 253
269 3300009094 Ga0111539_10003115 Ga0111539_1000311511 253
270 3300009098 Ga0105245_10047623 Ga0105245_100476232 253
271 3300009098 Ga0105245_10098913 Ga0105245_100989132 253
272 3300009101 Ga0105247_10236596 Ga0105247_102365962 253
273 3300009147 Ga0114129_10018648 Ga0114129_100186484 253
274 3300009148 Ga0105243_10009745 Ga0105243_100097453 253
275 3300009148 Ga0105243_10050314 Ga0105243_100503143 253
276 3300009148 Ga0105243_10779916 Ga0105243_107799161 253
277 3300009174 Ga0105241_10142191 Ga0105241_101421912 253
278 3300009545 Ga0105237_10022531 Ga0105237_100225316 253
279 3300010375 Ga0105239_10155328 Ga0105239_101553282 253
280 3300011119 Ga0105246_10047511 Ga0105246_100475112 253
281 3300011119 Ga0105246_10094682 Ga0105246_100946821 253
282 3300011119 Ga0105246_10270913 Ga0105246_102709132 253
283 3300012477 Ga0157336_1005365 Ga0157336_10053651 253
284 3300012512 Ga0157327_1001340 Ga0157327_10013401 253
285 3300013102 Ga0157371_10066651 Ga0157371_100666513 253
286 3300013296 Ga0157374_10056485 Ga0157374_100564852 253
287 3300013296 Ga0157374_10207808 Ga0157374_102078082 253
288 3300013297 Ga0157378_10157005 Ga0157378_101570053 253
289 3300013297 Ga0157378_10237158 Ga0157378_102371582 253
290 3300013306 Ga0163162_10507502 Ga0163162_105075022 253
291 3300013308 Ga0157375_10062711 Ga0157375_100627114 253
292 3300013308 Ga0157375_10111621 Ga0157375_101116212 253
293 3300013308 Ga0157375_10211693 Ga0157375_102116932 253
294 3300014968 Ga0157379_10092458 Ga0157379_100924583 253
295 3300014968 Ga0157379_10408390 Ga0157379_104083902 253
296 3300014969 Ga0157376_10143604 Ga0157376_101436042 253
297 3300021377 Ga0213874_10049336 Ga0213874_100493361 253
298 3300025898 Ga0207692_10017186 Ga0207692_100171864 253
299 3300025898 Ga0207692_10079013 Ga0207692_100790132 253
300 3300025898 Ga0207692_10091747 Ga0207692_100917472 253
301 3300025900 Ga0207710_10006645 Ga0207710_100066451 253
302 3300025900 Ga0207710_10069449 Ga0207710_100694492 253
303 3300025903 Ga0207680_10003367 Ga0207680_100033672 253
304 3300025904 Ga0207647_10046405 Ga0207647_100464052 253
305 3300025905 Ga0207685_10003024 Ga0207685_100030244 253
306 3300025906 Ga0207699_10002350 Ga0207699_100023505 253
307 3300025907 Ga0207645_10049701 Ga0207645_100497012 253
308 3300025907 Ga0207645_10218904 Ga0207645_102189042 253
309 3300025911 Ga0207654_10012053 Ga0207654_100120534 253
310 3300025911 Ga0207654_10213604 Ga0207654_102136042 253
311 3300025912 Ga0207707_10168105 Ga0207707_101681052 253
312 3300025912 Ga0207707_10196483 Ga0207707_101964832 253
313 3300025914 Ga0207671_10058380 Ga0207671_100583801 253
314 3300025915 Ga0207693_10012596 Ga0207693_100125967 253
315 3300025916 Ga0207663_10031210 Ga0207663_100312102 253
316 3300025916 Ga0207663_10099009 Ga0207663_100990092 253
317 3300025919 Ga0207657_10114435 Ga0207657_101144353 253
318 3300025919 Ga0207657_10205037 Ga0207657_102050372 253
319 3300025921 Ga0207652_10060507 Ga0207652_100605072 253
320 3300025924 Ga0207694_10226115 Ga0207694_102261152 253
321 3300025926 Ga0207659_10247545 Ga0207659_102475452 253
322 3300025928 Ga0207700_10001704 Ga0207700_100017047 253
323 3300025928 Ga0207700_10080569 Ga0207700_100805692 253
324 3300025929 Ga0207664_10003652 Ga0207664_100036523 253
325 3300025931 Ga0207644_10292448 Ga0207644_102924481 253
326 3300025932 Ga0207690_10011868 Ga0207690_100118685 253
327 3300025932 Ga0207690_10136120 Ga0207690_101361202 253
328 3300025933 Ga0207706_10013231 Ga0207706_100132311 253
329 3300025934 Ga0207686_10126220 Ga0207686_101262202 253
330 3300025936 Ga0207670_10024593 Ga0207670_100245933 253
331 3300025937 Ga0207669_10145742 Ga0207669_101457422 253
332 3300025938 Ga0207704_10277794 Ga0207704_102777942 253
333 3300025939 Ga0207665_10001096 Ga0207665_100010962 253
334 3300025939 Ga0207665_10079067 Ga0207665_100790673 253
335 3300025941 Ga0207711_10049726 Ga0207711_100497262 253
336 3300025944 Ga0207661_10040178 Ga0207661_100401782 253
337 3300025945 Ga0207679_10010041 Ga0207679_100100416 253
338 3300025945 Ga0207679_10124061 Ga0207679_101240612 253
339 3300025972 Ga0207668_10085410 Ga0207668_100854102 253
340 3300025972 Ga0207668_10237479 Ga0207668_102374792 253
341 3300025981 Ga0207640_10151336 Ga0207640_101513362 253
342 3300026023 Ga0207677_10016714 Ga0207677_100167141 253
343 3300026041 Ga0207639_10006047 Ga0207639_100060474 253
344 3300026067 Ga0207678_10002916 Ga0207678_100029167 253
345 3300026067 Ga0207678_10012097 Ga0207678_100120974 253
346 3300026067 Ga0207678_10061279 Ga0207678_100612791 253
347 3300026075 Ga0207708_10043682 Ga0207708_100436822 253
348 3300026078 Ga0207702_10282914 Ga0207702_102829141 253
349 3300026095 Ga0207676_10012407 Ga0207676_100124072 253
350 3300026121 Ga0207683_10011732 Ga0207683_100117324 253
351 3300026121 Ga0207683_10019514 Ga0207683_100195146 253
352 3300027907 Ga0207428_10000776 Ga0207428_1000077624 253
353 3300028379 Ga0268266_10016436 Ga0268266_100164366 253
354 3300028556 Ga0265337_1018756 Ga0265337_10187562 253
355 3300031239 Ga0265328_10019206 Ga0265328_100192062 253
356 3300031239 Ga0265328_10020256 Ga0265328_100202561 253
357 3300031241 Ga0265325_10000006 Ga0265325_10000006227 253
358 3300031241 Ga0265325_10030103 Ga0265325_100301032 253
359 3300031249 Ga0265339_10029619 Ga0265339_100296193 253
360 3300031249 Ga0265339_10167686 Ga0265339_101676861 253
361 3300031665 Ga0316575_10090114 Ga0316575_100901142 253
362 3300031727 Ga0316576_10005920 Ga0316576_100059206 253
363 3300031727 Ga0316576_10084976 Ga0316576_100849762 253
364 3300032133 Ga0316583_10000647 Ga0316583_100006474 253
365 3300035083 Ga0373926_0010240 Ga0373926_0010240_1852_2652 253
366 3300035090 Ga0373949_0009779 Ga0373949_0009779_871_1671 253
367 3300035092 Ga0373952_0021629 Ga0373952_0021629_131_931 253
368 3300035111 Ga0373923_0149719 Ga0373923_0149719_18_818 253
369 3300035112 Ga0373932_0075721 Ga0373932_0075721_52_852 253
370 3300035114 Ga0373939_0021458 Ga0373939_0021458_366_1166 253
371 3300035115 Ga0373941_0006526 Ga0373941_0006526_289_1089 253
372 3300035116 Ga0373945_0077005 Ga0373945_0077005_424_1224 253
373 3300035119 Ga0373956_0056408 Ga0373956_0056408_163_963 253
374 3300035121 Ga0373960_0051821 Ga0373960_0051821_348_1148 253
375 3300035171 Ga0373946_0006988 Ga0373946_0006988_1032_1832 253
376 3300035171 Ga0373946_0077086 Ga0373946_0077086_558_1358 253
377 3300035172 Ga0373955_0001327 Ga0373955_0001327_5126_5926 253
378 3300035241 Ga0373961_0017473 Ga0373961_0017473_1000_1800 253
379 3300035242 Ga0373962_0040675 Ga0373962_0040675_191_991 253
380 3300035398 Ga0316574_0000075 Ga0316574_0000075_18096_18893 253
381 3300035410 Ga0373924_0006015 Ga0373924_0006015_2200_3000 253
382 3300035691 Ga0373931_0049261 Ga0373931_0049261_192_992 253
383 3300035691 Ga0373931_0050069 Ga0373931_0050069_218_1018 253
384 3300035692 Ga0373935_0061327 Ga0373935_0061327_67_867 253
385 3300035692 Ga0373935_0070231 Ga0373935_0070231_84_896 253
386 3300035695 Ga0373927_0001008 Ga0373927_0001008_15341_16153 253
387 3300035695 Ga0373927_0010512 Ga0373927_0010512_4608_5408 253
388 3300035724 Ga0373933_0010010 Ga0373933_0010010_2524_3324 253
389 3300035725 Ga0373947_0022516 Ga0373947_0022516_730_1530 253
390 3300036401 Ga0373937_0009181 Ga0373937_0009181_5033_5833 253
391 3300036401 Ga0373937_0037169 Ga0373937_0037169_968_1768 253
392 3300036712 Ga0316584_0087795 Ga0316584_0087795_1341_2138 253
393 3300037068 Ga0373925_0005243 Ga0373925_0005243_7796_8596 253
394 3300039450 Ga0436363_1287891 Ga0436363_1287891_2578_3375 253
395 3300045049 Ga0466959_0053100 Ga0466959_0053100_1403_2200 253
396 3300046454 Ga0495592_0030192 Ga0495592_0030192_2650_3450 253
397 3300046455 Ga0495603_0040512 Ga0495603_0040512_596_1396 253
398 3300046455 Ga0495603_0072991 Ga0495603_0072991_1007_1807 253
399 3300046459 Ga0495629_0003499 Ga0495629_0003499_1272_2072 253
400 3300046459 Ga0495629_0021025 Ga0495629_0021025_1032_1832 253
401 3300046461 Ga0495641_0037402 Ga0495641_0037402_840_1640 253
402 3300046461 Ga0495641_0110901 Ga0495641_0110901_349_1149 253
403 3300046462 Ga0495651_0009161 Ga0495651_0009161_1435_2235 253
404 3300046463 Ga0495653_0004086 Ga0495653_0004086_1212_2012 253
405 3300046473 Ga0495582_0006763 Ga0495582_0006763_1148_1948 253
406 3300046473 Ga0495582_0327595 Ga0495582_0327595_48_848 253
407 3300046475 Ga0495639_0053255 Ga0495639_0053255_646_1446 253
408 3300046475 Ga0495639_0191680 Ga0495639_0191680_115_915 253
409 3300046477 Ga0495664_0022796 Ga0495664_0022796_764_1564 253
410 3300046499 Ga0495594_0006237 Ga0495594_0006237_76_876 253
411 3300046499 Ga0495594_0195505 Ga0495594_0195505_30_830 253
412 3300046511 Ga0495608_0000688 Ga0495608_0000688_14125_14925 253
413 3300046514 Ga0495618_0002700 Ga0495618_0002700_6971_7771 253
414 3300046517 Ga0495630_0017622 Ga0495630_0017622_1035_1835 253
415 3300046520 Ga0495637_0062181 Ga0495637_0062181_89_889 253
416 3300046526 Ga0495666_0181014 Ga0495666_0181014_107_907 253
417 3300046529 Ga0495652_0029734 Ga0495652_0029734_1028_1828 253
418 3300046531 Ga0495665_0113904 Ga0495665_0113904_206_1006 253
419 3300046533 Ga0495640_0026478 Ga0495640_0026478_735_1535 253
420 3300046533 Ga0495640_0252999 Ga0495640_0252999_229_1029 253
421 3300046535 Ga0495586_0006914 Ga0495586_0006914_3294_4094 253
422 3300046536 Ga0495587_0000534 Ga0495587_0000534_16978_17778 253
423 3300046543 Ga0495645_0001860 Ga0495645_0001860_4655_5455 253
424 3300046559 Ga0495667_0000771 Ga0495667_0000771_10901_11701 253
425 3300046559 Ga0495667_0135712 Ga0495667_0135712_282_1082 253
426 3300046663 Ga0495635_0003284 Ga0495635_0003284_6343_7143 253
427 3300046675 Ga0495657_0001333 Ga0495657_0001333_10912_11712 253
428 3300046678 Ga0495599_0012706 Ga0495599_0012706_2522_3322 253
429 3300046679 Ga0495623_0000354 Ga0495623_0000354_16980_17780 253
430 3300046680 Ga0495646_0002006 Ga0495646_0002006_2650_3450 253
431 3300046683 Ga0495658_0000934 Ga0495658_0000934_11614_12414 253
432 3300046689 Ga0495613_0002083 Ga0495613_0002083_5062_5862 253
433 3300046809 Ga0495600_0001299 Ga0495600_0001299_4138_4938 253
434 3300047315 Ga0495581_0064573 Ga0495581_0064573_25_825 253
435 3300047317 Ga0495604_0003048 Ga0495604_0003048_10591_11391 253
436 3300047317 Ga0495604_0234372 Ga0495604_0234372_166_966 253
437 3300047319 Ga0495674_0003671 Ga0495674_0003671_2750_3550 253
438 3300047319 Ga0495674_0140046 Ga0495674_0140046_974_1774 253
439 3300047321 Ga0495676_0392842 Ga0495676_0392842_64_864 253
440 3300047322 Ga0495680_0006916 Ga0495680_0006916_1487_2287 253
441 3300047322 Ga0495680_0041419 Ga0495680_0041419_2286_3086 253
442 3300047322 Ga0495680_0046009 Ga0495680_0046009_784_1584 253
443 3300047444 Ga0495675_0000892 Ga0495675_0000892_12678_13478 253
444 3300047471 Ga0495684_0072844 Ga0495684_0072844_1187_1987 253
445 3300048088 Ga0495602_0004679 Ga0495602_0004679_5011_5811 253
446 3300048905 Ga0496102_0013897 Ga0496102_0013897_1739_2539 253
447 3300048905 Ga0496102_0063990 Ga0496102_0063990_2455_3255 253
448 3300048906 Ga0496103_0080962 Ga0496103_0080962_876_1676 253
449 3300048907 Ga0496104_0000087 Ga0496104_0000087_57051_57851 253
450 3300048907 Ga0496104_0122154 Ga0496104_0122154_803_1603 253
451 3300048907 Ga0496104_0181740 Ga0496104_0181740_92_892 253
452 3300048908 Ga0496105_0012221 Ga0496105_0012221_3040_3840 253
453 3300048908 Ga0496105_0016627 Ga0496105_0016627_1643_2443 253
454 3300048909 Ga0496106_0116924 Ga0496106_0116924_116_916 253
455 3300048909 Ga0496106_0371268 Ga0496106_0371268_229_1029 253
456 3300048910 Ga0496107_0035960 Ga0496107_0035960_793_1593 253
457 3300048911 Ga0496108_0032223 Ga0496108_0032223_2052_2852 253
458 3300048911 Ga0496108_0131694 Ga0496108_0131694_475_1275 253
459 3300048911 Ga0496108_0427450 Ga0496108_0427450_220_1020 253
460 3300048915 Ga0496112_0090000 Ga0496112_0090000_58_858 253
461 3300048916 Ga0496113_0027470 Ga0496113_0027470_969_1769 253
462 3300048917 Ga0496114_0101681 Ga0496114_0101681_1291_2091 253
463 3300048918 Ga0496115_0075128 Ga0496115_0075128_1361_2161 253
464 3300048918 Ga0496115_0152539 Ga0496115_0152539_170_970 253
465 3300048918 Ga0496115_0159097 Ga0496115_0159097_357_1157 253
466 3300048918 Ga0496115_0183439 Ga0496115_0183439_102_902 253
467 3300049569 Ga0501032_0003702 Ga0501032_0003702_7538_8335 253
468 3300049571 Ga0501034_0000033 Ga0501034_0000033_130084_130881 253
469 3300049571 Ga0501034_0122826 Ga0501034_0122826_1662_2468 253
470 3300049571 Ga0501034_0271730 Ga0501034_0271730_768_1574 253
471 3300049573 Ga0501037_0001858 Ga0501037_0001858_615_1412 253
472 3300049574 Ga0501038_0009455 Ga0501038_0009455_2506_3303 253
473 3300049575 Ga0501039_0012230 Ga0501039_0012230_2964_3761 253
474 3300049579 Ga0501043_0170364 Ga0501043_0170364_526_1323 253
475 3300049580 Ga0501046_0004757 Ga0501046_0004757_10341_11138 253
476 3300049581 Ga0501047_0000135 Ga0501047_0000135_81148_81945 253
477 3300049582 Ga0501048_0093387 Ga0501048_0093387_364_1161 253
478 3300049583 Ga0501067_0000493 Ga0501067_0000493_4030_4836 253
479 3300049583 Ga0501067_0003030 Ga0501067_0003030_907_1704 253
480 3300049583 Ga0501067_0009400 Ga0501067_0009400_2776_3582 253
481 3300049585 Ga0501069_0079143 Ga0501069_0079143_922_1728 253
482 3300049586 Ga0501070_0023007 Ga0501070_0023007_3318_4115 253
483 3300049589 Ga0501073_0009481 Ga0501073_0009481_5192_5989 253
484 3300049589 Ga0501073_0072928 Ga0501073_0072928_1180_1986 253
485 3300049590 Ga0501074_0032212 Ga0501074_0032212_562_1368 253
486 3300049590 Ga0501074_0106440 Ga0501074_0106440_604_1410 253
487 3300049592 Ga0501076_0057962 Ga0501076_0057962_305_1111 253
488 3300049742 Ga0501080_0000002 Ga0501080_0000002_180838_181635 253
489 3300049742 Ga0501080_0099017 Ga0501080_0099017_1405_2211 253
490 3300049742 Ga0501080_0105330 Ga0501080_0105330_1049_1846 253
491 3300049744 Ga0501083_0006206 Ga0501083_0006206_3503_4309 253
492 3300049744 Ga0501083_0041091 Ga0501083_0041091_1514_2320 253
493 3300049822 Ga0501035_0000117 Ga0501035_0000117_74139_74936 253
494 3300049822 Ga0501035_0184400 Ga0501035_0184400_806_1612 253
495 3300049823 Ga0501044_0000019 Ga0501044_0000019_130079_130876 253
496 3300049824 Ga0501045_0021745 Ga0501045_0021745_3571_4368 253
497 3300050494 nmdc:mga06z11_124217_c1 nmdc:mga06z11_124217_c1_174_971 253
498 3300050507 nmdc:mga05p37_16673_c1 nmdc:mga05p37_16673_c1_291_1091 253
499 3300050508 nmdc:mga09592_6297_c1 nmdc:mga09592_6297_c1_2735_3535 253
500 3300050509 nmdc:mga0qj67_6078_c1 nmdc:mga0qj67_6078_c1_291_1091 253
501 3300050510 nmdc:mga06r32_165458_c1 nmdc:mga06r32_165458_c1_249_1046 253
502 3300050510 nmdc:mga06r32_19050_c1 nmdc:mga06r32_19050_c1_5238_6038 253
503 3300050511 nmdc:mga08y16_5758_c1 nmdc:mga08y16_5758_c1_4747_5547 253
504 3300050512 nmdc:mga0n895_421147_c1 nmdc:mga0n895_421147_c1_341_1168 253
505 3300050513 nmdc:mga0rr50_2490_c1 nmdc:mga0rr50_2490_c1_1116_1916 253
506 3300050513 nmdc:mga0rr50_539893_c1 nmdc:mga0rr50_539893_c1_20_820 253
507 3300050514 nmdc:mga08x19_49663_c1 nmdc:mga08x19_49663_c1_469_1269 253
508 3300050515 nmdc:mga0a205_112_c1 nmdc:mga0a205_112_c1_20783_21583 253
509 3300053077 Ga0495601_0001707 Ga0495601_0001707_607_1407 253
510 3300053077 Ga0495601_0003610 Ga0495601_0003610_2678_3478 253
511 3300053077 Ga0495601_0008011 Ga0495601_0008011_2670_3470 253
512 3300053078 Ga0495612_0001049 Ga0495612_0001049_9129_9929 253
513 3300053078 Ga0495612_0004559 Ga0495612_0004559_4097_4897 253
514 3300053078 Ga0495612_0006064 Ga0495612_0006064_4029_4829 253
515 3300053084 Ga0495595_0000615 Ga0495595_0000615_4580_5380 253
516 3300053084 Ga0495595_0017679 Ga0495595_0017679_57_857 253
517 3300053084 Ga0495595_0141347 Ga0495595_0141347_26_826 253
518 3300053085 Ga0495619_0000364 Ga0495619_0000364_22190_22990 253
519 3300053085 Ga0495619_0000433 Ga0495619_0000433_14106_14906 253
520 3300053085 Ga0495619_0029641 Ga0495619_0029641_2455_3255 253
521 3300053085 Ga0495619_0053193 Ga0495619_0053193_1795_2595 253
522 3300053087 Ga0500643_016797 Ga0500643_016797_895_1710 253
523 3300054114 Ga0501084_0043365 Ga0501084_0043365_2281_3087 253
524 3300054114 Ga0501084_0126557 Ga0501084_0126557_372_1178 253
525 3300054114 Ga0501084_0141924 Ga0501084_0141924_1179_1985 253
526 3300060353 Ga0501082_0007340 Ga0501082_0007340_3241_4038 253
527 3300060353 Ga0501082_0071033 Ga0501082_0071033_1045_1851 253
528 3300060353 Ga0501082_0179626 Ga0501082_0179626_661_1467 253
529 3300003659 JGI25404J52841_10012620 JGI25404J52841_100126202 254
530 3300005367 Ga0070667_100203743 Ga0070667_1002037431 254
531 3300005539 Ga0068853_100340757 Ga0068853_1003407572 254
532 3300005719 Ga0068861_100159895 Ga0068861_1001598952 254
533 3300005842 Ga0068858_100066767 Ga0068858_1000667674 254
534 3300005983 Ga0081540_1000092 Ga0081540_100009221 254
535 3300006042 Ga0075368_10113374 Ga0075368_101133741 254
536 3300006048 Ga0075363_100035266 Ga0075363_1000352663 254
537 3300006237 Ga0097621_100111963 Ga0097621_1001119632 254
538 3300006353 Ga0075370_10292180 Ga0075370_102921802 254
539 3300006358 Ga0068871_100122289 Ga0068871_1001222893 254
540 3300009098 Ga0105245_10051168 Ga0105245_100511683 254
541 3300009147 Ga0114129_10687566 Ga0114129_106875662 254
542 3300009176 Ga0105242_10045782 Ga0105242_100457826 254
543 3300009551 Ga0105238_10244566 Ga0105238_102445662 254
544 3300011119 Ga0105246_10216768 Ga0105246_102167682 254
545 3300025927 Ga0207687_10005912 Ga0207687_100059127 254
546 3300025986 Ga0207658_10123273 Ga0207658_101232732 254
547 3300026035 Ga0207703_10066839 Ga0207703_100668392 254
548 3300026116 Ga0207674_10044393 Ga0207674_100443934 254
549 3300026118 Ga0207675_100367329 Ga0207675_1003673292 254
550 3300027866 Ga0209813_10012654 Ga0209813_100126543 254
551 3300031241 Ga0265325_10051855 Ga0265325_100518553 254
552 3300031456 Ga0307513_10163272 Ga0307513_101632723 254
553 3300031730 Ga0307516_10067237 Ga0307516_100672372 254
554 3300046511 Ga0495608_0071797 Ga0495608_0071797_668_1474 254
555 3300049571 Ga0501034_0500058 Ga0501034_0500058_56_865 254
556 3300049586 Ga0501070_0291900 Ga0501070_0291900_494_1303 254
557 3300049589 Ga0501073_0187090 Ga0501073_0187090_559_1368 254
558 3300049649 Ga0501198_017496 Ga0501198_017496_204_968 254
559 3300049663 Ga0501223_032088 Ga0501223_032088_28_792 254
560 3300049679 Ga0501249_000383 Ga0501249_000383_3747_4511 254
561 3300050493 nmdc:mga0k408_134665_c2 nmdc:mga0k408_134665_c2_310_1110 254
562 3300050495 nmdc:mga04h51_64539_c1 nmdc:mga04h51_64539_c1_31_834 254
563 3300053087 Ga0500643_094058 Ga0500643_094058_19_783 254
564 3300053131 Ga0500652_120253 Ga0500652_120253_158_958 254
565 3300054114 Ga0501084_0278982 Ga0501084_0278982_177_986 254
566 iso_pu_bacteria 2917554339 2917555384 254
567 3300006914 Ga0075436_100002343 Ga0075436_1000023433 255
568 3300031235 Ga0265330_10046342 Ga0265330_100463423 255
569 3300031239 Ga0265328_10034280 Ga0265328_100342802 255
570 3300031249 Ga0265339_10032332 Ga0265339_100323323 255
571 3300031595 Ga0265313_10001555 Ga0265313_100015553 255
572 3300031712 Ga0265342_10013987 Ga0265342_100139872 255
573 3300035170 Ga0373943_0108900 Ga0373943_0108900_322_1128 255
574 3300035410 Ga0373924_0117042 Ga0373924_0117042_214_1026 255
575 3300039437 Ga0436365_1213299 Ga0436365_1213299_1459_2262 255
576 3300046476 Ga0495662_0079961 Ga0495662_0079961_227_1033 255
577 3300046642 Ga0495634_0089886 Ga0495634_0089886_969_1775 255
578 3300046689 Ga0495613_0354371 Ga0495613_0354371_149_955 255
579 3300047317 Ga0495604_0168888 Ga0495604_0168888_497_1303 255
580 3300047472 Ga0495686_0032905 Ga0495686_0032905_1757_2524 255
581 3300049571 Ga0501034_0491337 Ga0501034_0491337_44_889 255
582 3300049573 Ga0501037_0315763 Ga0501037_0315763_220_1050 255
583 3300049581 Ga0501047_0437425 Ga0501047_0437425_14_859 255
584 3300049589 Ga0501073_0187512 Ga0501073_0187512_390_1235 255
585 3300050514 nmdc:mga08x19_21112_c1 nmdc:mga08x19_21112_c1_2284_3084 255
586 3300053077 Ga0495601_0115499 Ga0495601_0115499_404_1210 255
587 3300053136 Ga0500559_0010930 Ga0500559_0010930_2201_2968 255
588 3300005336 Ga0070680_100344497 Ga0070680_1003444972 256
589 3300005530 Ga0070679_100220086 Ga0070679_1002200862 256
590 3300025917 Ga0207660_10167178 Ga0207660_101671782 256
591 3300025921 Ga0207652_10053749 Ga0207652_100537492 256
592 3300025939 Ga0207665_10197896 Ga0207665_101978962 256
593 3300031239 Ga0265328_10000410 Ga0265328_1000041013 256
594 3300031456 Ga0307513_10048768 Ga0307513_100487686 256
595 3300031728 Ga0316578_10006902 Ga0316578_100069024 256
596 3300035111 Ga0373923_0011828 Ga0373923_0011828_1243_2046 256
597 3300035113 Ga0373936_0006091 Ga0373936_0006091_2946_3749 256
598 3300035116 Ga0373945_0005656 Ga0373945_0005656_1415_2218 256
599 3300035117 Ga0373953_0013803 Ga0373953_0013803_205_1008 256
600 3300035118 Ga0373954_0029504 Ga0373954_0029504_879_1694 256
601 3300035119 Ga0373956_0042918 Ga0373956_0042918_867_1670 256
602 3300035120 Ga0373957_0022515 Ga0373957_0022515_1228_2031 256
603 3300035171 Ga0373946_0007704 Ga0373946_0007704_1304_2107 256
604 3300035172 Ga0373955_0002179 Ga0373955_0002179_6257_7060 256
605 3300035398 Ga0316574_0000154 Ga0316574_0000154_1742_2554 256
606 3300035410 Ga0373924_0021735 Ga0373924_0021735_112_915 256
607 3300035692 Ga0373935_0000006 Ga0373935_0000006_31615_32418 256
608 3300035724 Ga0373933_0004844 Ga0373933_0004844_2400_3203 256
609 3300035725 Ga0373947_0004133 Ga0373947_0004133_7234_8037 256
610 3300036401 Ga0373937_0000124 Ga0373937_0000124_1464_2267 256
611 3300036401 Ga0373937_0144541 Ga0373937_0144541_1307_2122 256
612 3300036712 Ga0316584_0003492 Ga0316584_0003492_3089_3901 256
613 3300037068 Ga0373925_0000210 Ga0373925_0000210_43811_44614 256
614 3300046454 Ga0495592_0000020 Ga0495592_0000020_68141_68944 256
615 3300046459 Ga0495629_0006124 Ga0495629_0006124_5416_6219 256
616 3300046462 Ga0495651_0001410 Ga0495651_0001410_10875_11678 256
617 3300046463 Ga0495653_0000046 Ga0495653_0000046_71854_72657 256
618 3300046473 Ga0495582_0054771 Ga0495582_0054771_1168_1971 256
619 3300046476 Ga0495662_0000709 Ga0495662_0000709_3427_4230 256
620 3300046477 Ga0495664_0000017 Ga0495664_0000017_71795_72598 256
621 3300046511 Ga0495608_0000250 Ga0495608_0000250_31063_31866 256
622 3300046514 Ga0495618_0000059 Ga0495618_0000059_71776_72579 256
623 3300046516 Ga0495628_0000022 Ga0495628_0000022_44941_45744 256
624 3300046517 Ga0495630_0000758 Ga0495630_0000758_15874_16677 256
625 3300046529 Ga0495652_0000008 Ga0495652_0000008_297894_298697 256
626 3300046533 Ga0495640_0000029 Ga0495640_0000029_7116_7919 256
627 3300046536 Ga0495587_0000019 Ga0495587_0000019_89537_90340 256
628 3300046543 Ga0495645_0000006 Ga0495645_0000006_116683_117486 256
629 3300046559 Ga0495667_0000061 Ga0495667_0000061_22235_23038 256
630 3300046642 Ga0495634_0001468 Ga0495634_0001468_16956_17759 256
631 3300046663 Ga0495635_0000023 Ga0495635_0000023_89769_90572 256
632 3300046663 Ga0495635_0172828 Ga0495635_0172828_294_1109 256
633 3300046675 Ga0495657_0000099 Ga0495657_0000099_69901_70704 256
634 3300046678 Ga0495599_0000039 Ga0495599_0000039_7357_8160 256
635 3300046679 Ga0495623_0000253 Ga0495623_0000253_26311_27114 256
636 3300046680 Ga0495646_0000017 Ga0495646_0000017_30861_31664 256
637 3300046689 Ga0495613_0006412 Ga0495613_0006412_7099_7902 256
638 3300046689 Ga0495613_0123721 Ga0495613_0123721_990_1805 256
639 3300046690 Ga0495624_0021015 Ga0495624_0021015_797_1600 256
640 3300046809 Ga0495600_0000030 Ga0495600_0000030_17078_17881 256
641 3300047317 Ga0495604_0000030 Ga0495604_0000030_92726_93529 256
642 3300047319 Ga0495674_0000009 Ga0495674_0000009_264608_265411 256
643 3300047319 Ga0495674_0416644 Ga0495674_0416644_96_911 256
644 3300047322 Ga0495680_0000359 Ga0495680_0000359_7123_7926 256
645 3300047322 Ga0495680_0054186 Ga0495680_0054186_1005_1820 256
646 3300047444 Ga0495675_0000056 Ga0495675_0000056_23246_24049 256
647 3300047471 Ga0495684_0000056 Ga0495684_0000056_7145_7948 256
648 3300047673 Ga0495593_0003363 Ga0495593_0003363_2398_3201 256
649 3300048088 Ga0495602_0000006 Ga0495602_0000006_71745_72548 256
650 3300050512 nmdc:mga0n895_35286_c1 nmdc:mga0n895_35286_c1_3471_4274 256
651 3300053077 Ga0495601_0000007 Ga0495601_0000007_293510_294313 256
652 3300053078 Ga0495612_0000053 Ga0495612_0000053_44941_45744 256
653 3300053084 Ga0495595_0000031 Ga0495595_0000031_59426_60229 256
654 3300053085 Ga0495619_0000023 Ga0495619_0000023_93639_94442 256
655 iso_pu_bacteria 3003930520 3003933457 256
656 3300005435 Ga0070714_100026165 Ga0070714_1000261655 257
657 3300025230 Ga0209563_101940 Ga0209563_1019403 257
658 3300031239 Ga0265328_10014176 Ga0265328_100141765 257
659 3300031250 Ga0265331_10003778 Ga0265331_100037783 257
660 3300049570 Ga0501033_0000190 Ga0501033_0000190_42054_42884 257
661 3300049571 Ga0501034_0006611 Ga0501034_0006611_11336_12154 257
662 3300049580 Ga0501046_0390689 Ga0501046_0390689_131_943 257
663 3300049822 Ga0501035_0001475 Ga0501035_0001475_9205_10035 257
664 3300060353 Ga0501082_0193753 Ga0501082_0193753_645_1457 257
665 3300060353 Ga0501082_0273708 Ga0501082_0273708_257_1162 257
666 3300003775 Ga0055524_1009044 Ga0055524_10090443 258
667 3300005445 Ga0070708_100170066 Ga0070708_1001700663 258
668 3300006186 Ga0075369_10099478 Ga0075369_100994782 258
669 3300006871 Ga0075434_100139490 Ga0075434_1001394905 258
670 3300007076 Ga0075435_100124241 Ga0075435_1001242412 258
671 3300050512 nmdc:mga0n895_188922_c1 nmdc:mga0n895_188922_c1_1177_2019 258
672 3300050516 nmdc:mga0sz30_197175_c1 nmdc:mga0sz30_197175_c1_60_872 258
673 3300053134 Ga0500658_0169566 Ga0500658_0169566_147_965 258
674 iso_pu_bacteria 2919709256 2919713166 258
675 3300053108 Ga0500562_004450 Ga0500562_004450_141_920 259
676 3300005289 Ga0065704_10011146 Ga0065704_100111463 261
677 3300005295 Ga0065707_10086855 Ga0065707_100868551 261
678 3300005353 Ga0070669_100366078 Ga0070669_1003660782 261
679 3300009978 Ga0105148_100072 Ga0105148_10007211 261
680 3300014326 Ga0157380_10145983 Ga0157380_101459832 261
681 3300025923 Ga0207681_10184656 Ga0207681_101846562 261
682 3300025925 Ga0207650_10331237 Ga0207650_103312372 261
683 3300025931 Ga0207644_10052826 Ga0207644_100528262 261
684 3300048912 Ga0496109_0026244 Ga0496109_0026244_4109_4894 261
685 3300048916 Ga0496113_0079235 Ga0496113_0079235_1348_2133 261
686 3300048927 Ga0496124_0069930 Ga0496124_0069930_396_1181 261
687 3300049551 Ga0501335_000262 Ga0501335_000262_1053_1838 261
688 3300049663 Ga0501223_001437 Ga0501223_001437_4052_4837 261
689 3300049669 Ga0501235_001074 Ga0501235_001074_2183_2968 261
690 3300049705 Ga0501225_0000036 Ga0501225_0000036_20644_21429 261
691 3300049705 Ga0501225_0002246 Ga0501225_0002246_4997_5782 261
692 3300049705 Ga0501225_0016000 Ga0501225_0016000_299_1084 261
693 3300049708 Ga0501245_002332 Ga0501245_002332_1537_2322 261
694 3300049761 Ga0501264_006153 Ga0501264_006153_205_990 261
695 3300009147 Ga0114129_10270134 Ga0114129_102701343 262
696 3300046452 Ga0495617_024550 Ga0495617_024550_1080_1874 262
697 3300046453 Ga0495627_000132 Ga0495627_000132_27114_27905 262
698 3300046453 Ga0495627_004439 Ga0495627_004439_2817_3611 262
699 3300046491 Ga0495584_0059196 Ga0495584_0059196_776_1567 262
700 3300046512 Ga0495610_0000071 Ga0495610_0000071_873_1667 262
701 3300046512 Ga0495610_0109727 Ga0495610_0109727_189_980 262
702 3300046518 Ga0495631_0097145 Ga0495631_0097145_40_834 262
703 3300046520 Ga0495637_0003841 Ga0495637_0003841_5861_6655 262
704 3300046520 Ga0495637_0010181 Ga0495637_0010181_2557_3348 262
705 3300046522 Ga0495643_0000053 Ga0495643_0000053_74801_75592 262
706 3300046524 Ga0495648_0011071 Ga0495648_0011071_5638_6429 262
707 3300046524 Ga0495648_0028063 Ga0495648_0028063_2175_2966 262
708 3300046665 Ga0495661_0160755 Ga0495661_0160755_45_839 262
709 3300046692 Ga0495671_0000031 Ga0495671_0000031_126439_127230 262
710 3300047470 Ga0495681_0000228 Ga0495681_0000228_18735_19529 262
711 3300047470 Ga0495681_0013181 Ga0495681_0013181_2909_3700 262
712 3300047472 Ga0495686_0022395 Ga0495686_0022395_362_1156 262
713 3300047472 Ga0495686_0072533 Ga0495686_0072533_805_1596 262
714 3300048928 Ga0496125_0112012 Ga0496125_0112012_311_1102 262
715 3300049459 Ga0495678_033720 Ga0495678_033720_845_1639 262
716 3300050507 nmdc:mga05p37_320917_c1 nmdc:mga05p37_320917_c1_657_1448 262
717 2162886007 SwRhRL2b_contig_3148643 SwRhRL2b_0994.00006710 263
718 3300048913 Ga0496110_0033405 Ga0496110_0033405_57_848 263
719 3300048914 Ga0496111_0288985 Ga0496111_0288985_365_1156 263
720 3300048924 Ga0496121_0055870 Ga0496121_0055870_922_1713 263
721 3300048925 Ga0496122_0060055 Ga0496122_0060055_1974_2765 263
722 3300048927 Ga0496124_0005153 Ga0496124_0005153_3603_4394 263
723 3300048928 Ga0496125_0002334 Ga0496125_0002334_11361_12152 263
724 3300048929 Ga0496126_0055653 Ga0496126_0055653_1457_2248 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

53

238

0.89

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

40

172

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b9v-assembly1.cif.gz_A crystal structure of a new diphosphatase from the phnp family 0.9461 1 256
3qh8-assembly1.cif.gz_A crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data 0.944 2 256
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.9384 3 257
6b9v-assembly1.cif.gz_A crystal structure of a new diphosphatase from the phnp family 0.9208 1 256
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.9168 3 257
ID Description Score Start End Superfamily
3py6A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9447 2 256 3.60.15.10
3py6A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9131 2 256 3.60.15.10
af_C4J9M0_89_373_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9046 1 256 3.60.15.10
af_O74545_3_299_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9045 2 256 3.60.15.10
af_I1K3H5_2_307_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8891 3 257 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A520HQX3-F1-model_v4 MBL fold metallo-hydrolase 0.9987 5 121 GO:0016787
AF-A0A431JRA6-F1-model_v4 deleted 0.998 41 252
AF-A0A520IMV3-F1-model_v4 MBL fold metallo-hydrolase 0.9974 5 141 GO:0016787
AF-A0A2W5EPR2-F1-model_v4 deleted 0.9972 5 99
AF-A0A4Q3CD66-F1-model_v4 MBL fold metallo-hydrolase 0.9967 102 256 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.05 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map