F477601

General Info

Members Datasets Scaffolds Average Seq Length
725 313 1450 210

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100000670|Ga0070706_1000006703
Length 231
Sequence MGVRRGRFADVNSLLHALQPLFAVAFTVLGAPFTWLELVAFVLAVAMVVFNIRVNPLGWPLAIVSSLLYFALFWSSRLYGDASLQIFFAAVALWGWWQWLRGTQADGGALRVRTLGPRGRTLIVLVLAAAWPATGLFLKRYTDTDVPWWDAFPTAASVIGQWLLGRKYLENWVAWIVVNIVSVGLFAYKGLWLTVVLYTIFVAMSVVGWRAWRRLLGATSAAAAARAPHAA

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
100 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
164 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
165 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
166 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
192 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
193 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
194 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
195 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
196 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
197 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
198 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
199 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
202 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
203 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
204 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
205 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
221 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
222 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
223 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
242 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
243 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
247 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
248 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
249 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
261 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
282 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
283 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
284 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
285 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
286 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
287 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
288 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
289 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
290 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
291 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
292 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
293 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
294 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
295 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
296 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
297 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
298 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
299 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
300 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
301 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
302 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
303 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
304 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
305 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
306 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
307 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
308 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
309 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
310 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
311 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
312 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
313 2643221660 Methylibium sp. Root1272 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.38
Nodule 0.28
Rhizoplane 1.93
Rhizosphere 71.72
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100000670 3300005467 Bacteria 38829
2 JGI25152J39213_1001709 3300002773 Bacteria 9004
3 JGI25152J39213_1002886 3300002773 Bacteria 6145
4 JGI25153J46596_10029375 3300003215 Bacteria 1889
5 rootL2_10175725 3300003322 Bacteria 1210
6 rootH1_10012451 3300003323 Bacteria 2217
7 rootH1_10029292 3300003323 Bacteria 1640
8 Ga0055526_1004651 3300003771 Bacteria 8162
9 Ga0055530_10011329 3300003791 Bacteria 3210
10 Ga0055530_10013387 3300003791 Bacteria 2803
11 Ga0055540_1000002 3300003792 Bacteria 436954
12 Ga0055531_10004641 3300003794 Bacteria 8250
13 Ga0065165_1003311 3300005262 Bacteria 11548
14 Ga0070658_10839318 3300005327 Bacteria 798
15 Ga0070676_10009865 3300005328 Bacteria 5167
16 Ga0070676_10013248 3300005328 Bacteria 4517
17 Ga0070676_10014725 3300005328 Bacteria 4302
18 Ga0070676_10026643 3300005328 Bacteria 3273
19 Ga0070676_10109878 3300005328 Bacteria 1715
20 Ga0070676_10380063 3300005328 Bacteria 978
21 Ga0070683_100186750 3300005329 Bacteria 1968
22 Ga0070690_100123156 3300005330 Bacteria 1743
23 Ga0070670_100001820 3300005331 Bacteria 17371
24 Ga0070670_100016116 3300005331 Bacteria 6414
25 Ga0070670_100097990 3300005331 Bacteria 2522
26 Ga0070670_100101058 3300005331 Bacteria 2483
27 Ga0070670_100415891 3300005331 Bacteria 1188
28 Ga0070677_10001548 3300005333 Bacteria 7279
29 Ga0070677_10009375 3300005333 Bacteria 3317
30 Ga0070677_10027675 3300005333 Bacteria 2136
31 Ga0070677_10037333 3300005333 Bacteria 1895
32 Ga0068869_100004621 3300005334 Bacteria 8588
33 Ga0068869_100013561 3300005334 Bacteria 5424
34 Ga0068869_100027665 3300005334 Bacteria 3956
35 Ga0068869_100227886 3300005334 Bacteria 1480
36 Ga0070666_10041643 3300005335 Bacteria 3070
37 Ga0068868_100081103 3300005338 Bacteria 2600
38 Ga0068868_100097025 3300005338 Bacteria 2381
39 Ga0068868_100146793 3300005338 Bacteria 1940
40 Ga0068868_100334934 3300005338 Bacteria 1292
41 Ga0070689_100034512 3300005340 Bacteria 3860
42 Ga0070689_100175586 3300005340 Bacteria 1737
43 Ga0070689_100896337 3300005340 Bacteria 784
44 Ga0070687_100014736 3300005343 Bacteria 3519
45 Ga0070661_100290663 3300005344 Bacteria 1270
46 Ga0070661_100621432 3300005344 Bacteria 875
47 Ga0070668_100004953 3300005347 Bacteria 9859
48 Ga0070668_100009291 3300005347 Bacteria 7292
49 Ga0070668_100386909 3300005347 Bacteria 1191
50 Ga0070669_100006105 3300005353 Bacteria 8694
51 Ga0070669_100025041 3300005353 Bacteria 4283
52 Ga0070669_100066477 3300005353 Bacteria 2657
53 Ga0070669_100261286 3300005353 Bacteria 1382
54 Ga0070675_100001535 3300005354 Bacteria 17078
55 Ga0070675_100005184 3300005354 Bacteria 9937
56 Ga0070675_100028715 3300005354 Bacteria 4478
57 Ga0070675_101052871 3300005354 Bacteria 747
58 Ga0070671_100021133 3300005355 Bacteria 5314
59 Ga0070671_100040868 3300005355 Bacteria 3853
60 Ga0070671_100081753 3300005355 Bacteria 2701
61 Ga0070671_100357690 3300005355 Bacteria 1246
62 Ga0070671_100398329 3300005355 Bacteria 1177
63 Ga0070671_100674958 3300005355 Bacteria 895
64 Ga0070674_100008300 3300005356 Bacteria 6178
65 Ga0070674_100030634 3300005356 Bacteria 3558
66 Ga0070674_100069521 3300005356 Bacteria 2484
67 Ga0070674_100236318 3300005356 Bacteria 1428
68 Ga0070674_100263727 3300005356 Bacteria 1358
69 Ga0070673_100005136 3300005364 Bacteria 8348
70 Ga0070673_100008629 3300005364 Bacteria 6789
71 Ga0070673_100072711 3300005364 Bacteria 2766
72 Ga0070673_100234991 3300005364 Bacteria 1591
73 Ga0070673_100261577 3300005364 Bacteria 1512
74 Ga0070673_100305514 3300005364 Bacteria 1402
75 Ga0070673_100413928 3300005364 Bacteria 1207
76 Ga0070673_100762403 3300005364 Bacteria 891
77 Ga0070673_101090464 3300005364 Bacteria 746
78 Ga0070688_100068326 3300005365 Bacteria 2265
79 Ga0070667_100001171 3300005367 Bacteria 23847
80 Ga0070667_100003010 3300005367 Bacteria 14476
81 Ga0070667_100043049 3300005367 Bacteria 3789
82 Ga0070667_100089205 3300005367 Bacteria 2648
83 Ga0070667_100106214 3300005367 Bacteria 2430
84 Ga0070667_100419924 3300005367 Bacteria 1219
85 Ga0070667_100432808 3300005367 Bacteria 1200
86 Ga0070667_100990802 3300005367 Bacteria 784
87 Ga0070663_100029789 3300005455 Bacteria 3734
88 Ga0070663_100275335 3300005455 Bacteria 1339
89 Ga0070663_100415337 3300005455 Bacteria 1103
90 Ga0070678_100001334 3300005456 Bacteria 13117
91 Ga0070678_100009607 3300005456 Bacteria 5871
92 Ga0070678_100096522 3300005456 Bacteria 2280
93 Ga0070678_100477514 3300005456 Bacteria 1096
94 Ga0070678_100621406 3300005456 Bacteria 966
95 Ga0070678_100711885 3300005456 Bacteria 905
96 Ga0070678_100938836 3300005456 Bacteria 792
97 Ga0070662_100010471 3300005457 Bacteria 6087
98 Ga0070662_100032584 3300005457 Bacteria 3662
99 Ga0070662_100034601 3300005457 Bacteria 3563
100 Ga0070662_100813706 3300005457 Bacteria 794
101 Ga0068867_100002841 3300005459 Bacteria 12176
102 Ga0068867_100002971 3300005459 Bacteria 11946
103 Ga0068867_100032757 3300005459 Bacteria 3760
104 Ga0068867_100042848 3300005459 Bacteria 3312
105 Ga0068867_100052489 3300005459 Bacteria 3009
106 Ga0068867_100105376 3300005459 Bacteria 2159
107 Ga0068867_100139769 3300005459 Bacteria 1892
108 Ga0068867_100146767 3300005459 Bacteria 1849
109 Ga0070707_100557157 3300005468 Bacteria 1108
110 Ga0070699_100224034 3300005518 Bacteria 1676
111 Ga0070679_100194436 3300005530 Bacteria 1996
112 Ga0070672_100002062 3300005543 Bacteria 12665
113 Ga0070672_100003281 3300005543 Bacteria 10476
114 Ga0070672_100010713 3300005543 Bacteria 6369
115 Ga0070672_100023394 3300005543 Bacteria 4554
116 Ga0070672_100042983 3300005543 Bacteria 3481
117 Ga0070672_100048996 3300005543 Bacteria 3285
118 Ga0070672_100062465 3300005543 Bacteria 2939
119 Ga0070672_100140374 3300005543 Bacteria 1992
120 Ga0070672_100205866 3300005543 Bacteria 1647
121 Ga0070672_100272832 3300005543 Bacteria 1428
122 Ga0070672_100282596 3300005543 Bacteria 1403
123 Ga0070672_100388970 3300005543 Bacteria 1194
124 Ga0070686_100789242 3300005544 Bacteria 765
125 Ga0070693_100079779 3300005547 Bacteria 1948
126 Ga0070665_100191214 3300005548 Bacteria 2047
127 Ga0070665_100471710 3300005548 Bacteria 1266
128 Ga0070664_100104728 3300005564 Bacteria 2463
129 Ga0070664_100706313 3300005564 Bacteria 940
130 Ga0068857_100012825 3300005577 Bacteria 7303
131 Ga0068857_100025437 3300005577 Bacteria 5212
132 Ga0068854_100018059 3300005578 Bacteria 4728
133 Ga0068854_100030430 3300005578 Bacteria 3744
134 Ga0068854_100143833 3300005578 Bacteria 1833
135 Ga0068856_100059001 3300005614 Bacteria 3790
136 Ga0068852_100070012 3300005616 Bacteria 3076
137 Ga0068852_100164833 3300005616 Bacteria 2073
138 Ga0068852_100601482 3300005616 Bacteria 1104
139 Ga0068852_101136915 3300005616 Bacteria 801
140 Ga0068859_100002636 3300005617 Bacteria 18245
141 Ga0068859_100012962 3300005617 Bacteria 8376
142 Ga0068859_100078982 3300005617 Bacteria 3330
143 Ga0068864_100020879 3300005618 Bacteria 5482
144 Ga0068864_100045556 3300005618 Bacteria 3762
145 Ga0068864_100110843 3300005618 Bacteria 2444
146 Ga0068864_100201786 3300005618 Bacteria 1827
147 Ga0068864_100525333 3300005618 Bacteria 1141
148 Ga0068866_10007367 3300005718 Bacteria 4605
149 Ga0068866_10119073 3300005718 Bacteria 1485
150 Ga0068861_100040775 3300005719 Bacteria 3474
151 Ga0068861_100063998 3300005719 Bacteria 2828
152 Ga0068851_10104658 3300005834 Bacteria 1505
153 Ga0068851_10397291 3300005834 Bacteria 810
154 Ga0068870_10041700 3300005840 Bacteria 2386
155 Ga0068870_10042666 3300005840 Bacteria 2362
156 Ga0068863_100004608 3300005841 Bacteria 13579
157 Ga0068863_100131899 3300005841 Bacteria 2386
158 Ga0068863_100147201 3300005841 Bacteria 2253
159 Ga0068863_100292604 3300005841 Bacteria 1579
160 Ga0068863_100376200 3300005841 Bacteria 1386
161 Ga0068863_100486275 3300005841 Bacteria 1214
162 Ga0068863_100654072 3300005841 Bacteria 1042
163 Ga0068858_100001760 3300005842 Bacteria 22084
164 Ga0068858_100054908 3300005842 Bacteria 3683
165 Ga0068858_100104820 3300005842 Bacteria 2639
166 Ga0068860_100001433 3300005843 Bacteria 25834
167 Ga0068860_100299585 3300005843 Bacteria 1575
168 Ga0068860_100373451 3300005843 Bacteria 1407
169 Ga0068860_100536719 3300005843 Bacteria 1171
170 Ga0068862_100025669 3300005844 Bacteria 4948
171 Ga0068862_100036314 3300005844 Bacteria 4177
172 Ga0070717_10873321 3300006028 Bacteria 819
173 Ga0075365_10106212 3300006038 Bacteria 1926
174 Ga0075368_10024067 3300006042 Bacteria 2330
175 Ga0075368_10064592 3300006042 Bacteria 1470
176 Ga0075363_100044589 3300006048 Bacteria 2350
177 Ga0075363_100072670 3300006048 Bacteria 1871
178 Ga0075363_100084357 3300006048 Bacteria 1742
179 Ga0075363_100197021 3300006048 Bacteria 1150
180 Ga0075364_10050756 3300006051 Bacteria 2708
181 Ga0075362_10058661 3300006177 Bacteria 1736
182 Ga0075362_10127865 3300006177 Bacteria 1207
183 Ga0075362_10305949 3300006177 Bacteria 789
184 Ga0075367_10022479 3300006178 Bacteria 3537
185 Ga0075367_10029363 3300006178 Bacteria 3144
186 Ga0075367_10294385 3300006178 Bacteria 1021
187 Ga0075369_10010341 3300006186 Bacteria 3647
188 Ga0075366_10013799 3300006195 Bacteria 4606
189 Ga0075366_10023472 3300006195 Bacteria 3593
190 Ga0075366_10034429 3300006195 Bacteria 2983
191 Ga0075366_10042422 3300006195 Bacteria 2693
192 Ga0075366_10059108 3300006195 Bacteria 2277
193 Ga0075366_10189916 3300006195 Bacteria 1248
194 Ga0075366_10334354 3300006195 Bacteria 929
195 Ga0097621_100020890 3300006237 Bacteria 5051
196 Ga0097621_100067657 3300006237 Bacteria 2944
197 Ga0097621_100083076 3300006237 Bacteria 2668
198 Ga0097621_100325218 3300006237 Bacteria 1363
199 Ga0097621_100439860 3300006237 Bacteria 1173
200 Ga0097621_100894581 3300006237 Bacteria 827
201 Ga0075370_10001743 3300006353 Bacteria 9690
202 Ga0075370_10007921 3300006353 Bacteria 5439
203 Ga0075370_10011666 3300006353 Bacteria 4624
204 Ga0075370_10032948 3300006353 Bacteria 2899
205 Ga0075370_10038650 3300006353 Bacteria 2686
206 Ga0075370_10125572 3300006353 Bacteria 1495
207 Ga0075370_10152705 3300006353 Bacteria 1353
208 Ga0075370_10204779 3300006353 Bacteria 1164
209 Ga0068871_100005010 3300006358 Bacteria 9253
210 Ga0068871_100040812 3300006358 Bacteria 3718
211 Ga0068871_100137399 3300006358 Bacteria 2076
212 Ga0068871_100141677 3300006358 Bacteria 2045
213 Ga0068871_100195663 3300006358 Bacteria 1743
214 Ga0068865_100010127 3300006881 Bacteria 5862
215 Ga0068865_100036259 3300006881 Bacteria 3323
216 Ga0097620_100002636 3300006931 Bacteria 18245
217 Ga0097620_100012962 3300006931 Bacteria 8376
218 Ga0097620_100078978 3300006931 Bacteria 3330
219 Ga0079104_1000017 3300006946 Bacteria 313784
220 Ga0105245_10048773 3300009098 Bacteria 3789
221 Ga0105245_10122662 3300009098 Bacteria 2429
222 Ga0105245_10256066 3300009098 Bacteria 1702
223 Ga0105243_10049442 3300009148 Bacteria 3317
224 Ga0105243_10082533 3300009148 Bacteria 2627
225 Ga0105243_10187471 3300009148 Bacteria 1804
226 Ga0105243_10232044 3300009148 Bacteria 1638
227 Ga0105241_10953023 3300009174 Bacteria 800
228 Ga0105242_10014443 3300009176 Bacteria 6119
229 Ga0105242_10204457 3300009176 Bacteria 1756
230 Ga0105248_10138031 3300009177 Bacteria 2751
231 Ga0105248_10180017 3300009177 Bacteria 2382
232 Ga0105237_10003466 3300009545 Bacteria 18708
233 Ga0105237_10008395 3300009545 Bacteria 11193
234 Ga0105237_10157249 3300009545 Bacteria 2270
235 Ga0105238_10007665 3300009551 Bacteria 10803
236 Ga0105238_10824318 3300009551 Bacteria 944
237 Ga0105249_10009522 3300009553 Bacteria 8513
238 Ga0105249_10052686 3300009553 Bacteria 3717
239 Ga0105239_10003789 3300010375 Bacteria 18406
240 Ga0105239_10060249 3300010375 Bacteria 4166
241 Ga0157371_10031263 3300013102 Bacteria 3835
242 Ga0157369_10660417 3300013105 Bacteria 1078
243 Ga0157374_10121407 3300013296 Bacteria 2522
244 Ga0157374_10561120 3300013296 Bacteria 1150
245 Ga0157374_10641785 3300013296 Bacteria 1073
246 Ga0157378_10044989 3300013297 Bacteria 3921
247 Ga0157378_10078498 3300013297 Bacteria 2978
248 Ga0157378_10271274 3300013297 Bacteria 1632
249 Ga0163162_10028472 3300013306 Bacteria 5529
250 Ga0163162_10052435 3300013306 Bacteria 4097
251 Ga0163162_10060587 3300013306 Bacteria 3821
252 Ga0163162_10166173 3300013306 Bacteria 2330
253 Ga0163162_10194073 3300013306 Bacteria 2159
254 Ga0157375_10003544 3300013308 Bacteria 13558
255 Ga0157375_10031329 3300013308 Bacteria 5025
256 Ga0157375_10039345 3300013308 Bacteria 4551
257 Ga0157375_10056327 3300013308 Bacteria 3881
258 Ga0157375_10135933 3300013308 Bacteria 2582
259 Ga0157375_10237311 3300013308 Bacteria 1983
260 Ga0157375_11266767 3300013308 Bacteria 866
261 Ga0163163_10083873 3300014325 Bacteria 3192
262 Ga0163163_10179958 3300014325 Bacteria 2161
263 Ga0163163_10510020 3300014325 Bacteria 1265
264 Ga0157380_10102647 3300014326 Bacteria 2385
265 Ga0157380_10318490 3300014326 Bacteria 1441
266 Ga0157380_10556477 3300014326 Bacteria 1126
267 Ga0157377_10068176 3300014745 Bacteria 2050
268 Ga0157379_10013894 3300014968 Bacteria 7057
269 Ga0157379_10031728 3300014968 Bacteria 4707
270 Ga0157376_10051337 3300014969 Bacteria 3425
271 Ga0157376_10327596 3300014969 Bacteria 1458
272 Ga0157376_10361085 3300014969 Bacteria 1393
273 Ga0163161_10031938 3300017792 Bacteria 3755
274 Ga0163161_10049540 3300017792 Bacteria 3036
275 Ga0163161_10051865 3300017792 Bacteria 2973
276 Ga0213872_10042754 3300021361 Bacteria 2066
277 Ga0207425_1000131 3300025245 Bacteria 68511
278 Ga0209129_1000075 3300025258 Bacteria 201273
279 Ga0209673_1002275 3300025273 Bacteria 13761
280 Ga0209673_1051328 3300025273 Bacteria 1089
281 Ga0209675_1006935 3300025291 Bacteria 4444
282 Ga0209564_1000046 3300025295 Bacteria 373787
283 Ga0209758_1000045 3300025297 Bacteria 369174
284 Ga0209758_1000052 3300025297 Bacteria 338962
285 Ga0209050_1000247 3300025298 Bacteria 116514
286 Ga0209050_1000457 3300025298 Bacteria 73281
287 Ga0209050_1022563 3300025298 Bacteria 2251
288 Ga0209256_1000011 3300025299 Bacteria 865309
289 Ga0209256_1013851 3300025299 Bacteria 2959
290 Ga0209256_1064149 3300025299 Bacteria 846
291 Ga0209051_1000024 3300025303 Bacteria 437007
292 Ga0209051_1002674 3300025303 Bacteria 12469
293 Ga0209051_1018049 3300025303 Bacteria 3135
294 Ga0209257_1000079 3300025304 Bacteria 316420
295 Ga0209257_1030582 3300025304 Bacteria 1736
296 Ga0207697_10017238 3300025315 Bacteria 2969
297 Ga0207656_10111072 3300025321 Bacteria 1267
298 Ga0207656_10193028 3300025321 Bacteria 981
299 Ga0207682_10001523 3300025893 Bacteria 10677
300 Ga0207682_10027272 3300025893 Bacteria 2274
301 Ga0207682_10033070 3300025893 Bacteria 2080
302 Ga0207682_10049175 3300025893 Bacteria 1740
303 Ga0207682_10063659 3300025893 Bacteria 1549
304 Ga0207642_10018235 3300025899 Bacteria 2689
305 Ga0207642_10030161 3300025899 Bacteria 2256
306 Ga0207642_10051757 3300025899 Bacteria 1860
307 Ga0207642_10157072 3300025899 Bacteria 1217
308 Ga0207680_10110209 3300025903 Bacteria 1784
309 Ga0207680_10325724 3300025903 Bacteria 1075
310 Ga0207680_10394355 3300025903 Bacteria 977
311 Ga0207645_10003743 3300025907 Bacteria 11440
312 Ga0207645_10008686 3300025907 Bacteria 7073
313 Ga0207645_10012119 3300025907 Bacteria 5857
314 Ga0207643_10049838 3300025908 Bacteria 2374
315 Ga0207643_10057915 3300025908 Bacteria 2207
316 Ga0207643_10068631 3300025908 Bacteria 2037
317 Ga0207705_10262264 3300025909 Bacteria 1319
318 Ga0207705_10534207 3300025909 Bacteria 911
319 Ga0207684_10068094 3300025910 Bacteria 3026
320 Ga0207654_10039557 3300025911 Bacteria 2653
321 Ga0207695_10031173 3300025913 Bacteria 5854
322 Ga0207671_10005697 3300025914 Bacteria 11382
323 Ga0207662_10005052 3300025918 Bacteria 6989
324 Ga0207657_10034678 3300025919 Bacteria 4535
325 Ga0207649_10183643 3300025920 Bacteria 1466
326 Ga0207649_10549080 3300025920 Bacteria 884
327 Ga0207646_10771870 3300025922 Bacteria 857
328 Ga0207681_10018380 3300025923 Bacteria 4403
329 Ga0207681_10037586 3300025923 Bacteria 3200
330 Ga0207681_10049977 3300025923 Bacteria 2828
331 Ga0207681_10409725 3300025923 Bacteria 1096
332 Ga0207694_10024013 3300025924 Bacteria 4630
333 Ga0207650_10002460 3300025925 Bacteria 12887
334 Ga0207650_10009009 3300025925 Bacteria 6823
335 Ga0207650_10075499 3300025925 Bacteria 2544
336 Ga0207650_10285723 3300025925 Bacteria 1344
337 Ga0207650_10332674 3300025925 Bacteria 1246
338 Ga0207650_10469996 3300025925 Bacteria 1048
339 Ga0207659_10006295 3300025926 Bacteria 7260
340 Ga0207659_10041441 3300025926 Bacteria 3224
341 Ga0207659_10064026 3300025926 Bacteria 2660
342 Ga0207659_10160710 3300025926 Bacteria 1763
343 Ga0207659_10253830 3300025926 Bacteria 1428
344 Ga0207687_10053973 3300025927 Bacteria 2810
345 Ga0207687_10075296 3300025927 Bacteria 2422
346 Ga0207644_10016645 3300025931 Bacteria 4949
347 Ga0207644_10020354 3300025931 Bacteria 4511
348 Ga0207644_10042428 3300025931 Bacteria 3224
349 Ga0207644_10049561 3300025931 Bacteria 3007
350 Ga0207644_10219693 3300025931 Bacteria 1506
351 Ga0207644_10308767 3300025931 Bacteria 1276
352 Ga0207706_10031191 3300025933 Bacteria 4750
353 Ga0207706_10113749 3300025933 Bacteria 2380
354 Ga0207706_10242717 3300025933 Bacteria 1575
355 Ga0207686_10025578 3300025934 Bacteria 3435
356 Ga0207709_10021922 3300025935 Bacteria 3619
357 Ga0207709_10394828 3300025935 Bacteria 1056
358 Ga0207670_10035459 3300025936 Bacteria 3234
359 Ga0207670_10188582 3300025936 Bacteria 1559
360 Ga0207669_10014898 3300025937 Bacteria 3909
361 Ga0207669_10066497 3300025937 Bacteria 2241
362 Ga0207669_10074985 3300025937 Bacteria 2142
363 Ga0207669_10115988 3300025937 Bacteria 1806
364 Ga0207669_10132696 3300025937 Bacteria 1714
365 Ga0207669_10158269 3300025937 Bacteria 1596
366 Ga0207704_10008558 3300025938 Bacteria 4899
367 Ga0207704_10027482 3300025938 Bacteria 3141
368 Ga0207691_10001741 3300025940 Bacteria 21453
369 Ga0207691_10006082 3300025940 Bacteria 11664
370 Ga0207691_10007915 3300025940 Bacteria 10231
371 Ga0207691_10021169 3300025940 Bacteria 6144
372 Ga0207691_10038362 3300025940 Bacteria 4434
373 Ga0207691_10045325 3300025940 Bacteria 4043
374 Ga0207691_10082658 3300025940 Bacteria 2884
375 Ga0207691_10085262 3300025940 Bacteria 2835
376 Ga0207691_10106713 3300025940 Bacteria 2494
377 Ga0207691_10157816 3300025940 Bacteria 1991
378 Ga0207691_10172455 3300025940 Bacteria 1894
379 Ga0207691_10531419 3300025940 Bacteria 998
380 Ga0207691_10821458 3300025940 Bacteria 780
381 Ga0207711_10077302 3300025941 Bacteria 2901
382 Ga0207711_10297657 3300025941 Bacteria 1488
383 Ga0207689_10011178 3300025942 Bacteria 7701
384 Ga0207689_10014824 3300025942 Bacteria 6617
385 Ga0207689_10055774 3300025942 Bacteria 3252
386 Ga0207689_10315909 3300025942 Bacteria 1296
387 Ga0207661_10130483 3300025944 Bacteria 2152
388 Ga0207679_10084416 3300025945 Bacteria 2437
389 Ga0207679_10171165 3300025945 Bacteria 1788
390 Ga0207679_10274408 3300025945 Bacteria 1443
391 Ga0207651_10006687 3300025960 Bacteria 6069
392 Ga0207651_10037495 3300025960 Bacteria 3176
393 Ga0207651_10155760 3300025960 Bacteria 1784
394 Ga0207651_10275512 3300025960 Bacteria 1388
395 Ga0207651_10770105 3300025960 Bacteria 852
396 Ga0207712_10005181 3300025961 Bacteria 8251
397 Ga0207712_10076222 3300025961 Bacteria 2427
398 Ga0207668_10033305 3300025972 Bacteria 3412
399 Ga0207668_10092840 3300025972 Bacteria 2222
400 Ga0207640_10451546 3300025981 Bacteria 1059
401 Ga0207640_10714845 3300025981 Bacteria 860
402 Ga0207658_10000959 3300025986 Bacteria 23778
403 Ga0207658_10009082 3300025986 Bacteria 6742
404 Ga0207658_10034313 3300025986 Bacteria 3626
405 Ga0207658_10059730 3300025986 Bacteria 2842
406 Ga0207658_10087064 3300025986 Bacteria 2411
407 Ga0207658_10314803 3300025986 Bacteria 1353
408 Ga0207677_10072104 3300026023 Bacteria 2440
409 Ga0207677_10092228 3300026023 Bacteria 2205
410 Ga0207677_10133104 3300026023 Bacteria 1891
411 Ga0207677_10219121 3300026023 Bacteria 1525
412 Ga0207703_10001350 3300026035 Bacteria 22464
413 Ga0207703_10206014 3300026035 Bacteria 1750
414 Ga0207678_10010696 3300026067 Bacteria 8061
415 Ga0207678_10041360 3300026067 Bacteria 3996
416 Ga0207702_10241988 3300026078 Bacteria 1691
417 Ga0207641_10009363 3300026088 Bacteria 8078
418 Ga0207641_10049902 3300026088 Bacteria 3538
419 Ga0207641_10069885 3300026088 Bacteria 3016
420 Ga0207641_10112479 3300026088 Bacteria 2416
421 Ga0207641_10323964 3300026088 Bacteria 1462
422 Ga0207641_10918976 3300026088 Bacteria 869
423 Ga0207648_10002848 3300026089 Bacteria 18311
424 Ga0207648_10010781 3300026089 Bacteria 8636
425 Ga0207648_10033465 3300026089 Bacteria 4533
426 Ga0207648_10038606 3300026089 Bacteria 4201
427 Ga0207648_10052175 3300026089 Bacteria 3576
428 Ga0207648_10054667 3300026089 Bacteria 3487
429 Ga0207648_10097960 3300026089 Bacteria 2567
430 Ga0207648_10105316 3300026089 Bacteria 2474
431 Ga0207676_10015099 3300026095 Bacteria 5569
432 Ga0207676_10026111 3300026095 Bacteria 4341
433 Ga0207676_10026609 3300026095 Bacteria 4302
434 Ga0207676_10508889 3300026095 Bacteria 1144
435 Ga0207674_10008218 3300026116 Bacteria 12093
436 Ga0207674_10022905 3300026116 Bacteria 6701
437 Ga0207675_100025434 3300026118 Bacteria 5511
438 Ga0207675_100075512 3300026118 Bacteria 3155
439 Ga0207675_101167756 3300026118 Bacteria 790
440 Ga0207683_10006663 3300026121 Bacteria 9879
441 Ga0207683_10011765 3300026121 Bacteria 7468
442 Ga0207683_10013159 3300026121 Bacteria 7059
443 Ga0207683_10048071 3300026121 Bacteria 3736
444 Ga0207683_10052477 3300026121 Bacteria 3573
445 Ga0207683_10084334 3300026121 Bacteria 2824
446 Ga0207683_10118931 3300026121 Bacteria 2371
447 Ga0207683_10176541 3300026121 Bacteria 1936
448 Ga0207683_10188520 3300026121 Bacteria 1872
449 Ga0207698_10036460 3300026142 Bacteria 3610
450 Ga0207698_10280502 3300026142 Bacteria 1541
451 Ga0207698_10461291 3300026142 Bacteria 1229
452 Ga0207698_11003022 3300026142 Bacteria 846
453 Ga0209281_1000042 3300027111 Bacteria 344748
454 Ga0209813_10064684 3300027866 Bacteria 1176
455 Ga0209974_10132095 3300027876 Bacteria 891
456 Ga0268266_10490045 3300028379 Bacteria 1172
457 Ga0268266_10722222 3300028379 Bacteria 961
458 Ga0268265_10058350 3300028380 Bacteria 2946
459 Ga0268265_10756346 3300028380 Bacteria 944
460 Ga0268264_10004852 3300028381 Bacteria 11396
461 Ga0268264_10092858 3300028381 Bacteria 2606
462 Ga0268264_10238395 3300028381 Bacteria 1684
463 Ga0268264_10258278 3300028381 Bacteria 1622
464 Ga0307517_10001871 3300028786 Bacteria 34464
465 Ga0307517_10080650 3300028786 Bacteria 2784
466 Ga0307517_10091945 3300028786 Bacteria 2473
467 Ga0307517_10229954 3300028786 Bacteria 1115
468 Ga0307515_10000991 3300028794 Bacteria 64898
469 Ga0307515_10001283 3300028794 Bacteria 57022
470 Ga0307515_10038740 3300028794 Bacteria 7610
471 Ga0307515_10064124 3300028794 Bacteria 5141
472 Ga0307515_10252323 3300028794 Bacteria 1514
473 Ga0307515_10336081 3300028794 Bacteria 1166
474 Ga0307515_10477683 3300028794 Bacteria 859
475 Ga0307512_10113458 3300030522 Bacteria 1773
476 Ga0307513_10034868 3300031456 Bacteria 5639
477 Ga0307513_10116867 3300031456 Bacteria 2645
478 Ga0307513_10119691 3300031456 Bacteria 2604
479 Ga0307513_10168930 3300031456 Bacteria 2067
480 Ga0307513_10236591 3300031456 Bacteria 1635
481 Ga0307513_10471060 3300031456 Bacteria 977
482 Ga0307513_10617064 3300031456 Bacteria 793
483 Ga0307509_10000041 3300031507 Bacteria 182302
484 Ga0307509_10025279 3300031507 Bacteria 6635
485 Ga0307509_10030443 3300031507 Bacteria 5970
486 Ga0307509_10064009 3300031507 Bacteria 3870
487 Ga0307509_10139159 3300031507 Bacteria 2367
488 Ga0307509_10214130 3300031507 Bacteria 1748
489 Ga0307508_10000227 3300031616 Bacteria 68533
490 Ga0307508_10038562 3300031616 Bacteria 4293
491 Ga0307514_10001840 3300031649 Bacteria 23499
492 Ga0307514_10077945 3300031649 Bacteria 2463
493 Ga0307514_10100606 3300031649 Bacteria 2077
494 Ga0307516_10000312 3300031730 Bacteria 62905
495 Ga0307516_10000497 3300031730 Bacteria 52295
496 Ga0307516_10004946 3300031730 Bacteria 16201
497 Ga0307516_10005605 3300031730 Bacteria 14948
498 Ga0307516_10350336 3300031730 Bacteria 1142
499 Ga0307405_10006547 3300031731 Bacteria 5739
500 Ga0307413_10094755 3300031824 Bacteria 1955
501 Ga0307410_10009817 3300031852 Bacteria 5391
502 Ga0307406_10034996 3300031901 Bacteria 3085
503 Ga0307407_10101551 3300031903 Bacteria 1786
504 Ga0307412_10018914 3300031911 Bacteria 4158
505 Ga0307409_100094217 3300031995 Bacteria 2463
506 Ga0307409_100255757 3300031995 Bacteria 1604
507 Ga0307416_100088088 3300032002 Bacteria 2653
508 Ga0307416_100158615 3300032002 Bacteria 2087
509 Ga0307411_10048663 3300032005 Bacteria 2749
510 Ga0307507_10040065 3300033179 Bacteria 4714
511 Ga0307510_10020701 3300033180 Bacteria 7681
512 Ga0307510_10026627 3300033180 Bacteria 6642
513 Ga0307510_10100095 3300033180 Bacteria 2694
514 Ga0307510_10105002 3300033180 Bacteria 2595
515 Ga0373953_0051288 3300035117 Bacteria 1668
516 Ga0373943_0031464 3300035170 Bacteria 2518
517 Ga0373924_0062125 3300035410 Bacteria 1564
518 Ga0373931_0033207 3300035691 Bacteria 2673
519 Ga0373935_0224379 3300035692 Bacteria 1306
520 Ga0373927_0266747 3300035695 Bacteria 1126
521 Ga0373933_0332096 3300035724 Bacteria 986
522 Ga0373947_0028227 3300035725 Bacteria 3288
523 Ga0373937_0028691 3300036401 Bacteria 5037
524 Ga0373937_0075115 3300036401 Bacteria 3120
525 Ga0373937_0134894 3300036401 Bacteria 2307
526 Ga0395900_0572842 3300037418 Bacteria 1072
527 Ga0395900_0966104 3300037418 Bacteria 773
528 Ga0395898_0060715 3300037466 Bacteria 3673
529 Ga0395905_0000431 3300037471 Bacteria 58717
530 Ga0395905_0013446 3300037471 Bacteria 7843
531 Ga0395905_0016819 3300037471 Bacteria 6948
532 Ga0395905_0017199 3300037471 Bacteria 6868
533 Ga0395905_0022443 3300037471 Bacteria 5968
534 Ga0395905_0188665 3300037471 Bacteria 1934
535 Ga0395905_0235876 3300037471 Bacteria 1710
536 Ga0395905_0398234 3300037471 Bacteria 1271
537 Ga0436361_0537689 3300039447 Bacteria 1286
538 Ga0436361_0552361 3300039447 Bacteria 2748
539 Ga0439439_0055533 3300041406 Bacteria 1045
540 Ga0451789_0966433 3300041443 Bacteria 813
541 Ga0451791_0680598 3300041451 Bacteria 771
542 Ga0451793_0607649 3300041452 Bacteria 1389
543 Ga0451793_1038358 3300041452 Bacteria 761
544 Ga0451793_1656761 3300041452 Bacteria 854
545 Ga0451797_0679364 3300041453 Bacteria 1105
546 Ga0451807_1925146 3300041486 Bacteria 1082
547 Ga0451835_1076998 3300041492 Bacteria 791
548 Ga0451839_0531012 3300041496 Unclassified 772
549 Ga0451851_0230368 3300041507 Bacteria 734
550 Ga0451853_1613797 3300041512 Bacteria 1792
551 Ga0450911_003584 3300042115 Bacteria 2704
552 Ga0450919_000514 3300042121 Bacteria 4843
553 Ga0439459_0015933 3300042438 Bacteria 1383
554 Ga0450918_000377 3300042531 Bacteria 9735
555 Ga0450893_0009216 3300042532 Bacteria 1611
556 Ga0451577_0356691 3300042876 Bacteria 1326
557 Ga0451577_0403684 3300042876 Bacteria 1240
558 Ga0466969_0109207 3300044656 Bacteria 1296
559 Ga0466965_0243806 3300044683 Bacteria 962
560 Ga0466961_0112239 3300044693 Bacteria 1714
561 Ga0466964_0002777 3300044706 Bacteria 6290
562 Ga0453684_0703456 3300044712 Bacteria 1098
563 Ga0466971_0015449 3300044719 Bacteria 3360
564 Ga0466968_0314042 3300044735 Bacteria 756
565 Ga0466970_0087113 3300044765 Bacteria 1693
566 Ga0466959_0015984 3300045049 Bacteria 5477
567 Ga0451576_0114403 3300045051 Bacteria 2808
568 Ga0495592_0000028 3300046454 Bacteria 132590
569 Ga0495590_0007405 3300046457 Bacteria 4236
570 Ga0495629_0069203 3300046459 Bacteria 2463
571 Ga0495638_0054568 3300046460 Bacteria 2484
572 Ga0495638_0235906 3300046460 Bacteria 1015
573 Ga0495610_0053593 3300046512 Bacteria 1952
574 Ga0495610_0095059 3300046512 Bacteria 1344
575 Ga0495616_0090863 3300046513 Bacteria 1446
576 Ga0495618_0192528 3300046514 Bacteria 1293
577 Ga0495620_0059119 3300046515 Bacteria 1603
578 Ga0495628_0380886 3300046516 Bacteria 1033
579 Ga0495628_0528178 3300046516 Bacteria 849
580 Ga0495630_0047998 3300046517 Bacteria 3195
581 Ga0495632_0007745 3300046519 Bacteria 6701
582 Ga0495632_0055676 3300046519 Bacteria 1935
583 Ga0495632_0179215 3300046519 Bacteria 971
584 Ga0495666_0036781 3300046526 Bacteria 2384
585 Ga0495654_0022190 3300046530 Bacteria 3299
586 Ga0495621_0005578 3300046539 Bacteria 3627
587 Ga0495621_0054314 3300046539 Bacteria 1440
588 Ga0495621_0066745 3300046539 Bacteria 1317
589 Ga0495621_0157671 3300046539 Bacteria 896
590 Ga0495621_0198156 3300046539 Bacteria 807
591 Ga0495597_0108459 3300046542 Bacteria 1166
592 Ga0495645_0067784 3300046543 Bacteria 2577
593 Ga0495645_0156318 3300046543 Bacteria 1580
594 Ga0495645_0425101 3300046543 Bacteria 842
595 Ga0495622_0242412 3300046557 Bacteria 794
596 Ga0495625_0019171 3300046660 Bacteria 5316
597 Ga0495625_0022014 3300046660 Bacteria 4894
598 Ga0495625_0156033 3300046660 Bacteria 1532
599 Ga0495625_0453014 3300046660 Bacteria 792
600 Ga0495635_0563347 3300046663 Bacteria 746
601 Ga0495646_0084859 3300046680 Bacteria 1838
602 Ga0495647_0216216 3300046681 Bacteria 845
603 Ga0495658_0129338 3300046683 Bacteria 1535
604 Ga0495658_0145588 3300046683 Bacteria 1452
605 Ga0495613_0219569 3300046689 Bacteria 1335
606 Ga0495624_0053869 3300046690 Bacteria 2538
607 Ga0495671_0133351 3300046692 Bacteria 1211
608 Ga0495649_0004724 3300046694 Bacteria 8839
609 Ga0495660_0105785 3300046810 Bacteria 1442
610 Ga0495674_0278914 3300047319 Bacteria 1370
611 Ga0495687_000594 3300047443 Bacteria 42250
612 Ga0495687_005079 3300047443 Bacteria 8539
613 Ga0495687_006945 3300047443 Bacteria 6806
614 Ga0495684_0138480 3300047471 Bacteria 1826
615 Ga0495684_0339469 3300047471 Bacteria 1069
616 Ga0495686_0001297 3300047472 Bacteria 28173
617 Ga0495593_0029380 3300047673 Bacteria 3014
618 Ga0495626_0026314 3300048091 Bacteria 2837
619 Ga0496104_0272846 3300048907 Bacteria 1604
620 Ga0496105_0272040 3300048908 Bacteria 1368
621 Ga0496106_0351541 3300048909 Bacteria 1184
622 Ga0496108_0273204 3300048911 Bacteria 1471
623 Ga0496109_0128519 3300048912 Bacteria 2364
624 Ga0496110_0235992 3300048913 Bacteria 1664
625 Ga0496114_0013197 3300048917 Bacteria 6622
626 Ga0496121_0018535 3300048924 Bacteria 7012
627 Ga0496121_0026536 3300048924 Bacteria 5454
628 Ga0496124_0000317 3300048927 Bacteria 89188
629 Ga0496124_0136939 3300048927 Bacteria 1937
630 Ga0496124_0639209 3300048927 Bacteria 685
631 Ga0496125_0022403 3300048928 Bacteria 5867
632 Ga0496125_0060586 3300048928 Bacteria 3040
633 Ga0496125_0080252 3300048928 Bacteria 2497
634 Ga0496125_0145801 3300048928 Bacteria 1636
635 Ga0496125_0199471 3300048928 Bacteria 1312
636 Ga0495682_0079819 3300049460 Bacteria 1177
637 Ga0501292_010355 3300049515 Bacteria 1395
638 Ga0501043_0000004 3300049579 Bacteria 291085
639 Ga0501046_0000016 3300049580 Bacteria 234374
640 Ga0501047_0000012 3300049581 Bacteria 368824
641 Ga0501048_0035397 3300049582 Bacteria 3594
642 Ga0501252_007397 3300049682 Bacteria 1243
643 Ga0501035_0207821 3300049822 Bacteria 1676
644 Ga0501045_0192075 3300049824 Bacteria 1522
645 nmdc:mga03683_149396_c1 3300050489 Bacteria 1054
646 nmdc:mga03683_358208_c1 3300050489 Bacteria 691
647 nmdc:mga03683_9019_c1 3300050489 Bacteria 3529
648 nmdc:mga03n38_307349_c1 3300050490 Bacteria 853
649 nmdc:mga03n38_326475_c1 3300050490 Bacteria 830
650 nmdc:mga03n38_72335_c1 3300050490 Bacteria 1598
651 nmdc:mga00v17_256147_c1 3300050491 Bacteria 1135
652 nmdc:mga0yw44_47259_c1 3300050492 Bacteria 2589
653 nmdc:mga0k408_106001_c1 3300050493 Bacteria 1660
654 nmdc:mga0k408_14932_c1 3300050493 Bacteria 4289
655 nmdc:mga0k408_161057_c1 3300050493 Bacteria 1337
656 nmdc:mga0k408_24186_c1 3300050493 Bacteria 2706
657 nmdc:mga0k408_25980_c1 3300050493 Bacteria 3319
658 nmdc:mga0k408_34475_c1 3300050493 Bacteria 2898
659 nmdc:mga0k408_41741_c1 3300050493 Bacteria 2642
660 nmdc:mga0k408_570007_c1 3300050493 Bacteria 669
661 nmdc:mga0k408_66956_c1 3300050493 Bacteria 2093
662 nmdc:mga0k408_83039_c1 3300050493 Bacteria 1878
663 nmdc:mga0k408_8818_c1 3300050493 Bacteria 5428
664 nmdc:mga0k408_9344_c1 3300050493 Bacteria 5283
665 nmdc:mga06z11_110420_c1 3300050494 Bacteria 1522
666 nmdc:mga06z11_123658_c1 3300050494 Bacteria 1446
667 nmdc:mga06z11_248091_c1 3300050494 Bacteria 1048
668 nmdc:mga04h51_40466_c1 3300050495 Bacteria 1519
669 nmdc:mga04h51_70965_c1 3300050495 Bacteria 1216
670 nmdc:mga07m45_167580_c1 3300050496 Bacteria 1276
671 nmdc:mga07m45_192112_c1 3300050496 Bacteria 1187
672 nmdc:mga07m45_219578_c1 3300050496 Bacteria 1106
673 nmdc:mga07m45_2993_c2 3300050496 Bacteria 5533
674 nmdc:mga07m45_35470_c1 3300050496 Bacteria 2774
675 nmdc:mga07m45_408656_c1 3300050496 Bacteria 788
676 nmdc:mga07m45_436225_c1 3300050496 Bacteria 760
677 nmdc:mga07m45_68110_c1 3300050496 Bacteria 2024
678 nmdc:mga07m45_9585_c1 3300050496 Bacteria 5031
679 nmdc:mga0sz30_3098_c1 3300050516 Bacteria 5961
680 Ga0495601_0299709 3300053077 Bacteria 1047
681 Ga0495612_0257763 3300053078 Bacteria 777
682 Ga0495595_0089668 3300053084 Bacteria 1474
683 Ga0495619_0476371 3300053085 Bacteria 860
684 Ga0500578_0000282 3300053086 Bacteria 62821
685 Ga0500578_0035984 3300053086 Bacteria 3181
686 Ga0500644_0055142 3300053088 Bacteria 1379
687 Ga0500646_0001831 3300053090 Bacteria 5587
688 Ga0500647_0056143 3300053091 Bacteria 1894
689 Ga0500651_0013178 3300053093 Bacteria 5028
690 Ga0500651_0079698 3300053093 Bacteria 2029
691 Ga0500651_0389613 3300053093 Bacteria 784
692 Ga0500650_0065740 3300053098 Bacteria 1694
693 Ga0500650_0139505 3300053098 Bacteria 1124
694 Ga0500569_023259 3300053109 Bacteria 1663
695 Ga0500607_115033 3300053121 Bacteria 1312
696 Ga0500623_120745 3300053127 Bacteria 1149
697 Ga0500642_0000652 3300053130 Bacteria 10322
698 Ga0500652_000492 3300053131 Bacteria 13875
699 Ga0500658_0008541 3300053134 Bacteria 3783
700 Ga0500559_0017642 3300053136 Bacteria 3015
701 Ga0500559_0133526 3300053136 Bacteria 1160
702 Ga0500568_0028846 3300053139 Bacteria 2310
703 Ga0500568_0053545 3300053139 Bacteria 1581
704 Ga0500568_0072439 3300053139 Bacteria 1317
705 Ga0500590_020753 3300053148 Bacteria 3410
706 Ga0500604_0003349 3300053151 Bacteria 4309
707 Ga0500604_0116829 3300053151 Bacteria 889
708 Ga0500619_000180 3300053154 Bacteria 15135
709 Ga0500622_0000202 3300053156 Bacteria 63233
710 Ga0500622_0043686 3300053156 Bacteria 2324
711 Ga0500622_0081863 3300053156 Bacteria 1615
712 Ga0500634_0088639 3300053161 Bacteria 1576
713 Ga0500636_0077845 3300053177 Bacteria 1915
714 Ga0500645_002406 3300053730 Bacteria 8396
715 Ga0500587_000298 3300053739 Bacteria 5554
716 Ga0466962_0002769 3300061719 Bacteria 8328
717 2587730558 2585428057 Bacteria 6737412
718 2587734918 2585428058 Bacteria 6853932
719 2588293137 2588253510 Bacteria 6901809
720 2643968359 2643221592 Bacteria 6608788
721 2644141849 2643221625 Bacteria 6512927
722 2644245713 2643221644 Bacteria 6865017
723 2644272482 2643221648 Bacteria 6521465
724 2644304273 2643221654 Bacteria 5273570
725 2644338342 2643221660 Bacteria 4208257
726 Ga0070706_100000670
727 JGI25152J39213_1001709
728 JGI25152J39213_1002886
729 JGI25153J46596_10029375
730 rootL2_10175725
731 rootH1_10012451
732 rootH1_10029292
733 Ga0055526_1004651
734 Ga0055530_10011329
735 Ga0055530_10013387
736 Ga0055540_1000002
737 Ga0055531_10004641
738 Ga0065165_1003311
739 Ga0070658_10839318
740 Ga0070676_10009865
741 Ga0070676_10013248
742 Ga0070676_10014725
743 Ga0070676_10026643
744 Ga0070676_10109878
745 Ga0070676_10380063
746 Ga0070683_100186750
747 Ga0070690_100123156
748 Ga0070670_100001820
749 Ga0070670_100016116
750 Ga0070670_100097990
751 Ga0070670_100101058
752 Ga0070670_100415891
753 Ga0070677_10001548
754 Ga0070677_10009375
755 Ga0070677_10027675
756 Ga0070677_10037333
757 Ga0068869_100004621
758 Ga0068869_100013561
759 Ga0068869_100027665
760 Ga0068869_100227886
761 Ga0070666_10041643
762 Ga0068868_100081103
763 Ga0068868_100097025
764 Ga0068868_100146793
765 Ga0068868_100334934
766 Ga0070689_100034512
767 Ga0070689_100175586
768 Ga0070689_100896337
769 Ga0070687_100014736
770 Ga0070661_100290663
771 Ga0070661_100621432
772 Ga0070668_100004953
773 Ga0070668_100009291
774 Ga0070668_100386909
775 Ga0070669_100006105
776 Ga0070669_100025041
777 Ga0070669_100066477
778 Ga0070669_100261286
779 Ga0070675_100001535
780 Ga0070675_100005184
781 Ga0070675_100028715
782 Ga0070675_101052871
783 Ga0070671_100021133
784 Ga0070671_100040868
785 Ga0070671_100081753
786 Ga0070671_100357690
787 Ga0070671_100398329
788 Ga0070671_100674958
789 Ga0070674_100008300
790 Ga0070674_100030634
791 Ga0070674_100069521
792 Ga0070674_100236318
793 Ga0070674_100263727
794 Ga0070673_100005136
795 Ga0070673_100008629
796 Ga0070673_100072711
797 Ga0070673_100234991
798 Ga0070673_100261577
799 Ga0070673_100305514
800 Ga0070673_100413928
801 Ga0070673_100762403
802 Ga0070673_101090464
803 Ga0070688_100068326
804 Ga0070667_100001171
805 Ga0070667_100003010
806 Ga0070667_100043049
807 Ga0070667_100089205
808 Ga0070667_100106214
809 Ga0070667_100419924
810 Ga0070667_100432808
811 Ga0070667_100990802
812 Ga0070663_100029789
813 Ga0070663_100275335
814 Ga0070663_100415337
815 Ga0070678_100001334
816 Ga0070678_100009607
817 Ga0070678_100096522
818 Ga0070678_100477514
819 Ga0070678_100621406
820 Ga0070678_100711885
821 Ga0070678_100938836
822 Ga0070662_100010471
823 Ga0070662_100032584
824 Ga0070662_100034601
825 Ga0070662_100813706
826 Ga0068867_100002841
827 Ga0068867_100002971
828 Ga0068867_100032757
829 Ga0068867_100042848
830 Ga0068867_100052489
831 Ga0068867_100105376
832 Ga0068867_100139769
833 Ga0068867_100146767
834 Ga0070707_100557157
835 Ga0070699_100224034
836 Ga0070679_100194436
837 Ga0070672_100002062
838 Ga0070672_100003281
839 Ga0070672_100010713
840 Ga0070672_100023394
841 Ga0070672_100042983
842 Ga0070672_100048996
843 Ga0070672_100062465
844 Ga0070672_100140374
845 Ga0070672_100205866
846 Ga0070672_100272832
847 Ga0070672_100282596
848 Ga0070672_100388970
849 Ga0070686_100789242
850 Ga0070693_100079779
851 Ga0070665_100191214
852 Ga0070665_100471710
853 Ga0070664_100104728
854 Ga0070664_100706313
855 Ga0068857_100012825
856 Ga0068857_100025437
857 Ga0068854_100018059
858 Ga0068854_100030430
859 Ga0068854_100143833
860 Ga0068856_100059001
861 Ga0068852_100070012
862 Ga0068852_100164833
863 Ga0068852_100601482
864 Ga0068852_101136915
865 Ga0068859_100002636
866 Ga0068859_100012962
867 Ga0068859_100078982
868 Ga0068864_100020879
869 Ga0068864_100045556
870 Ga0068864_100110843
871 Ga0068864_100201786
872 Ga0068864_100525333
873 Ga0068866_10007367
874 Ga0068866_10119073
875 Ga0068861_100040775
876 Ga0068861_100063998
877 Ga0068851_10104658
878 Ga0068851_10397291
879 Ga0068870_10041700
880 Ga0068870_10042666
881 Ga0068863_100004608
882 Ga0068863_100131899
883 Ga0068863_100147201
884 Ga0068863_100292604
885 Ga0068863_100376200
886 Ga0068863_100486275
887 Ga0068863_100654072
888 Ga0068858_100001760
889 Ga0068858_100054908
890 Ga0068858_100104820
891 Ga0068860_100001433
892 Ga0068860_100299585
893 Ga0068860_100373451
894 Ga0068860_100536719
895 Ga0068862_100025669
896 Ga0068862_100036314
897 Ga0070717_10873321
898 Ga0075365_10106212
899 Ga0075368_10024067
900 Ga0075368_10064592
901 Ga0075363_100044589
902 Ga0075363_100072670
903 Ga0075363_100084357
904 Ga0075363_100197021
905 Ga0075364_10050756
906 Ga0075362_10058661
907 Ga0075362_10127865
908 Ga0075362_10305949
909 Ga0075367_10022479
910 Ga0075367_10029363
911 Ga0075367_10294385
912 Ga0075369_10010341
913 Ga0075366_10013799
914 Ga0075366_10023472
915 Ga0075366_10034429
916 Ga0075366_10042422
917 Ga0075366_10059108
918 Ga0075366_10189916
919 Ga0075366_10334354
920 Ga0097621_100020890
921 Ga0097621_100067657
922 Ga0097621_100083076
923 Ga0097621_100325218
924 Ga0097621_100439860
925 Ga0097621_100894581
926 Ga0075370_10001743
927 Ga0075370_10007921
928 Ga0075370_10011666
929 Ga0075370_10032948
930 Ga0075370_10038650
931 Ga0075370_10125572
932 Ga0075370_10152705
933 Ga0075370_10204779
934 Ga0068871_100005010
935 Ga0068871_100040812
936 Ga0068871_100137399
937 Ga0068871_100141677
938 Ga0068871_100195663
939 Ga0068865_100010127
940 Ga0068865_100036259
941 Ga0097620_100002636
942 Ga0097620_100012962
943 Ga0097620_100078978
944 Ga0079104_1000017
945 Ga0105245_10048773
946 Ga0105245_10122662
947 Ga0105245_10256066
948 Ga0105243_10049442
949 Ga0105243_10082533
950 Ga0105243_10187471
951 Ga0105243_10232044
952 Ga0105241_10953023
953 Ga0105242_10014443
954 Ga0105242_10204457
955 Ga0105248_10138031
956 Ga0105248_10180017
957 Ga0105237_10003466
958 Ga0105237_10008395
959 Ga0105237_10157249
960 Ga0105238_10007665
961 Ga0105238_10824318
962 Ga0105249_10009522
963 Ga0105249_10052686
964 Ga0105239_10003789
965 Ga0105239_10060249
966 Ga0157371_10031263
967 Ga0157369_10660417
968 Ga0157374_10121407
969 Ga0157374_10561120
970 Ga0157374_10641785
971 Ga0157378_10044989
972 Ga0157378_10078498
973 Ga0157378_10271274
974 Ga0163162_10028472
975 Ga0163162_10052435
976 Ga0163162_10060587
977 Ga0163162_10166173
978 Ga0163162_10194073
979 Ga0157375_10003544
980 Ga0157375_10031329
981 Ga0157375_10039345
982 Ga0157375_10056327
983 Ga0157375_10135933
984 Ga0157375_10237311
985 Ga0157375_11266767
986 Ga0163163_10083873
987 Ga0163163_10179958
988 Ga0163163_10510020
989 Ga0157380_10102647
990 Ga0157380_10318490
991 Ga0157380_10556477
992 Ga0157377_10068176
993 Ga0157379_10013894
994 Ga0157379_10031728
995 Ga0157376_10051337
996 Ga0157376_10327596
997 Ga0157376_10361085
998 Ga0163161_10031938
999 Ga0163161_10049540
1000 Ga0163161_10051865
1001 Ga0213872_10042754
1002 Ga0207425_1000131
1003 Ga0209129_1000075
1004 Ga0209673_1002275
1005 Ga0209673_1051328
1006 Ga0209675_1006935
1007 Ga0209564_1000046
1008 Ga0209758_1000045
1009 Ga0209758_1000052
1010 Ga0209050_1000247
1011 Ga0209050_1000457
1012 Ga0209050_1022563
1013 Ga0209256_1000011
1014 Ga0209256_1013851
1015 Ga0209256_1064149
1016 Ga0209051_1000024
1017 Ga0209051_1002674
1018 Ga0209051_1018049
1019 Ga0209257_1000079
1020 Ga0209257_1030582
1021 Ga0207697_10017238
1022 Ga0207656_10111072
1023 Ga0207656_10193028
1024 Ga0207682_10001523
1025 Ga0207682_10027272
1026 Ga0207682_10033070
1027 Ga0207682_10049175
1028 Ga0207682_10063659
1029 Ga0207642_10018235
1030 Ga0207642_10030161
1031 Ga0207642_10051757
1032 Ga0207642_10157072
1033 Ga0207680_10110209
1034 Ga0207680_10325724
1035 Ga0207680_10394355
1036 Ga0207645_10003743
1037 Ga0207645_10008686
1038 Ga0207645_10012119
1039 Ga0207643_10049838
1040 Ga0207643_10057915
1041 Ga0207643_10068631
1042 Ga0207705_10262264
1043 Ga0207705_10534207
1044 Ga0207684_10068094
1045 Ga0207654_10039557
1046 Ga0207695_10031173
1047 Ga0207671_10005697
1048 Ga0207662_10005052
1049 Ga0207657_10034678
1050 Ga0207649_10183643
1051 Ga0207649_10549080
1052 Ga0207646_10771870
1053 Ga0207681_10018380
1054 Ga0207681_10037586
1055 Ga0207681_10049977
1056 Ga0207681_10409725
1057 Ga0207694_10024013
1058 Ga0207650_10002460
1059 Ga0207650_10009009
1060 Ga0207650_10075499
1061 Ga0207650_10285723
1062 Ga0207650_10332674
1063 Ga0207650_10469996
1064 Ga0207659_10006295
1065 Ga0207659_10041441
1066 Ga0207659_10064026
1067 Ga0207659_10160710
1068 Ga0207659_10253830
1069 Ga0207687_10053973
1070 Ga0207687_10075296
1071 Ga0207644_10016645
1072 Ga0207644_10020354
1073 Ga0207644_10042428
1074 Ga0207644_10049561
1075 Ga0207644_10219693
1076 Ga0207644_10308767
1077 Ga0207706_10031191
1078 Ga0207706_10113749
1079 Ga0207706_10242717
1080 Ga0207686_10025578
1081 Ga0207709_10021922
1082 Ga0207709_10394828
1083 Ga0207670_10035459
1084 Ga0207670_10188582
1085 Ga0207669_10014898
1086 Ga0207669_10066497
1087 Ga0207669_10074985
1088 Ga0207669_10115988
1089 Ga0207669_10132696
1090 Ga0207669_10158269
1091 Ga0207704_10008558
1092 Ga0207704_10027482
1093 Ga0207691_10001741
1094 Ga0207691_10006082
1095 Ga0207691_10007915
1096 Ga0207691_10021169
1097 Ga0207691_10038362
1098 Ga0207691_10045325
1099 Ga0207691_10082658
1100 Ga0207691_10085262
1101 Ga0207691_10106713
1102 Ga0207691_10157816
1103 Ga0207691_10172455
1104 Ga0207691_10531419
1105 Ga0207691_10821458
1106 Ga0207711_10077302
1107 Ga0207711_10297657
1108 Ga0207689_10011178
1109 Ga0207689_10014824
1110 Ga0207689_10055774
1111 Ga0207689_10315909
1112 Ga0207661_10130483
1113 Ga0207679_10084416
1114 Ga0207679_10171165
1115 Ga0207679_10274408
1116 Ga0207651_10006687
1117 Ga0207651_10037495
1118 Ga0207651_10155760
1119 Ga0207651_10275512
1120 Ga0207651_10770105
1121 Ga0207712_10005181
1122 Ga0207712_10076222
1123 Ga0207668_10033305
1124 Ga0207668_10092840
1125 Ga0207640_10451546
1126 Ga0207640_10714845
1127 Ga0207658_10000959
1128 Ga0207658_10009082
1129 Ga0207658_10034313
1130 Ga0207658_10059730
1131 Ga0207658_10087064
1132 Ga0207658_10314803
1133 Ga0207677_10072104
1134 Ga0207677_10092228
1135 Ga0207677_10133104
1136 Ga0207677_10219121
1137 Ga0207703_10001350
1138 Ga0207703_10206014
1139 Ga0207678_10010696
1140 Ga0207678_10041360
1141 Ga0207702_10241988
1142 Ga0207641_10009363
1143 Ga0207641_10049902
1144 Ga0207641_10069885
1145 Ga0207641_10112479
1146 Ga0207641_10323964
1147 Ga0207641_10918976
1148 Ga0207648_10002848
1149 Ga0207648_10010781
1150 Ga0207648_10033465
1151 Ga0207648_10038606
1152 Ga0207648_10052175
1153 Ga0207648_10054667
1154 Ga0207648_10097960
1155 Ga0207648_10105316
1156 Ga0207676_10015099
1157 Ga0207676_10026111
1158 Ga0207676_10026609
1159 Ga0207676_10508889
1160 Ga0207674_10008218
1161 Ga0207674_10022905
1162 Ga0207675_100025434
1163 Ga0207675_100075512
1164 Ga0207675_101167756
1165 Ga0207683_10006663
1166 Ga0207683_10011765
1167 Ga0207683_10013159
1168 Ga0207683_10048071
1169 Ga0207683_10052477
1170 Ga0207683_10084334
1171 Ga0207683_10118931
1172 Ga0207683_10176541
1173 Ga0207683_10188520
1174 Ga0207698_10036460
1175 Ga0207698_10280502
1176 Ga0207698_10461291
1177 Ga0207698_11003022
1178 Ga0209281_1000042
1179 Ga0209813_10064684
1180 Ga0209974_10132095
1181 Ga0268266_10490045
1182 Ga0268266_10722222
1183 Ga0268265_10058350
1184 Ga0268265_10756346
1185 Ga0268264_10004852
1186 Ga0268264_10092858
1187 Ga0268264_10238395
1188 Ga0268264_10258278
1189 Ga0307517_10001871
1190 Ga0307517_10080650
1191 Ga0307517_10091945
1192 Ga0307517_10229954
1193 Ga0307515_10000991
1194 Ga0307515_10001283
1195 Ga0307515_10038740
1196 Ga0307515_10064124
1197 Ga0307515_10252323
1198 Ga0307515_10336081
1199 Ga0307515_10477683
1200 Ga0307512_10113458
1201 Ga0307513_10034868
1202 Ga0307513_10116867
1203 Ga0307513_10119691
1204 Ga0307513_10168930
1205 Ga0307513_10236591
1206 Ga0307513_10471060
1207 Ga0307513_10617064
1208 Ga0307509_10000041
1209 Ga0307509_10025279
1210 Ga0307509_10030443
1211 Ga0307509_10064009
1212 Ga0307509_10139159
1213 Ga0307509_10214130
1214 Ga0307508_10000227
1215 Ga0307508_10038562
1216 Ga0307514_10001840
1217 Ga0307514_10077945
1218 Ga0307514_10100606
1219 Ga0307516_10000312
1220 Ga0307516_10000497
1221 Ga0307516_10004946
1222 Ga0307516_10005605
1223 Ga0307516_10350336
1224 Ga0307405_10006547
1225 Ga0307413_10094755
1226 Ga0307410_10009817
1227 Ga0307406_10034996
1228 Ga0307407_10101551
1229 Ga0307412_10018914
1230 Ga0307409_100094217
1231 Ga0307409_100255757
1232 Ga0307416_100088088
1233 Ga0307416_100158615
1234 Ga0307411_10048663
1235 Ga0307507_10040065
1236 Ga0307510_10020701
1237 Ga0307510_10026627
1238 Ga0307510_10100095
1239 Ga0307510_10105002
1240 Ga0373953_0051288
1241 Ga0373943_0031464
1242 Ga0373924_0062125
1243 Ga0373931_0033207
1244 Ga0373935_0224379
1245 Ga0373927_0266747
1246 Ga0373933_0332096
1247 Ga0373947_0028227
1248 Ga0373937_0028691
1249 Ga0373937_0075115
1250 Ga0373937_0134894
1251 Ga0395900_0572842
1252 Ga0395900_0966104
1253 Ga0395898_0060715
1254 Ga0395905_0000431
1255 Ga0395905_0013446
1256 Ga0395905_0016819
1257 Ga0395905_0017199
1258 Ga0395905_0022443
1259 Ga0395905_0188665
1260 Ga0395905_0235876
1261 Ga0395905_0398234
1262 Ga0436361_0537689
1263 Ga0436361_0552361
1264 Ga0439439_0055533
1265 Ga0451789_0966433
1266 Ga0451791_0680598
1267 Ga0451793_0607649
1268 Ga0451793_1038358
1269 Ga0451793_1656761
1270 Ga0451797_0679364
1271 Ga0451807_1925146
1272 Ga0451835_1076998
1273 Ga0451839_0531012
1274 Ga0451851_0230368
1275 Ga0451853_1613797
1276 Ga0450911_003584
1277 Ga0450919_000514
1278 Ga0439459_0015933
1279 Ga0450918_000377
1280 Ga0450893_0009216
1281 Ga0451577_0356691
1282 Ga0451577_0403684
1283 Ga0466969_0109207
1284 Ga0466965_0243806
1285 Ga0466961_0112239
1286 Ga0466964_0002777
1287 Ga0453684_0703456
1288 Ga0466971_0015449
1289 Ga0466968_0314042
1290 Ga0466970_0087113
1291 Ga0466959_0015984
1292 Ga0451576_0114403
1293 Ga0495592_0000028
1294 Ga0495590_0007405
1295 Ga0495629_0069203
1296 Ga0495638_0054568
1297 Ga0495638_0235906
1298 Ga0495610_0053593
1299 Ga0495610_0095059
1300 Ga0495616_0090863
1301 Ga0495618_0192528
1302 Ga0495620_0059119
1303 Ga0495628_0380886
1304 Ga0495628_0528178
1305 Ga0495630_0047998
1306 Ga0495632_0007745
1307 Ga0495632_0055676
1308 Ga0495632_0179215
1309 Ga0495666_0036781
1310 Ga0495654_0022190
1311 Ga0495621_0005578
1312 Ga0495621_0054314
1313 Ga0495621_0066745
1314 Ga0495621_0157671
1315 Ga0495621_0198156
1316 Ga0495597_0108459
1317 Ga0495645_0067784
1318 Ga0495645_0156318
1319 Ga0495645_0425101
1320 Ga0495622_0242412
1321 Ga0495625_0019171
1322 Ga0495625_0022014
1323 Ga0495625_0156033
1324 Ga0495625_0453014
1325 Ga0495635_0563347
1326 Ga0495646_0084859
1327 Ga0495647_0216216
1328 Ga0495658_0129338
1329 Ga0495658_0145588
1330 Ga0495613_0219569
1331 Ga0495624_0053869
1332 Ga0495671_0133351
1333 Ga0495649_0004724
1334 Ga0495660_0105785
1335 Ga0495674_0278914
1336 Ga0495687_000594
1337 Ga0495687_005079
1338 Ga0495687_006945
1339 Ga0495684_0138480
1340 Ga0495684_0339469
1341 Ga0495686_0001297
1342 Ga0495593_0029380
1343 Ga0495626_0026314
1344 Ga0496104_0272846
1345 Ga0496105_0272040
1346 Ga0496106_0351541
1347 Ga0496108_0273204
1348 Ga0496109_0128519
1349 Ga0496110_0235992
1350 Ga0496114_0013197
1351 Ga0496121_0018535
1352 Ga0496121_0026536
1353 Ga0496124_0000317
1354 Ga0496124_0136939
1355 Ga0496124_0639209
1356 Ga0496125_0022403
1357 Ga0496125_0060586
1358 Ga0496125_0080252
1359 Ga0496125_0145801
1360 Ga0496125_0199471
1361 Ga0495682_0079819
1362 Ga0501292_010355
1363 Ga0501043_0000004
1364 Ga0501046_0000016
1365 Ga0501047_0000012
1366 Ga0501048_0035397
1367 Ga0501252_007397
1368 Ga0501035_0207821
1369 Ga0501045_0192075
1370 nmdc:mga03683_149396_c1
1371 nmdc:mga03683_358208_c1
1372 nmdc:mga03683_9019_c1
1373 nmdc:mga03n38_307349_c1
1374 nmdc:mga03n38_326475_c1
1375 nmdc:mga03n38_72335_c1
1376 nmdc:mga00v17_256147_c1
1377 nmdc:mga0yw44_47259_c1
1378 nmdc:mga0k408_106001_c1
1379 nmdc:mga0k408_14932_c1
1380 nmdc:mga0k408_161057_c1
1381 nmdc:mga0k408_24186_c1
1382 nmdc:mga0k408_25980_c1
1383 nmdc:mga0k408_34475_c1
1384 nmdc:mga0k408_41741_c1
1385 nmdc:mga0k408_570007_c1
1386 nmdc:mga0k408_66956_c1
1387 nmdc:mga0k408_83039_c1
1388 nmdc:mga0k408_8818_c1
1389 nmdc:mga0k408_9344_c1
1390 nmdc:mga06z11_110420_c1
1391 nmdc:mga06z11_123658_c1
1392 nmdc:mga06z11_248091_c1
1393 nmdc:mga04h51_40466_c1
1394 nmdc:mga04h51_70965_c1
1395 nmdc:mga07m45_167580_c1
1396 nmdc:mga07m45_192112_c1
1397 nmdc:mga07m45_219578_c1
1398 nmdc:mga07m45_2993_c2
1399 nmdc:mga07m45_35470_c1
1400 nmdc:mga07m45_408656_c1
1401 nmdc:mga07m45_436225_c1
1402 nmdc:mga07m45_68110_c1
1403 nmdc:mga07m45_9585_c1
1404 nmdc:mga0sz30_3098_c1
1405 Ga0495601_0299709
1406 Ga0495612_0257763
1407 Ga0495595_0089668
1408 Ga0495619_0476371
1409 Ga0500578_0000282
1410 Ga0500578_0035984
1411 Ga0500644_0055142
1412 Ga0500646_0001831
1413 Ga0500647_0056143
1414 Ga0500651_0013178
1415 Ga0500651_0079698
1416 Ga0500651_0389613
1417 Ga0500650_0065740
1418 Ga0500650_0139505
1419 Ga0500569_023259
1420 Ga0500607_115033
1421 Ga0500623_120745
1422 Ga0500642_0000652
1423 Ga0500652_000492
1424 Ga0500658_0008541
1425 Ga0500559_0017642
1426 Ga0500559_0133526
1427 Ga0500568_0028846
1428 Ga0500568_0053545
1429 Ga0500568_0072439
1430 Ga0500590_020753
1431 Ga0500604_0003349
1432 Ga0500604_0116829
1433 Ga0500619_000180
1434 Ga0500622_0000202
1435 Ga0500622_0043686
1436 Ga0500622_0081863
1437 Ga0500634_0088639
1438 Ga0500636_0077845
1439 Ga0500645_002406
1440 Ga0500587_000298
1441 Ga0466962_0002769
1442 2587730558
1443 2587734918
1444 2588293137
1445 2643968359
1446 2644141849
1447 2644245713
1448 2644272482
1449 2644304273
1450 2644338342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04973

NMN_transporter

Nicotinamide mononucleotide transporter

34

214

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4qtn-assembly1.cif.gz_B crystal structure of the vitamin b3 transporter pnuc 0.8279 25 205
4qtn-assembly1.cif.gz_B crystal structure of the vitamin b3 transporter pnuc 0.7184 25 205
2chp-assembly1.cif.gz_A crystal structure of the dodecameric ferritin mrga from b. subtilis 168 0.4633 111 204
3t9j-assembly1.cif.gz_A-4 crystal structure hp-nap from strain ys39 in apo form 0.4549 113 205
3t9j-assembly1.cif.gz_A-2 crystal structure hp-nap from strain ys39 in apo form 0.4549 113 205
ID Description Score Start End Superfamily
af_D3ZYP5_7_123_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5512 108 196 1.20.120.550
af_Q54UQ6_235_311_1.20.1280.20 Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain 0.5421 105 204 1.20.1280.20
af_E1JH38_1_134_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.528 110 205 1.20.140.150
af_Q54K44_8_93_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5184 109 203 1.20.1280.290
af_Q9VUN8_10_99_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5153 107 210 1.20.1280.290
ID Description Score Start End GO Terms
AF-J2KBV2-F1-model_v4 Nicotinamide riboside transporter PnuC 0.991 6 207 GO:0005886
GO:0034257
AF-A0A257JKJ3-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9873 1 205 GO:0005886
GO:0034257
AF-A0A4R1ZLJ2-F1-model_v4 deleted 0.9743 17 209
AF-A2SJR4-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9597 2 205 GO:0005886
GO:0034257
AF-A0A257JKJ3-F1-model_v4 Nicotinamide riboside transporter PnuC 0.9595 1 205 GO:0005886
GO:0034257

Map