F477604

General Info

Members Datasets Scaffolds Average Seq Length
725 409 1450 511

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100022808|Ga0070698_1000228081
Length 557
Sequence MITLSTRFYGLRMNLRSATCGRNYETRRSEAEPLWQPEDKSVRLTDYLDKGASLGAEAPCLTAGGRTLSYGDVQALSWRIARXXXXSRIRPGDKVAILSANDPVAFSCVFGISRAGAVWCPVNPRNEAAENRDLLDFFDCTCLIFQAAFAPLVTKILPDLPKLTTLVCLDGEHPSATPFGQWLADLPGEPWQAEPPDDLVMLVGTGGTTGRPKGVMLTGHNIETMSALTLMSYPFRPRPRYLALAPLTHAAGVLCFPVMTLGGEIVIMPKPDLAEFLSLIEKYKITHTFLPPTLIYLLLDHPALRAADLASLQCLWYGAAPMSAARLTEALAKIGPVMGQLFGQSEAPMMISTMAPADHFREDGSLAEERLSSAGRPTPLTTVAIMDDEGHLLGPGQRGEIVARGPLVMAGYYKNPQASAEAARYGWHHTGDIGYLDEDNYLFIVDRAKDMIITGGFNVYSAEVEQVLLAHPAVQDCAVVGLPDEKWGERVTAVVQLRPGQTVTEDEVRSFVKERLGSVKAPKQVEVWPDLPRSKVGKVLKVDVKAQLRAGESAQSR

Samples

Sample ID Description Type Environment
1 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
166 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
175 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
187 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
205 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
217 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
218 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
233 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
234 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
244 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
245 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
246 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
247 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
248 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
249 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
255 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
258 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
259 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
267 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
272 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
275 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
278 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
302 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
303 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
304 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
316 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
317 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
318 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
319 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
322 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
323 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
324 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
333 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
334 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
335 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
338 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
339 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
340 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
341 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
342 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
343 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
344 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
345 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
346 2643221561 Nocardioides sp. Root151 Isolate Unclassified
347 2643221576 Nocardioides sp. Root614 Isolate Unclassified
348 2643221590 Nocardioides sp. Root682 Isolate Unclassified
349 2643221604 Nocardioides sp. Root190 Isolate Unclassified
350 2643221615 Nocardioides sp. Root224 Isolate Unclassified
351 2643221617 Nocardioides sp. Root79 Isolate Unclassified
352 2643221620 Nocardioides sp. Root240 Isolate Unclassified
353 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
354 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
355 2643221683 Variovorax sp. Root473 Isolate Unclassified
356 2643221696 Nocardioides sp. Root140 Isolate Unclassified
357 2738541305 Nocardioides sp. CF167 Isolate Unclassified
358 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
359 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
360 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
361 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
362 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
363 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
364 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
365 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
366 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
367 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
368 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
369 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
370 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
371 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
372 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
373 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
374 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
375 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
376 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
377 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
378 2885198086 Variovorax sp. 679 Isolate Unclassified
379 2885211737 Variovorax sp. 553 Isolate Unclassified
380 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
381 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
382 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
383 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
384 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
385 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
386 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
387 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
388 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
389 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
390 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
391 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
392 2922554459 Rhodococcus sp. 66b Isolate Unclassified
393 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
394 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
395 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
396 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
397 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
398 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
399 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
400 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
401 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
402 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
403 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
404 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
405 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
406 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
407 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
408 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
409 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.07
Metatranscriptomes 0.41
Isolates 9.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.41
Bulb 0
Endosphere 4.97
Nodule 0.97
Rhizoplane 8.41
Rhizosphere 73.66
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070698_100022808 3300005471 Bacteria 6544
2 JGI24736J21556_1000082 3300001904 Bacteria 15646
3 JGI24740J21852_10003927 3300001979 Bacteria 6454
4 JGI24739J22299_10005208 3300001989 Bacteria 4956
5 JGI24735J21928_10006642 3300002067 Bacteria 3799
6 JGI24738J21930_10008269 3300002075 Bacteria 2369
7 JGI25407J50210_10003955 3300003373 Bacteria 3588
8 JGI25404J52841_10000235 3300003659 Bacteria 6918
9 Ga0055530_10000093 3300003791 Bacteria 77624
10 Ga0055530_10000104 3300003791 Bacteria 72163
11 Ga0055540_1007428 3300003792 Bacteria 4136
12 Ga0055531_10000432 3300003794 Bacteria 39735
13 Ga0055531_10002055 3300003794 Bacteria 13881
14 Ga0070683_100002702 3300005329 Bacteria 14166
15 Ga0070683_100010116 3300005329 Bacteria 8093
16 Ga0070683_100013188 3300005329 Bacteria 7198
17 Ga0070683_100032144 3300005329 Bacteria 4776
18 Ga0070683_100075807 3300005329 Bacteria 3143
19 Ga0068869_100009568 3300005334 Bacteria 6293
20 Ga0068869_100071657 3300005334 Bacteria 2566
21 Ga0068869_100077878 3300005334 Bacteria 2468
22 Ga0070666_10014340 3300005335 Bacteria 5045
23 Ga0070666_10029643 3300005335 Bacteria 3599
24 Ga0070682_100057762 3300005337 Bacteria 2446
25 Ga0070682_100067088 3300005337 Bacteria 2284
26 Ga0070682_100101305 3300005337 Bacteria 1902
27 Ga0068868_100037250 3300005338 Bacteria 3769
28 Ga0070687_100019362 3300005343 Bacteria 3164
29 Ga0070661_100030912 3300005344 Bacteria 3870
30 Ga0070668_100000425 3300005347 Bacteria 27984
31 Ga0070668_100039888 3300005347 Bacteria 3591
32 Ga0070668_100071753 3300005347 Bacteria 2698
33 Ga0070675_100053540 3300005354 Bacteria 3319
34 Ga0070675_100196275 3300005354 Bacteria 1751
35 Ga0070671_100013148 3300005355 Bacteria 6668
36 Ga0070671_100050494 3300005355 Bacteria 3459
37 Ga0070674_100041183 3300005356 Bacteria 3128
38 Ga0070673_100047366 3300005364 Bacteria 3345
39 Ga0070688_100064672 3300005365 Bacteria 2322
40 Ga0070659_100004221 3300005366 Bacteria 10260
41 Ga0070659_100058748 3300005366 Bacteria 3036
42 Ga0070667_100041269 3300005367 Bacteria 3871
43 Ga0070667_100233722 3300005367 Bacteria 1640
44 Ga0070703_10010202 3300005406 Bacteria 2648
45 Ga0070709_10021541 3300005434 Bacteria 3755
46 Ga0070714_100021486 3300005435 Bacteria 5281
47 Ga0070714_100182209 3300005435 Bacteria 1912
48 Ga0070713_100057549 3300005436 Bacteria 3238
49 Ga0070710_10007207 3300005437 Bacteria 5374
50 Ga0070711_100003971 3300005439 Bacteria 8693
51 Ga0070711_100029686 3300005439 Bacteria 3611
52 Ga0070711_100076887 3300005439 Bacteria 2367
53 Ga0070705_100020353 3300005440 Bacteria 3509
54 Ga0070694_100009061 3300005444 Bacteria 6100
55 Ga0070694_100113622 3300005444 Bacteria 1932
56 Ga0070708_100016030 3300005445 Bacteria 6207
57 Ga0070708_100055574 3300005445 Bacteria 3520
58 Ga0070708_100072383 3300005445 Bacteria 3106
59 Ga0070708_100143161 3300005445 Bacteria 2218
60 Ga0070663_100005868 3300005455 Bacteria 7340
61 Ga0070678_100039449 3300005456 Bacteria 3332
62 Ga0070662_100020261 3300005457 Bacteria 4526
63 Ga0070662_100022891 3300005457 Bacteria 4285
64 Ga0070662_100042699 3300005457 Bacteria 3240
65 Ga0070685_10018383 3300005466 Bacteria 3758
66 Ga0070685_10071439 3300005466 Bacteria 2058
67 Ga0070685_10086558 3300005466 Bacteria 1890
68 Ga0070706_100001943 3300005467 Bacteria 21303
69 Ga0070706_100033486 3300005467 Bacteria 4742
70 Ga0070706_100150348 3300005467 Bacteria 2173
71 Ga0070707_100011160 3300005468 Bacteria 8372
72 Ga0070707_100015242 3300005468 Bacteria 7213
73 Ga0070707_100080783 3300005468 Bacteria 3138
74 Ga0070698_100001126 3300005471 Bacteria 29553
75 Ga0070698_100004906 3300005471 Bacteria 14675
76 Ga0070698_100005767 3300005471 Bacteria 13540
77 Ga0070699_100002453 3300005518 Bacteria 16669
78 Ga0070699_100011087 3300005518 Bacteria 7792
79 Ga0070679_100024686 3300005530 Bacteria 5891
80 Ga0070679_100048194 3300005530 Bacteria 4246
81 Ga0070684_100003428 3300005535 Bacteria 11910
82 Ga0070697_100003236 3300005536 Bacteria 12501
83 Ga0070672_100041287 3300005543 Bacteria 3546
84 Ga0070672_100148817 3300005543 Bacteria 1936
85 Ga0070696_100017808 3300005546 Bacteria 4796
86 Ga0070665_100000011 3300005548 Bacteria 525539
87 Ga0070665_100000596 3300005548 Bacteria 50215
88 Ga0070665_100004605 3300005548 Bacteria 14422
89 Ga0070665_100072533 3300005548 Bacteria 3450
90 Ga0068855_100000032 3300005563 Bacteria 168335
91 Ga0070664_100001201 3300005564 Bacteria 20631
92 Ga0070664_100006782 3300005564 Bacteria 9232
93 Ga0070664_100085635 3300005564 Bacteria 2722
94 Ga0068857_100023384 3300005577 Bacteria 5441
95 Ga0068857_100028137 3300005577 Bacteria 4958
96 Ga0068857_100041684 3300005577 Bacteria 4070
97 Ga0068857_100042508 3300005577 Bacteria 4033
98 Ga0068857_100081984 3300005577 Bacteria 2881
99 Ga0068857_100127933 3300005577 Bacteria 2289
100 Ga0068856_100013762 3300005614 Bacteria 7821
101 Ga0068859_100109284 3300005617 Bacteria 2826
102 Ga0068864_100143672 3300005618 Bacteria 2155
103 Ga0068866_10034919 3300005718 Bacteria 2452
104 Ga0068866_10057655 3300005718 Bacteria 2002
105 Ga0068861_100021704 3300005719 Bacteria 4616
106 Ga0068851_10061692 3300005834 Bacteria 1922
107 Ga0068870_10008775 3300005840 Bacteria 4560
108 Ga0068870_10054071 3300005840 Bacteria 2134
109 Ga0068870_10097947 3300005840 Bacteria 1651
110 Ga0068863_100034139 3300005841 Bacteria 4846
111 Ga0068863_100054372 3300005841 Bacteria 3793
112 Ga0068863_100069141 3300005841 Bacteria 3339
113 Ga0068863_100071883 3300005841 Bacteria 3273
114 Ga0068858_100002113 3300005842 Bacteria 20168
115 Ga0068858_100032909 3300005842 Bacteria 4814
116 Ga0068858_100047466 3300005842 Bacteria 3980
117 Ga0068862_100022922 3300005844 Bacteria 5227
118 Ga0068862_100027619 3300005844 Bacteria 4778
119 Ga0081455_10000724 3300005937 Bacteria 42797
120 Ga0081455_10084898 3300005937 Bacteria 2583
121 Ga0081538_10004167 3300005981 Bacteria 13420
122 Ga0081540_1000528 3300005983 Bacteria 37260
123 Ga0081539_10000999 3300005985 Bacteria 52497
124 Ga0081539_10005615 3300005985 Bacteria 12628
125 Ga0081539_10007595 3300005985 Bacteria 9797
126 Ga0070717_10039004 3300006028 Bacteria 3863
127 Ga0075365_10009286 3300006038 Bacteria 5642
128 Ga0075368_10004625 3300006042 Bacteria 4680
129 Ga0075363_100035372 3300006048 Bacteria 2613
130 Ga0075364_10006473 3300006051 Bacteria 6882
131 Ga0070715_10020379 3300006163 Bacteria 2557
132 Ga0070715_10047190 3300006163 Bacteria 1835
133 Ga0070712_100005558 3300006175 Bacteria 7802
134 Ga0070712_100006558 3300006175 Bacteria 7224
135 Ga0070712_100010785 3300006175 Bacteria 5777
136 Ga0075367_10064425 3300006178 Bacteria 2192
137 Ga0068871_100020061 3300006358 Bacteria 5115
138 Ga0068871_100095675 3300006358 Bacteria 2480
139 Ga0075430_100067423 3300006846 Bacteria 3004
140 Ga0075431_100032592 3300006847 Bacteria 5369
141 Ga0075433_10053485 3300006852 Bacteria 3521
142 Ga0075429_100003204 3300006880 Bacteria 13921
143 Ga0075429_100021787 3300006880 Bacteria 5556
144 Ga0097620_100109284 3300006931 Bacteria 2826
145 Ga0075435_100026319 3300007076 Bacteria 4536
146 Ga0105240_10180463 3300009093 Bacteria 2492
147 Ga0111539_10000515 3300009094 Bacteria 49121
148 Ga0111539_10089136 3300009094 Bacteria 3625
149 Ga0105245_10000529 3300009098 Bacteria 35001
150 Ga0105245_10020906 3300009098 Bacteria 5738
151 Ga0105245_10072319 3300009098 Bacteria 3132
152 Ga0105247_10011549 3300009101 Bacteria 5319
153 Ga0114129_10028864 3300009147 Bacteria 7860
154 Ga0105243_10047640 3300009148 Bacteria 3376
155 Ga0105242_10051819 3300009176 Bacteria 3346
156 Ga0105237_10069511 3300009545 Bacteria 3517
157 Ga0105238_10080063 3300009551 Bacteria 3256
158 Ga0105238_10103866 3300009551 Bacteria 2823
159 Ga0105238_10163190 3300009551 Bacteria 2204
160 Ga0105249_10022755 3300009553 Bacteria 5617
161 Ga0105249_10170644 3300009553 Bacteria 2109
162 Ga0105239_10258978 3300010375 Bacteria 1955
163 Ga0105246_10004077 3300011119 Bacteria 8872
164 Ga0105246_10038778 3300011119 Bacteria 3205
165 Ga0157342_1001046 3300012507 Bacteria 1928
166 Ga0157370_10029089 3300013104 Bacteria 5428
167 Ga0157369_10003669 3300013105 Bacteria 18233
168 Ga0157369_10033051 3300013105 Bacteria 5686
169 Ga0157369_10071413 3300013105 Bacteria 3727
170 Ga0157374_10073628 3300013296 Bacteria 3224
171 Ga0157374_10153738 3300013296 Bacteria 2238
172 Ga0157378_10154159 3300013297 Bacteria 2143
173 Ga0163162_10112126 3300013306 Bacteria 2826
174 Ga0157372_10080788 3300013307 Bacteria 3679
175 Ga0157372_10196199 3300013307 Bacteria 2338
176 Ga0157375_10033927 3300013308 Bacteria 4856
177 Ga0157375_10037218 3300013308 Bacteria 4660
178 Ga0157375_10106674 3300013308 Bacteria 2893
179 Ga0157375_10138891 3300013308 Bacteria 2555
180 Ga0157380_10047068 3300014326 Bacteria 3390
181 Ga0157377_10011005 3300014745 Bacteria 4499
182 Ga0157377_10065040 3300014745 Bacteria 2094
183 Ga0157379_10018288 3300014968 Bacteria 6176
184 Ga0157379_10048224 3300014968 Bacteria 3802
185 Ga0157376_10020114 3300014969 Bacteria 5158
186 Ga0157376_10103403 3300014969 Bacteria 2494
187 Ga0163161_10023742 3300017792 Bacteria 4328
188 Ga0206356_11380849 3300020070 Bacteria 2669
189 Ga0206354_10770736 3300020081 Bacteria 3699
190 Ga0214544_1000056 3300021320 Bacteria 132760
191 Ga0213875_10001633 3300021388 Bacteria 14154
192 Ga0209147_100368 3300025229 Bacteria 32053
193 Ga0209675_1000132 3300025291 Bacteria 102062
194 Ga0209676_1000085 3300025292 Bacteria 273425
195 Ga0209676_1000118 3300025292 Bacteria 201939
196 Ga0209676_1001329 3300025292 Bacteria 25002
197 Ga0209050_1000115 3300025298 Bacteria 204622
198 Ga0207426_1007082 3300025302 Bacteria 4744
199 Ga0209051_1000413 3300025303 Bacteria 59027
200 Ga0209051_1011091 3300025303 Bacteria 4480
201 Ga0209257_1000160 3300025304 Bacteria 177175
202 Ga0209257_1000482 3300025304 Bacteria 72375
203 Ga0209257_1006194 3300025304 Bacteria 7853
204 Ga0207656_10053774 3300025321 Bacteria 1748
205 Ga0207653_10002294 3300025885 Bacteria 6104
206 Ga0207653_10015836 3300025885 Bacteria 2367
207 Ga0207692_10006037 3300025898 Bacteria 4897
208 Ga0207692_10008808 3300025898 Bacteria 4192
209 Ga0207692_10020664 3300025898 Bacteria 3000
210 Ga0207688_10000995 3300025901 Bacteria 14450
211 Ga0207688_10012849 3300025901 Bacteria 4552
212 Ga0207688_10014437 3300025901 Bacteria 4294
213 Ga0207688_10080432 3300025901 Bacteria 1860
214 Ga0207680_10029174 3300025903 Bacteria 3096
215 Ga0207647_10003799 3300025904 Bacteria 11286
216 Ga0207647_10030334 3300025904 Bacteria 3489
217 Ga0207699_10004882 3300025906 Bacteria 6418
218 Ga0207699_10006490 3300025906 Bacteria 5669
219 Ga0207699_10046955 3300025906 Bacteria 2529
220 Ga0207645_10032768 3300025907 Bacteria 3340
221 Ga0207643_10054170 3300025908 Bacteria 2279
222 Ga0207643_10063681 3300025908 Bacteria 2109
223 Ga0207684_10002895 3300025910 Bacteria 17010
224 Ga0207684_10096748 3300025910 Bacteria 2520
225 Ga0207671_10001110 3300025914 Bacteria 32453
226 Ga0207693_10001394 3300025915 Bacteria 21405
227 Ga0207693_10003334 3300025915 Bacteria 13739
228 Ga0207693_10008049 3300025915 Bacteria 8652
229 Ga0207693_10016153 3300025915 Bacteria 5971
230 Ga0207693_10021512 3300025915 Bacteria 5124
231 Ga0207663_10002702 3300025916 Bacteria 8555
232 Ga0207662_10012788 3300025918 Bacteria 4682
233 Ga0207662_10024763 3300025918 Bacteria 3454
234 Ga0207657_10006877 3300025919 Bacteria 11737
235 Ga0207657_10020250 3300025919 Bacteria 6293
236 Ga0207657_10056571 3300025919 Bacteria 3384
237 Ga0207657_10061524 3300025919 Bacteria 3218
238 Ga0207652_10005615 3300025921 Bacteria 10176
239 Ga0207646_10005267 3300025922 Bacteria 13639
240 Ga0207646_10006511 3300025922 Bacteria 12055
241 Ga0207659_10027441 3300025926 Bacteria 3855
242 Ga0207687_10102872 3300025927 Bacteria 2105
243 Ga0207687_10166833 3300025927 Bacteria 1695
244 Ga0207700_10013193 3300025928 Bacteria 5366
245 Ga0207700_10017788 3300025928 Bacteria 4756
246 Ga0207700_10028349 3300025928 Bacteria 3935
247 Ga0207700_10067357 3300025928 Bacteria 2740
248 Ga0207664_10010087 3300025929 Bacteria 6658
249 Ga0207664_10032123 3300025929 Bacteria 4022
250 Ga0207644_10014395 3300025931 Bacteria 5291
251 Ga0207706_10009888 3300025933 Bacteria 8748
252 Ga0207706_10017955 3300025933 Bacteria 6367
253 Ga0207706_10027818 3300025933 Bacteria 5054
254 Ga0207706_10035702 3300025933 Bacteria 4418
255 Ga0207706_10065345 3300025933 Bacteria 3203
256 Ga0207706_10145110 3300025933 Bacteria 2088
257 Ga0207709_10082687 3300025935 Bacteria 2074
258 Ga0207670_10015775 3300025936 Bacteria 4523
259 Ga0207665_10001604 3300025939 Bacteria 15248
260 Ga0207665_10002187 3300025939 Bacteria 13215
261 Ga0207665_10006158 3300025939 Bacteria 7967
262 Ga0207665_10011024 3300025939 Bacteria 5934
263 Ga0207665_10067307 3300025939 Bacteria 2439
264 Ga0207665_10111621 3300025939 Bacteria 1922
265 Ga0207691_10045389 3300025940 Bacteria 4039
266 Ga0207711_10034870 3300025941 Bacteria 4262
267 Ga0207689_10025359 3300025942 Bacteria 4969
268 Ga0207689_10088384 3300025942 Bacteria 2545
269 Ga0207661_10085376 3300025944 Bacteria 2616
270 Ga0207667_10012779 3300025949 Bacteria 9644
271 Ga0207651_10036222 3300025960 Bacteria 3219
272 Ga0207668_10001956 3300025972 Bacteria 12053
273 Ga0207658_10032959 3300025986 Bacteria 3692
274 Ga0207677_10042210 3300026023 Bacteria 3023
275 Ga0207677_10068782 3300026023 Bacteria 2487
276 Ga0207703_10001637 3300026035 Bacteria 20186
277 Ga0207639_10122657 3300026041 Bacteria 2137
278 Ga0207678_10010983 3300026067 Bacteria 7954
279 Ga0207678_10011222 3300026067 Bacteria 7870
280 Ga0207678_10015276 3300026067 Bacteria 6753
281 Ga0207678_10019597 3300026067 Bacteria 5946
282 Ga0207678_10052876 3300026067 Bacteria 3502
283 Ga0207678_10055042 3300026067 Bacteria 3426
284 Ga0207678_10069896 3300026067 Bacteria 3010
285 Ga0207678_10099774 3300026067 Bacteria 2480
286 Ga0207708_10021659 3300026075 Bacteria 4848
287 Ga0207702_10001744 3300026078 Bacteria 21387
288 Ga0207702_10011750 3300026078 Bacteria 7294
289 Ga0207641_10013183 3300026088 Bacteria 6778
290 Ga0207641_10101803 3300026088 Bacteria 2532
291 Ga0207676_10189753 3300026095 Bacteria 1807
292 Ga0207674_10034983 3300026116 Bacteria 5245
293 Ga0207674_10035385 3300026116 Bacteria 5211
294 Ga0207674_10037641 3300026116 Bacteria 5029
295 Ga0207674_10052862 3300026116 Bacteria 4142
296 Ga0207674_10056821 3300026116 Bacteria 3971
297 Ga0207674_10080075 3300026116 Bacteria 3270
298 Ga0207674_10083033 3300026116 Bacteria 3203
299 Ga0207675_100032639 3300026118 Bacteria 4850
300 Ga0207675_100043257 3300026118 Bacteria 4207
301 Ga0207675_100149280 3300026118 Bacteria 2224
302 Ga0207683_10023161 3300026121 Bacteria 5337
303 Ga0207683_10052256 3300026121 Bacteria 3580
304 Ga0207683_10090274 3300026121 Bacteria 2728
305 Ga0207683_10139381 3300026121 Bacteria 2185
306 Ga0207428_10053149 3300027907 Bacteria 3231
307 Ga0268266_10000063 3300028379 Bacteria 253339
308 Ga0268266_10005453 3300028379 Bacteria 11853
309 Ga0268266_10029429 3300028379 Bacteria 4669
310 Ga0268265_10101647 3300028380 Bacteria 2323
311 Ga0265337_1003142 3300028556 Bacteria 7273
312 Ga0265336_10003485 3300028666 Bacteria 6156
313 Ga0307515_10000456 3300028794 Bacteria 97538
314 Ga0307515_10036149 3300028794 Bacteria 8004
315 Ga0307515_10046075 3300028794 Bacteria 6678
316 Ga0307515_10103950 3300028794 Bacteria 3399
317 Ga0265338_10004224 3300028800 Bacteria 19552
318 Ga0265338_10005162 3300028800 Bacteria 17168
319 Ga0265324_10002929 3300029957 Bacteria 8367
320 Ga0307512_10007181 3300030522 Bacteria 11085
321 Ga0307512_10008020 3300030522 Bacteria 10360
322 Ga0265332_10014040 3300031238 Bacteria 3543
323 Ga0265320_10000584 3300031240 Bacteria 28109
324 Ga0265320_10000631 3300031240 Bacteria 26946
325 Ga0265320_10023782 3300031240 Bacteria 3253
326 Ga0265325_10079709 3300031241 Bacteria 1629
327 Ga0307513_10001838 3300031456 Bacteria 30130
328 Ga0307513_10004469 3300031456 Bacteria 18672
329 Ga0307509_10047050 3300031507 Bacteria 4641
330 Ga0265313_10020736 3300031595 Bacteria 3617
331 Ga0307508_10002212 3300031616 Bacteria 20747
332 Ga0307508_10019006 3300031616 Bacteria 6243
333 Ga0307508_10026744 3300031616 Bacteria 5229
334 Ga0316579_10011725 3300031691 Bacteria 3733
335 Ga0265314_10001042 3300031711 Bacteria 32320
336 Ga0265342_10013750 3300031712 Bacteria 5406
337 Ga0307518_10002915 3300031838 Bacteria 12420
338 Ga0307412_10013256 3300031911 Bacteria 4826
339 Ga0307409_100011709 3300031995 Bacteria 5548
340 Ga0307409_100105678 3300031995 Bacteria 2348
341 Ga0307409_100141808 3300031995 Bacteria 2072
342 Ga0307409_100159216 3300031995 Bacteria 1972
343 Ga0307414_10003714 3300032004 Bacteria 8186
344 Ga0307414_10182977 3300032004 Bacteria 1687
345 Ga0307415_100003630 3300032126 Bacteria 7889
346 Ga0307415_100161534 3300032126 Bacteria 1737
347 Ga0307507_10004675 3300033179 Bacteria 23774
348 Ga0307507_10047549 3300033179 Bacteria 4187
349 Ga0307510_10003235 3300033180 Bacteria 18933
350 Ga0307510_10025725 3300033180 Bacteria 6782
351 Ga0307510_10040826 3300033180 Bacteria 5084
352 Ga0373926_0001284 3300035083 Bacteria 7557
353 Ga0373923_0014478 3300035111 Bacteria 2963
354 Ga0373936_0002046 3300035113 Bacteria 7472
355 Ga0373936_0011727 3300035113 Bacteria 3324
356 Ga0373945_0000375 3300035116 Bacteria 12851
357 Ga0373953_0015437 3300035117 Bacteria 2768
358 Ga0373953_0022533 3300035117 Bacteria 2376
359 Ga0373953_0031235 3300035117 Bacteria 2070
360 Ga0373956_0000970 3300035119 Bacteria 11908
361 Ga0373956_0009086 3300035119 Bacteria 4030
362 Ga0373957_0014511 3300035120 Bacteria 2694
363 Ga0373960_0013726 3300035121 Bacteria 2039
364 Ga0373943_0000129 3300035170 Bacteria 28679
365 Ga0373943_0001180 3300035170 Bacteria 11664
366 Ga0373946_0000242 3300035171 Bacteria 17204
367 Ga0373946_0002798 3300035171 Bacteria 6168
368 Ga0373955_0005820 3300035172 Bacteria 5567
369 Ga0373955_0050635 3300035172 Bacteria 2259
370 Ga0373924_0000750 3300035410 Bacteria 10109
371 Ga0373924_0004493 3300035410 Bacteria 4877
372 Ga0373924_0021296 3300035410 Bacteria 2527
373 Ga0373935_0014178 3300035692 Unclassified 4809
374 Ga0373935_0014651 3300035692 Bacteria 4731
375 Ga0373935_0021142 3300035692 Bacteria 3983
376 Ga0373927_0003873 3300035695 Bacteria 10609
377 Ga0373933_0015835 3300035724 Bacteria 4208
378 Ga0373933_0020652 3300035724 Bacteria 3733
379 Ga0373947_0001856 3300035725 Bacteria 12880
380 Ga0373947_0015165 3300035725 Bacteria 4424
381 Ga0373947_0068144 3300035725 Bacteria 2175
382 Ga0372808_002217 3300036459 Bacteria 2200
383 Ga0316584_0022151 3300036712 Unclassified 4631
384 Ga0373925_0000177 3300037068 Bacteria 69605
385 Ga0373925_0003615 3300037068 Bacteria 11916
386 Ga0373925_0032872 3300037068 Bacteria 3820
387 Ga0373925_0082139 3300037068 Bacteria 2452
388 Ga0373925_0142407 3300037068 Bacteria 1877
389 Ga0395899_0000091 3300037312 Bacteria 154780
390 Ga0395900_0000008 3300037418 Bacteria 480459
391 Ga0395898_0002459 3300037466 Bacteria 21851
392 Ga0395898_0017952 3300037466 Bacteria 7218
393 Ga0395898_0058182 3300037466 Bacteria 3764
394 Ga0395898_0074973 3300037466 Bacteria 3268
395 Ga0395905_0046457 3300037471 Bacteria 4071
396 Ga0436364_0103177 3300037853 Bacteria 67977
397 Ga0436364_0764299 3300037853 Bacteria 2189
398 Ga0436364_1261928 3300037853 Bacteria 13312
399 Ga0395901_0000008 3300038443 Bacteria 495962
400 Ga0436365_1238059 3300039437 Bacteria 1804
401 Ga0436365_1885236 3300039437 Bacteria 5379
402 Ga0451833_1162688 3300041491 Bacteria 4749
403 Ga0451853_0323525 3300041512 Bacteria 6063
404 Ga0439445_0004315 3300042004 Bacteria 3218
405 Ga0450911_000124 3300042115 Bacteria 30673
406 Ga0451577_0083155 3300042876 Bacteria 2855
407 Ga0466972_0001395 3300044658 Bacteria 11710
408 Ga0466972_0033019 3300044658 Bacteria 2539
409 Ga0466960_0012342 3300044901 Bacteria 3602
410 Ga0466967_0018193 3300045976 Bacteria 5606
411 Ga0495627_000078 3300046453 Bacteria 119920
412 Ga0495627_000939 3300046453 Bacteria 20046
413 Ga0495592_0003588 3300046454 Bacteria 11156
414 Ga0495592_0033654 3300046454 Bacteria 3865
415 Ga0495603_0004389 3300046455 Bacteria 8406
416 Ga0495641_0011856 3300046461 Bacteria 4925
417 Ga0495651_0000950 3300046462 Bacteria 22399
418 Ga0495651_0032332 3300046462 Bacteria 4081
419 Ga0495651_0090440 3300046462 Bacteria 2296
420 Ga0495653_0008312 3300046463 Bacteria 8506
421 Ga0495653_0012779 3300046463 Bacteria 6854
422 Ga0495653_0062980 3300046463 Bacteria 2801
423 Ga0495653_0104813 3300046463 Bacteria 2043
424 Ga0495580_0011006 3300046472 Bacteria 7011
425 Ga0495580_0016612 3300046472 Bacteria 5520
426 Ga0495582_0002565 3300046473 Bacteria 10112
427 Ga0495662_0000938 3300046476 Bacteria 14281
428 Ga0495594_0023142 3300046499 Unclassified 3326
429 Ga0495583_0004588 3300046506 Bacteria 9796
430 Ga0495608_0002908 3300046511 Bacteria 12260
431 Ga0495608_0034479 3300046511 Bacteria 3415
432 Ga0495608_0055321 3300046511 Bacteria 2622
433 Ga0495608_0059385 3300046511 Bacteria 2520
434 Ga0495610_0001502 3300046512 Bacteria 20504
435 Ga0495618_0011128 3300046514 Bacteria 5452
436 Ga0495618_0012264 3300046514 Bacteria 5203
437 Ga0495618_0171047 3300046514 Bacteria 1382
438 Ga0495628_0039393 3300046516 Bacteria 3780
439 Ga0495628_0057808 3300046516 Bacteria 3050
440 Ga0495630_0001927 3300046517 Bacteria 14476
441 Ga0495630_0051296 3300046517 Bacteria 3088
442 Ga0495631_0046322 3300046518 Bacteria 1912
443 Ga0495632_0000001 3300046519 Bacteria 873295
444 Ga0495637_0000088 3300046520 Bacteria 71915
445 Ga0495637_0004718 3300046520 Bacteria 7035
446 Ga0495643_0000006 3300046522 Bacteria 419524
447 Ga0495648_0002964 3300046524 Bacteria 15231
448 Ga0495648_0025371 3300046524 Bacteria 4014
449 Ga0495663_0000001 3300046525 Bacteria 595264
450 Ga0495666_0021076 3300046526 Bacteria 3227
451 Ga0495666_0061266 3300046526 Bacteria 1798
452 Ga0495652_0005862 3300046529 Bacteria 11496
453 Ga0495652_0008046 3300046529 Bacteria 9660
454 Ga0495652_0016357 3300046529 Bacteria 6636
455 Ga0495652_0042844 3300046529 Bacteria 3902
456 Ga0495665_0001964 3300046531 Bacteria 11105
457 Ga0495640_0009996 3300046533 Bacteria 7356
458 Ga0495640_0065988 3300046533 Bacteria 2441
459 Ga0495586_0002352 3300046535 Bacteria 10291
460 Ga0495587_0000345 3300046536 Bacteria 33064
461 Ga0495587_0023240 3300046536 Unclassified 3810
462 Ga0495587_0030726 3300046536 Bacteria 3257
463 Ga0495645_0053901 3300046543 Bacteria 2922
464 Ga0495633_0000053 3300046558 Bacteria 152374
465 Ga0495633_0000424 3300046558 Bacteria 43906
466 Ga0495667_0003206 3300046559 Bacteria 10968
467 Ga0495667_0004058 3300046559 Bacteria 9838
468 Ga0495667_0033563 3300046559 Bacteria 3434
469 Ga0495668_0062364 3300046616 Bacteria 2054
470 Ga0495634_0011880 3300046642 Bacteria 6327
471 Ga0495625_0000014 3300046660 Bacteria 323486
472 Ga0495625_0000373 3300046660 Bacteria 68625
473 Ga0495635_0001305 3300046663 Bacteria 16644
474 Ga0495635_0006403 3300046663 Bacteria 8206
475 Ga0495635_0012165 3300046663 Bacteria 6034
476 Ga0495635_0028428 3300046663 Bacteria 3886
477 Ga0495588_0008813 3300046674 Bacteria 4637
478 Ga0495657_0003044 3300046675 Bacteria 13872
479 Ga0495657_0009809 3300046675 Bacteria 7229
480 Ga0495657_0015303 3300046675 Bacteria 5616
481 Ga0495599_0010916 3300046678 Bacteria 5568
482 Ga0495599_0021657 3300046678 Bacteria 4010
483 Ga0495599_0050948 3300046678 Bacteria 2594
484 Ga0495623_0008957 3300046679 Bacteria 6499
485 Ga0495623_0026268 3300046679 Bacteria 3749
486 Ga0495646_0025300 3300046680 Bacteria 3734
487 Ga0495646_0029906 3300046680 Bacteria 3402
488 Ga0495624_0000989 3300046690 Bacteria 22470
489 Ga0495624_0002326 3300046690 Bacteria 14470
490 Ga0495624_0002760 3300046690 Bacteria 13187
491 Ga0495670_0001666 3300046691 Bacteria 10897
492 Ga0495671_0000008 3300046692 Bacteria 419524
493 Ga0495671_0006971 3300046692 Bacteria 6480
494 Ga0495671_0029544 3300046692 Bacteria 2814
495 Ga0495600_0019097 3300046809 Bacteria 4373
496 Ga0495600_0026610 3300046809 Bacteria 3734
497 Ga0495600_0036267 3300046809 Bacteria 3204
498 Ga0495581_0000510 3300047315 Bacteria 19910
499 Ga0495581_0020951 3300047315 Bacteria 3793
500 Ga0495604_0000884 3300047317 Bacteria 24919
501 Ga0495604_0006999 3300047317 Bacteria 8937
502 Ga0495604_0084086 3300047317 Bacteria 2377
503 Ga0495674_0003043 3300047319 Bacteria 16312
504 Ga0495674_0012615 3300047319 Bacteria 7962
505 Ga0495674_0018553 3300047319 Bacteria 6475
506 Ga0495674_0040366 3300047319 Bacteria 4175
507 Ga0495674_0102978 3300047319 Bacteria 2427
508 Ga0495672_0006713 3300047320 Bacteria 8834
509 Ga0495672_0015785 3300047320 Bacteria 5115
510 Ga0495676_0002502 3300047321 Bacteria 16361
511 Ga0495676_0021417 3300047321 Bacteria 5645
512 Ga0495680_0008897 3300047322 Bacteria 9077
513 Ga0495680_0018754 3300047322 Bacteria 5864
514 Ga0495680_0022567 3300047322 Bacteria 5242
515 Ga0495680_0051412 3300047322 Bacteria 3217
516 Ga0495680_0052464 3300047322 Bacteria 3178
517 Ga0495675_0009340 3300047444 Bacteria 6099
518 Ga0495675_0023179 3300047444 Bacteria 3956
519 Ga0495675_0026882 3300047444 Bacteria 3668
520 Ga0495677_0001245 3300047445 Bacteria 10197
521 Ga0495681_0000022 3300047470 Bacteria 165281
522 Ga0495681_0002045 3300047470 Bacteria 14697
523 Ga0495684_0007992 3300047471 Bacteria 8176
524 Ga0495684_0008048 3300047471 Bacteria 8152
525 Ga0495684_0013394 3300047471 Bacteria 6312
526 Ga0495684_0039063 3300047471 Bacteria 3638
527 Ga0495684_0042567 3300047471 Bacteria 3478
528 Ga0495686_0008331 3300047472 Bacteria 7620
529 Ga0495686_0036614 3300047472 Bacteria 3149
530 Ga0495686_0039467 3300047472 Bacteria 3015
531 Ga0495593_0051201 3300047673 Bacteria 2185
532 Ga0495602_0009207 3300048088 Bacteria 10278
533 Ga0495602_0045787 3300048088 Bacteria 3956
534 Ga0495602_0072763 3300048088 Bacteria 2929
535 Ga0495602_0110417 3300048088 Bacteria 2235
536 Ga0495602_0114340 3300048088 Bacteria 2185
537 Ga0496100_0001545 3300048903 Bacteria 11304
538 Ga0496101_0006501 3300048904 Bacteria 7525
539 Ga0496101_0031887 3300048904 Bacteria 3706
540 Ga0496101_0080995 3300048904 Bacteria 2400
541 Ga0496102_0000286 3300048905 Bacteria 64518
542 Ga0496102_0000597 3300048905 Bacteria 37872
543 Ga0496102_0006754 3300048905 Bacteria 9795
544 Ga0496102_0032587 3300048905 Bacteria 4681
545 Ga0496102_0051173 3300048905 Bacteria 3763
546 Ga0496102_0116117 3300048905 Bacteria 2498
547 Ga0496103_0000490 3300048906 Bacteria 32894
548 Ga0496104_0001473 3300048907 Bacteria 20326
549 Ga0496104_0003060 3300048907 Bacteria 14414
550 Ga0496104_0003963 3300048907 Bacteria 12814
551 Ga0496104_0008437 3300048907 Bacteria 9162
552 Ga0496104_0024032 3300048907 Bacteria 5607
553 Ga0496104_0198845 3300048907 Bacteria 1916
554 Ga0496104_0241722 3300048907 Bacteria 1718
555 Ga0496105_0002023 3300048908 Bacteria 14649
556 Ga0496105_0011879 3300048908 Bacteria 6896
557 Ga0496105_0012595 3300048908 Bacteria 6697
558 Ga0496105_0014155 3300048908 Bacteria 6347
559 Ga0496105_0102504 3300048908 Bacteria 2363
560 Ga0496106_0027628 3300048909 Bacteria 4227
561 Ga0496106_0122083 3300048909 Bacteria 2037
562 Ga0496107_0079383 3300048910 Bacteria 2392
563 Ga0496107_0083010 3300048910 Bacteria 2336
564 Ga0496107_0135991 3300048910 Bacteria 1815
565 Ga0496108_0010632 3300048911 Bacteria 7465
566 Ga0496108_0017998 3300048911 Bacteria 5780
567 Ga0496108_0039650 3300048911 Bacteria 3925
568 Ga0496108_0051720 3300048911 Bacteria 3441
569 Ga0496108_0114705 3300048911 Bacteria 2307
570 Ga0496109_0011608 3300048912 Bacteria 7576
571 Ga0496109_0031161 3300048912 Bacteria 4783
572 Ga0496109_0032929 3300048912 Bacteria 4663
573 Ga0496109_0045004 3300048912 Bacteria 4005
574 Ga0496109_0073903 3300048912 Bacteria 3133
575 Ga0496110_0001000 3300048913 Bacteria 19881
576 Ga0496110_0004537 3300048913 Bacteria 10778
577 Ga0496110_0066517 3300048913 Bacteria 3187
578 Ga0496111_0013741 3300048914 Bacteria 5515
579 Ga0496111_0017504 3300048914 Bacteria 4956
580 Ga0496111_0021375 3300048914 Bacteria 4517
581 Ga0496112_0018227 3300048915 Bacteria 6608
582 Ga0496112_0035818 3300048915 Bacteria 4837
583 Ga0496112_0208399 3300048915 Bacteria 1912
584 Ga0496113_0028398 3300048916 Bacteria 4023
585 Ga0496113_0063145 3300048916 Bacteria 2799
586 Ga0496113_0111440 3300048916 Bacteria 2130
587 Ga0496114_0008354 3300048917 Bacteria 8200
588 Ga0496114_0014087 3300048917 Bacteria 6411
589 Ga0496114_0027090 3300048917 Bacteria 4695
590 Ga0496114_0048288 3300048917 Bacteria 3540
591 Ga0496114_0065841 3300048917 Bacteria 3036
592 Ga0496114_0110278 3300048917 Bacteria 2357
593 Ga0496114_0152875 3300048917 Bacteria 2002
594 Ga0496114_0181426 3300048917 Bacteria 1839
595 Ga0496115_0012725 3300048918 Bacteria 6341
596 Ga0496115_0030072 3300048918 Bacteria 4270
597 Ga0496115_0279334 3300048918 Bacteria 1371
598 Ga0496116_0000716 3300048919 Bacteria 42501
599 Ga0496117_0000579 3300048920 Bacteria 60223
600 Ga0496118_0000587 3300048921 Bacteria 60205
601 Ga0496119_0001329 3300048922 Bacteria 30377
602 Ga0496120_0002815 3300048923 Bacteria 16800
603 Ga0496121_0016612 3300048924 Bacteria 7585
604 Ga0496123_0010794 3300048926 Bacteria 8015
605 Ga0496124_0063030 3300048927 Bacteria 3099
606 Ga0496125_0003687 3300048928 Bacteria 18296
607 Ga0496125_0004511 3300048928 Bacteria 16008
608 Ga0496126_0000272 3300048929 Bacteria 110072
609 Ga0496126_0000588 3300048929 Bacteria 68756
610 Ga0496126_0000649 3300048929 Bacteria 64480
611 Ga0496126_0020830 3300048929 Bacteria 6418
612 Ga0496126_0025832 3300048929 Bacteria 5643
613 Ga0496126_0088657 3300048929 Bacteria 2725
614 Ga0501033_0065851 3300049570 Bacteria 2665
615 Ga0501034_0020094 3300049571 Bacteria 6820
616 Ga0501036_0005090 3300049572 Bacteria 10639
617 Ga0501038_0038142 3300049574 Bacteria 4209
618 Ga0501038_0038679 3300049574 Bacteria 4176
619 Ga0501039_0061030 3300049575 Bacteria 2920
620 Ga0501043_0017475 3300049579 Bacteria 5623
621 Ga0501046_0035807 3300049580 Bacteria 3998
622 Ga0501047_0000514 3300049581 Bacteria 41781
623 Ga0501047_0012506 3300049581 Bacteria 8038
624 Ga0501048_0073434 3300049582 Bacteria 2414
625 Ga0501067_0016723 3300049583 Bacteria 4053
626 Ga0501067_0051568 3300049583 Bacteria 2280
627 Ga0501067_0054191 3300049583 Bacteria 2222
628 Ga0501071_0018860 3300049587 Bacteria 4784
629 Ga0501072_0004592 3300049588 Bacteria 10510
630 nmdc:mga00v17_3991_c1 3300050491 Bacteria 7618
631 nmdc:mga0yw44_11116_c1 3300050492 Bacteria 4628
632 nmdc:mga0yw44_15782_c1 3300050492 Bacteria 4059
633 nmdc:mga07m45_21284_c1 3300050496 Bacteria 3529
634 nmdc:mga05p37_6701_c1 3300050507 Bacteria 13571
635 nmdc:mga09592_71_c1 3300050508 Bacteria 57332
636 nmdc:mga0qj67_6384_c1 3300050509 Bacteria 8660
637 nmdc:mga06r32_31467_c1 3300050510 Bacteria 4984
638 nmdc:mga08y16_55524_c1 3300050511 Bacteria 4138
639 nmdc:mga0rr50_109703_c1 3300050513 Bacteria 2182
640 nmdc:mga0a205_86348_c1 3300050515 Bacteria 3030
641 Ga0495601_0043059 3300053077 Bacteria 2835
642 Ga0495612_0026850 3300053078 Bacteria 2313
643 Ga0495595_0019955 3300053084 Bacteria 2912
644 Ga0495619_0012890 3300053085 Bacteria 5265
645 Ga0495619_0099843 3300053085 Bacteria 1974
646 Ga0500643_000221 3300053087 Bacteria 53085
647 Ga0500566_0006585 3300053094 Bacteria 6885
648 Ga0500641_0020714 3300053096 Bacteria 2498
649 Ga0500556_0000532 3300053104 Bacteria 26053
650 Ga0500594_0006883 3300053118 Bacteria 2563
651 Ga0500568_0001089 3300053139 Bacteria 18282
652 Ga0500568_0030813 3300053139 Bacteria 2218
653 Ga0500604_0000011 3300053151 Bacteria 104892
654 Ga0500616_0000123 3300053153 Bacteria 140214
655 Ga0500627_0000001 3300053158 Bacteria 251552
656 Ga0501084_0006171 3300054114 Bacteria 9857
657 2513718960 2513237104 Bacteria 10034502
658 2513891068 2513237141 Bacteria 8496279
659 2514045617 2513237165 Bacteria 6771773
660 2566995155 2565956761 Bacteria 6601618
661 2586061796 2585427649 Bacteria 9053857
662 2643827547 2643221561 Bacteria 4984412
663 2643891134 2643221576 Bacteria 5214352
664 2643960190 2643221590 Bacteria 5214697
665 2644035139 2643221604 Bacteria 5014917
666 2644090252 2643221615 Bacteria 5487866
667 2644101288 2643221617 Bacteria 5139111
668 2644119306 2643221620 Bacteria 5134593
669 2644303094 2643221654 Bacteria 5273570
670 2644320097 2643221657 Bacteria 5490246
671 2644464723 2643221683 Bacteria 5749203
672 2644533622 2643221696 Bacteria 5431823
673 2738868914 2738541305 Bacteria 4910150
674 2738889451 2738541308 Bacteria 7020677
675 2739362509 2738543034 Bacteria 6084756
676 2774393064 2773857762 Bacteria 5971770
677 2809063805 2808606401 Bacteria 4586670
678 2809079773 2808606404 Bacteria 4652788
679 2809084138 2808606405 Bacteria 4586632
680 2809196908 2808606439 Bacteria 5952208
681 2809590471 2808606522 Bacteria 9488490
682 2812330364 2811994874 Bacteria 5367947
683 2812350933 2811994878 Bacteria 5992952
684 2819426109 2818991318 Bacteria 5266538
685 2819696995 2818991463 Bacteria 7948711
686 2819745855 2818991472 Bacteria 10089953
687 2824682654 2824679649 Bacteria 8248951
688 2824709430 2824704595 Bacteria 9667483
689 2824757730 2824753945 Bacteria 9787441
690 2824768758 2824763712 Bacteria 9792355
691 2857485266 2857481737 Bacteria 4761446
692 2873158729 2873151551 Bacteria 8625867
693 2880523510 2880518877 Bacteria 5012590
694 2885201522 2885198086 Bacteria 7212419
695 2885215767 2885211737 Bacteria 7212420
696 2891971477 2891968417 Bacteria 5821697
697 2904537321 2904535858 Bacteria 6308016
698 2904713068 2904711408 Bacteria 9771557
699 2904767144 2904765812 Bacteria 5369154
700 2904773896 2904770941 Bacteria 5580202
701 2908814782 2908811453 Bacteria 5478616
702 2915363004 2915358134 Bacteria 6050864
703 2915770696 2915768154 Bacteria 8424322
704 2917739937 2917736166 Bacteria 9690793
705 2919420417 2919420072 Bacteria 5390363
706 2919433825 2919432681 Bacteria 5390474
707 2922396334 2922393267 Bacteria 8285685
708 2922559064 2922554459 Bacteria 6683962
709 2932806705 2932801729 Bacteria 7987968
710 2941535615 2941531003 Bacteria 7653939
711 2945914593 2945909444 Bacteria 7065066
712 2945990006 2945984333 Bacteria 7358892
713 2966605567 2966598605 Bacteria 7676064
714 2974319439 2974315732 Bacteria 4602776
715 2984527645 2984523437 Bacteria 4508481
716 2984580520 2984576629 Bacteria 4248407
717 2990258212 2990256926 Bacteria 4252839
718 3006322908 3006321560 Bacteria 8247479
719 3006497949 3006493962 Bacteria 8825450
720 8003317686 8003314358 Bacteria 10575343
721 8006928545 8006926726 Bacteria 6749210
722 8011353305 8011350971 Bacteria 6158957
723 8047720425 8047710418 Bacteria 11023148
724 8054475976 8054472261 Bacteria 7464355
725 8057102815 8057101203 Bacteria 5034064
726 Ga0070698_100022808
727 JGI24736J21556_1000082
728 JGI24740J21852_10003927
729 JGI24739J22299_10005208
730 JGI24735J21928_10006642
731 JGI24738J21930_10008269
732 JGI25407J50210_10003955
733 JGI25404J52841_10000235
734 Ga0055530_10000093
735 Ga0055530_10000104
736 Ga0055540_1007428
737 Ga0055531_10000432
738 Ga0055531_10002055
739 Ga0070683_100002702
740 Ga0070683_100010116
741 Ga0070683_100013188
742 Ga0070683_100032144
743 Ga0070683_100075807
744 Ga0068869_100009568
745 Ga0068869_100071657
746 Ga0068869_100077878
747 Ga0070666_10014340
748 Ga0070666_10029643
749 Ga0070682_100057762
750 Ga0070682_100067088
751 Ga0070682_100101305
752 Ga0068868_100037250
753 Ga0070687_100019362
754 Ga0070661_100030912
755 Ga0070668_100000425
756 Ga0070668_100039888
757 Ga0070668_100071753
758 Ga0070675_100053540
759 Ga0070675_100196275
760 Ga0070671_100013148
761 Ga0070671_100050494
762 Ga0070674_100041183
763 Ga0070673_100047366
764 Ga0070688_100064672
765 Ga0070659_100004221
766 Ga0070659_100058748
767 Ga0070667_100041269
768 Ga0070667_100233722
769 Ga0070703_10010202
770 Ga0070709_10021541
771 Ga0070714_100021486
772 Ga0070714_100182209
773 Ga0070713_100057549
774 Ga0070710_10007207
775 Ga0070711_100003971
776 Ga0070711_100029686
777 Ga0070711_100076887
778 Ga0070705_100020353
779 Ga0070694_100009061
780 Ga0070694_100113622
781 Ga0070708_100016030
782 Ga0070708_100055574
783 Ga0070708_100072383
784 Ga0070708_100143161
785 Ga0070663_100005868
786 Ga0070678_100039449
787 Ga0070662_100020261
788 Ga0070662_100022891
789 Ga0070662_100042699
790 Ga0070685_10018383
791 Ga0070685_10071439
792 Ga0070685_10086558
793 Ga0070706_100001943
794 Ga0070706_100033486
795 Ga0070706_100150348
796 Ga0070707_100011160
797 Ga0070707_100015242
798 Ga0070707_100080783
799 Ga0070698_100001126
800 Ga0070698_100004906
801 Ga0070698_100005767
802 Ga0070699_100002453
803 Ga0070699_100011087
804 Ga0070679_100024686
805 Ga0070679_100048194
806 Ga0070684_100003428
807 Ga0070697_100003236
808 Ga0070672_100041287
809 Ga0070672_100148817
810 Ga0070696_100017808
811 Ga0070665_100000011
812 Ga0070665_100000596
813 Ga0070665_100004605
814 Ga0070665_100072533
815 Ga0068855_100000032
816 Ga0070664_100001201
817 Ga0070664_100006782
818 Ga0070664_100085635
819 Ga0068857_100023384
820 Ga0068857_100028137
821 Ga0068857_100041684
822 Ga0068857_100042508
823 Ga0068857_100081984
824 Ga0068857_100127933
825 Ga0068856_100013762
826 Ga0068859_100109284
827 Ga0068864_100143672
828 Ga0068866_10034919
829 Ga0068866_10057655
830 Ga0068861_100021704
831 Ga0068851_10061692
832 Ga0068870_10008775
833 Ga0068870_10054071
834 Ga0068870_10097947
835 Ga0068863_100034139
836 Ga0068863_100054372
837 Ga0068863_100069141
838 Ga0068863_100071883
839 Ga0068858_100002113
840 Ga0068858_100032909
841 Ga0068858_100047466
842 Ga0068862_100022922
843 Ga0068862_100027619
844 Ga0081455_10000724
845 Ga0081455_10084898
846 Ga0081538_10004167
847 Ga0081540_1000528
848 Ga0081539_10000999
849 Ga0081539_10005615
850 Ga0081539_10007595
851 Ga0070717_10039004
852 Ga0075365_10009286
853 Ga0075368_10004625
854 Ga0075363_100035372
855 Ga0075364_10006473
856 Ga0070715_10020379
857 Ga0070715_10047190
858 Ga0070712_100005558
859 Ga0070712_100006558
860 Ga0070712_100010785
861 Ga0075367_10064425
862 Ga0068871_100020061
863 Ga0068871_100095675
864 Ga0075430_100067423
865 Ga0075431_100032592
866 Ga0075433_10053485
867 Ga0075429_100003204
868 Ga0075429_100021787
869 Ga0097620_100109284
870 Ga0075435_100026319
871 Ga0105240_10180463
872 Ga0111539_10000515
873 Ga0111539_10089136
874 Ga0105245_10000529
875 Ga0105245_10020906
876 Ga0105245_10072319
877 Ga0105247_10011549
878 Ga0114129_10028864
879 Ga0105243_10047640
880 Ga0105242_10051819
881 Ga0105237_10069511
882 Ga0105238_10080063
883 Ga0105238_10103866
884 Ga0105238_10163190
885 Ga0105249_10022755
886 Ga0105249_10170644
887 Ga0105239_10258978
888 Ga0105246_10004077
889 Ga0105246_10038778
890 Ga0157342_1001046
891 Ga0157370_10029089
892 Ga0157369_10003669
893 Ga0157369_10033051
894 Ga0157369_10071413
895 Ga0157374_10073628
896 Ga0157374_10153738
897 Ga0157378_10154159
898 Ga0163162_10112126
899 Ga0157372_10080788
900 Ga0157372_10196199
901 Ga0157375_10033927
902 Ga0157375_10037218
903 Ga0157375_10106674
904 Ga0157375_10138891
905 Ga0157380_10047068
906 Ga0157377_10011005
907 Ga0157377_10065040
908 Ga0157379_10018288
909 Ga0157379_10048224
910 Ga0157376_10020114
911 Ga0157376_10103403
912 Ga0163161_10023742
913 Ga0206356_11380849
914 Ga0206354_10770736
915 Ga0214544_1000056
916 Ga0213875_10001633
917 Ga0209147_100368
918 Ga0209675_1000132
919 Ga0209676_1000085
920 Ga0209676_1000118
921 Ga0209676_1001329
922 Ga0209050_1000115
923 Ga0207426_1007082
924 Ga0209051_1000413
925 Ga0209051_1011091
926 Ga0209257_1000160
927 Ga0209257_1000482
928 Ga0209257_1006194
929 Ga0207656_10053774
930 Ga0207653_10002294
931 Ga0207653_10015836
932 Ga0207692_10006037
933 Ga0207692_10008808
934 Ga0207692_10020664
935 Ga0207688_10000995
936 Ga0207688_10012849
937 Ga0207688_10014437
938 Ga0207688_10080432
939 Ga0207680_10029174
940 Ga0207647_10003799
941 Ga0207647_10030334
942 Ga0207699_10004882
943 Ga0207699_10006490
944 Ga0207699_10046955
945 Ga0207645_10032768
946 Ga0207643_10054170
947 Ga0207643_10063681
948 Ga0207684_10002895
949 Ga0207684_10096748
950 Ga0207671_10001110
951 Ga0207693_10001394
952 Ga0207693_10003334
953 Ga0207693_10008049
954 Ga0207693_10016153
955 Ga0207693_10021512
956 Ga0207663_10002702
957 Ga0207662_10012788
958 Ga0207662_10024763
959 Ga0207657_10006877
960 Ga0207657_10020250
961 Ga0207657_10056571
962 Ga0207657_10061524
963 Ga0207652_10005615
964 Ga0207646_10005267
965 Ga0207646_10006511
966 Ga0207659_10027441
967 Ga0207687_10102872
968 Ga0207687_10166833
969 Ga0207700_10013193
970 Ga0207700_10017788
971 Ga0207700_10028349
972 Ga0207700_10067357
973 Ga0207664_10010087
974 Ga0207664_10032123
975 Ga0207644_10014395
976 Ga0207706_10009888
977 Ga0207706_10017955
978 Ga0207706_10027818
979 Ga0207706_10035702
980 Ga0207706_10065345
981 Ga0207706_10145110
982 Ga0207709_10082687
983 Ga0207670_10015775
984 Ga0207665_10001604
985 Ga0207665_10002187
986 Ga0207665_10006158
987 Ga0207665_10011024
988 Ga0207665_10067307
989 Ga0207665_10111621
990 Ga0207691_10045389
991 Ga0207711_10034870
992 Ga0207689_10025359
993 Ga0207689_10088384
994 Ga0207661_10085376
995 Ga0207667_10012779
996 Ga0207651_10036222
997 Ga0207668_10001956
998 Ga0207658_10032959
999 Ga0207677_10042210
1000 Ga0207677_10068782
1001 Ga0207703_10001637
1002 Ga0207639_10122657
1003 Ga0207678_10010983
1004 Ga0207678_10011222
1005 Ga0207678_10015276
1006 Ga0207678_10019597
1007 Ga0207678_10052876
1008 Ga0207678_10055042
1009 Ga0207678_10069896
1010 Ga0207678_10099774
1011 Ga0207708_10021659
1012 Ga0207702_10001744
1013 Ga0207702_10011750
1014 Ga0207641_10013183
1015 Ga0207641_10101803
1016 Ga0207676_10189753
1017 Ga0207674_10034983
1018 Ga0207674_10035385
1019 Ga0207674_10037641
1020 Ga0207674_10052862
1021 Ga0207674_10056821
1022 Ga0207674_10080075
1023 Ga0207674_10083033
1024 Ga0207675_100032639
1025 Ga0207675_100043257
1026 Ga0207675_100149280
1027 Ga0207683_10023161
1028 Ga0207683_10052256
1029 Ga0207683_10090274
1030 Ga0207683_10139381
1031 Ga0207428_10053149
1032 Ga0268266_10000063
1033 Ga0268266_10005453
1034 Ga0268266_10029429
1035 Ga0268265_10101647
1036 Ga0265337_1003142
1037 Ga0265336_10003485
1038 Ga0307515_10000456
1039 Ga0307515_10036149
1040 Ga0307515_10046075
1041 Ga0307515_10103950
1042 Ga0265338_10004224
1043 Ga0265338_10005162
1044 Ga0265324_10002929
1045 Ga0307512_10007181
1046 Ga0307512_10008020
1047 Ga0265332_10014040
1048 Ga0265320_10000584
1049 Ga0265320_10000631
1050 Ga0265320_10023782
1051 Ga0265325_10079709
1052 Ga0307513_10001838
1053 Ga0307513_10004469
1054 Ga0307509_10047050
1055 Ga0265313_10020736
1056 Ga0307508_10002212
1057 Ga0307508_10019006
1058 Ga0307508_10026744
1059 Ga0316579_10011725
1060 Ga0265314_10001042
1061 Ga0265342_10013750
1062 Ga0307518_10002915
1063 Ga0307412_10013256
1064 Ga0307409_100011709
1065 Ga0307409_100105678
1066 Ga0307409_100141808
1067 Ga0307409_100159216
1068 Ga0307414_10003714
1069 Ga0307414_10182977
1070 Ga0307415_100003630
1071 Ga0307415_100161534
1072 Ga0307507_10004675
1073 Ga0307507_10047549
1074 Ga0307510_10003235
1075 Ga0307510_10025725
1076 Ga0307510_10040826
1077 Ga0373926_0001284
1078 Ga0373923_0014478
1079 Ga0373936_0002046
1080 Ga0373936_0011727
1081 Ga0373945_0000375
1082 Ga0373953_0015437
1083 Ga0373953_0022533
1084 Ga0373953_0031235
1085 Ga0373956_0000970
1086 Ga0373956_0009086
1087 Ga0373957_0014511
1088 Ga0373960_0013726
1089 Ga0373943_0000129
1090 Ga0373943_0001180
1091 Ga0373946_0000242
1092 Ga0373946_0002798
1093 Ga0373955_0005820
1094 Ga0373955_0050635
1095 Ga0373924_0000750
1096 Ga0373924_0004493
1097 Ga0373924_0021296
1098 Ga0373935_0014178
1099 Ga0373935_0014651
1100 Ga0373935_0021142
1101 Ga0373927_0003873
1102 Ga0373933_0015835
1103 Ga0373933_0020652
1104 Ga0373947_0001856
1105 Ga0373947_0015165
1106 Ga0373947_0068144
1107 Ga0372808_002217
1108 Ga0316584_0022151
1109 Ga0373925_0000177
1110 Ga0373925_0003615
1111 Ga0373925_0032872
1112 Ga0373925_0082139
1113 Ga0373925_0142407
1114 Ga0395899_0000091
1115 Ga0395900_0000008
1116 Ga0395898_0002459
1117 Ga0395898_0017952
1118 Ga0395898_0058182
1119 Ga0395898_0074973
1120 Ga0395905_0046457
1121 Ga0436364_0103177
1122 Ga0436364_0764299
1123 Ga0436364_1261928
1124 Ga0395901_0000008
1125 Ga0436365_1238059
1126 Ga0436365_1885236
1127 Ga0451833_1162688
1128 Ga0451853_0323525
1129 Ga0439445_0004315
1130 Ga0450911_000124
1131 Ga0451577_0083155
1132 Ga0466972_0001395
1133 Ga0466972_0033019
1134 Ga0466960_0012342
1135 Ga0466967_0018193
1136 Ga0495627_000078
1137 Ga0495627_000939
1138 Ga0495592_0003588
1139 Ga0495592_0033654
1140 Ga0495603_0004389
1141 Ga0495641_0011856
1142 Ga0495651_0000950
1143 Ga0495651_0032332
1144 Ga0495651_0090440
1145 Ga0495653_0008312
1146 Ga0495653_0012779
1147 Ga0495653_0062980
1148 Ga0495653_0104813
1149 Ga0495580_0011006
1150 Ga0495580_0016612
1151 Ga0495582_0002565
1152 Ga0495662_0000938
1153 Ga0495594_0023142
1154 Ga0495583_0004588
1155 Ga0495608_0002908
1156 Ga0495608_0034479
1157 Ga0495608_0055321
1158 Ga0495608_0059385
1159 Ga0495610_0001502
1160 Ga0495618_0011128
1161 Ga0495618_0012264
1162 Ga0495618_0171047
1163 Ga0495628_0039393
1164 Ga0495628_0057808
1165 Ga0495630_0001927
1166 Ga0495630_0051296
1167 Ga0495631_0046322
1168 Ga0495632_0000001
1169 Ga0495637_0000088
1170 Ga0495637_0004718
1171 Ga0495643_0000006
1172 Ga0495648_0002964
1173 Ga0495648_0025371
1174 Ga0495663_0000001
1175 Ga0495666_0021076
1176 Ga0495666_0061266
1177 Ga0495652_0005862
1178 Ga0495652_0008046
1179 Ga0495652_0016357
1180 Ga0495652_0042844
1181 Ga0495665_0001964
1182 Ga0495640_0009996
1183 Ga0495640_0065988
1184 Ga0495586_0002352
1185 Ga0495587_0000345
1186 Ga0495587_0023240
1187 Ga0495587_0030726
1188 Ga0495645_0053901
1189 Ga0495633_0000053
1190 Ga0495633_0000424
1191 Ga0495667_0003206
1192 Ga0495667_0004058
1193 Ga0495667_0033563
1194 Ga0495668_0062364
1195 Ga0495634_0011880
1196 Ga0495625_0000014
1197 Ga0495625_0000373
1198 Ga0495635_0001305
1199 Ga0495635_0006403
1200 Ga0495635_0012165
1201 Ga0495635_0028428
1202 Ga0495588_0008813
1203 Ga0495657_0003044
1204 Ga0495657_0009809
1205 Ga0495657_0015303
1206 Ga0495599_0010916
1207 Ga0495599_0021657
1208 Ga0495599_0050948
1209 Ga0495623_0008957
1210 Ga0495623_0026268
1211 Ga0495646_0025300
1212 Ga0495646_0029906
1213 Ga0495624_0000989
1214 Ga0495624_0002326
1215 Ga0495624_0002760
1216 Ga0495670_0001666
1217 Ga0495671_0000008
1218 Ga0495671_0006971
1219 Ga0495671_0029544
1220 Ga0495600_0019097
1221 Ga0495600_0026610
1222 Ga0495600_0036267
1223 Ga0495581_0000510
1224 Ga0495581_0020951
1225 Ga0495604_0000884
1226 Ga0495604_0006999
1227 Ga0495604_0084086
1228 Ga0495674_0003043
1229 Ga0495674_0012615
1230 Ga0495674_0018553
1231 Ga0495674_0040366
1232 Ga0495674_0102978
1233 Ga0495672_0006713
1234 Ga0495672_0015785
1235 Ga0495676_0002502
1236 Ga0495676_0021417
1237 Ga0495680_0008897
1238 Ga0495680_0018754
1239 Ga0495680_0022567
1240 Ga0495680_0051412
1241 Ga0495680_0052464
1242 Ga0495675_0009340
1243 Ga0495675_0023179
1244 Ga0495675_0026882
1245 Ga0495677_0001245
1246 Ga0495681_0000022
1247 Ga0495681_0002045
1248 Ga0495684_0007992
1249 Ga0495684_0008048
1250 Ga0495684_0013394
1251 Ga0495684_0039063
1252 Ga0495684_0042567
1253 Ga0495686_0008331
1254 Ga0495686_0036614
1255 Ga0495686_0039467
1256 Ga0495593_0051201
1257 Ga0495602_0009207
1258 Ga0495602_0045787
1259 Ga0495602_0072763
1260 Ga0495602_0110417
1261 Ga0495602_0114340
1262 Ga0496100_0001545
1263 Ga0496101_0006501
1264 Ga0496101_0031887
1265 Ga0496101_0080995
1266 Ga0496102_0000286
1267 Ga0496102_0000597
1268 Ga0496102_0006754
1269 Ga0496102_0032587
1270 Ga0496102_0051173
1271 Ga0496102_0116117
1272 Ga0496103_0000490
1273 Ga0496104_0001473
1274 Ga0496104_0003060
1275 Ga0496104_0003963
1276 Ga0496104_0008437
1277 Ga0496104_0024032
1278 Ga0496104_0198845
1279 Ga0496104_0241722
1280 Ga0496105_0002023
1281 Ga0496105_0011879
1282 Ga0496105_0012595
1283 Ga0496105_0014155
1284 Ga0496105_0102504
1285 Ga0496106_0027628
1286 Ga0496106_0122083
1287 Ga0496107_0079383
1288 Ga0496107_0083010
1289 Ga0496107_0135991
1290 Ga0496108_0010632
1291 Ga0496108_0017998
1292 Ga0496108_0039650
1293 Ga0496108_0051720
1294 Ga0496108_0114705
1295 Ga0496109_0011608
1296 Ga0496109_0031161
1297 Ga0496109_0032929
1298 Ga0496109_0045004
1299 Ga0496109_0073903
1300 Ga0496110_0001000
1301 Ga0496110_0004537
1302 Ga0496110_0066517
1303 Ga0496111_0013741
1304 Ga0496111_0017504
1305 Ga0496111_0021375
1306 Ga0496112_0018227
1307 Ga0496112_0035818
1308 Ga0496112_0208399
1309 Ga0496113_0028398
1310 Ga0496113_0063145
1311 Ga0496113_0111440
1312 Ga0496114_0008354
1313 Ga0496114_0014087
1314 Ga0496114_0027090
1315 Ga0496114_0048288
1316 Ga0496114_0065841
1317 Ga0496114_0110278
1318 Ga0496114_0152875
1319 Ga0496114_0181426
1320 Ga0496115_0012725
1321 Ga0496115_0030072
1322 Ga0496115_0279334
1323 Ga0496116_0000716
1324 Ga0496117_0000579
1325 Ga0496118_0000587
1326 Ga0496119_0001329
1327 Ga0496120_0002815
1328 Ga0496121_0016612
1329 Ga0496123_0010794
1330 Ga0496124_0063030
1331 Ga0496125_0003687
1332 Ga0496125_0004511
1333 Ga0496126_0000272
1334 Ga0496126_0000588
1335 Ga0496126_0000649
1336 Ga0496126_0020830
1337 Ga0496126_0025832
1338 Ga0496126_0088657
1339 Ga0501033_0065851
1340 Ga0501034_0020094
1341 Ga0501036_0005090
1342 Ga0501038_0038142
1343 Ga0501038_0038679
1344 Ga0501039_0061030
1345 Ga0501043_0017475
1346 Ga0501046_0035807
1347 Ga0501047_0000514
1348 Ga0501047_0012506
1349 Ga0501048_0073434
1350 Ga0501067_0016723
1351 Ga0501067_0051568
1352 Ga0501067_0054191
1353 Ga0501071_0018860
1354 Ga0501072_0004592
1355 nmdc:mga00v17_3991_c1
1356 nmdc:mga0yw44_11116_c1
1357 nmdc:mga0yw44_15782_c1
1358 nmdc:mga07m45_21284_c1
1359 nmdc:mga05p37_6701_c1
1360 nmdc:mga09592_71_c1
1361 nmdc:mga0qj67_6384_c1
1362 nmdc:mga06r32_31467_c1
1363 nmdc:mga08y16_55524_c1
1364 nmdc:mga0rr50_109703_c1
1365 nmdc:mga0a205_86348_c1
1366 Ga0495601_0043059
1367 Ga0495612_0026850
1368 Ga0495595_0019955
1369 Ga0495619_0012890
1370 Ga0495619_0099843
1371 Ga0500643_000221
1372 Ga0500566_0006585
1373 Ga0500641_0020714
1374 Ga0500556_0000532
1375 Ga0500594_0006883
1376 Ga0500568_0001089
1377 Ga0500568_0030813
1378 Ga0500604_0000011
1379 Ga0500616_0000123
1380 Ga0500627_0000001
1381 Ga0501084_0006171
1382 2513718960
1383 2513891068
1384 2514045617
1385 2566995155
1386 2586061796
1387 2643827547
1388 2643891134
1389 2643960190
1390 2644035139
1391 2644090252
1392 2644101288
1393 2644119306
1394 2644303094
1395 2644320097
1396 2644464723
1397 2644533622
1398 2738868914
1399 2738889451
1400 2739362509
1401 2774393064
1402 2809063805
1403 2809079773
1404 2809084138
1405 2809196908
1406 2809590471
1407 2812330364
1408 2812350933
1409 2819426109
1410 2819696995
1411 2819745855
1412 2824682654
1413 2824709430
1414 2824757730
1415 2824768758
1416 2857485266
1417 2873158729
1418 2880523510
1419 2885201522
1420 2885215767
1421 2891971477
1422 2904537321
1423 2904713068
1424 2904767144
1425 2904773896
1426 2908814782
1427 2915363004
1428 2915770696
1429 2917739937
1430 2919420417
1431 2919433825
1432 2922396334
1433 2922559064
1434 2932806705
1435 2941535615
1436 2945914593
1437 2945990006
1438 2966605567
1439 2974319439
1440 2984527645
1441 2984580520
1442 2990258212
1443 3006322908
1444 3006497949
1445 8003317686
1446 8006928545
1447 8011353305
1448 8047720425
1449 8054475976
1450 8057102815

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13193

AMP-binding_C

AMP-binding enzyme C-terminal domain

463

538

0.98

PF00501

AMP-binding

AMP-binding enzyme

48

413

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ivr-assembly1.cif.gz_B crystal structure of putative long-chain-fatty-acid coa ligase from rhodopseudomonas palustris cga009 0.9219 5 412
3ivr-assembly1.cif.gz_B crystal structure of putative long-chain-fatty-acid coa ligase from rhodopseudomonas palustris cga009 0.9129 5 412
5zrn-assembly1.cif.gz_A inhibitor bound crystal structure of n-terminal domain of facl13 from mycobacterium tuberculosis 0.9101 5 412
3t5c-assembly2.cif.gz_B crystal structure of n-terminal domain of facl13 from mycobacterium tuberculosis in different space group c2 0.9084 5 411
3t5c-assembly2.cif.gz_B crystal structure of n-terminal domain of facl13 from mycobacterium tuberculosis in different space group c2 0.9061 5 411
ID Description Score Start End Superfamily
5u95D03 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9419 340 412 2.30.38.10
af_O05819_776_852_2.30.38.10 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9419 344 410 2.30.38.10
2d1qA01 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9363 338 412 2.30.38.10
af_Q2G1H9_722_797_2.30.38.10 Mainly Beta;Roll;Luciferase; domain 3;Luciferase; Domain 3 0.9278 340 410 2.30.38.10
3ivrB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;ANL, N-terminal domain 0.9219 5 412 3.40.50.12780
ID Description Score Start End GO Terms
AF-X0Y3T5-F1-model_v4 AMP-dependent synthetase/ligase domain-containing protein 0.9449 338 410
AF-A0A538IHP9-F1-model_v4 Fatty acid--CoA ligase family protein 0.9402 7 107 GO:0016874
AF-A0A1M5BJV3-F1-model_v4 AMP-binding enzyme 0.9273 6 116
AF-A0A0F4IVL8-F1-model_v4 deleted 0.9148 1 107
AF-A0A533VPQ0-F1-model_v4 Long-chain fatty acid--CoA ligase 0.9071 6 413 GO:0016874

Map