F477659
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 726 | 291 | 702 | 153 |
Family's Representative Sequence
| Representative Sequence | 3300005333|Ga0070677_10001704|Ga0070677_100017045 |
| Length | 177 |
| Sequence | MAKVYSAALDLTTEPGIRPVYSVRRMRIALAADHAGFELKQQMGAYLTRQGHDVVDLGTHSTAPVDYPDSAEAVAQTIFDGHADRGVIVCGSGAGVSIAANKFPGIRAAVCHDTYTAHQAVEHDDMNVLCVGSRVIGSALACEIVDAFLRAQFSHEDRHQRRLNKIFAIERRFVVRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 3 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 4 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 5 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 6 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 7 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 8 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 9 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 10 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 11 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 12 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 13 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 14 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 15 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 16 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 17 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 18 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 19 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 20 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 21 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 22 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 23 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 24 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 25 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 26 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 27 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 62 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 77 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 78 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 80 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 81 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 82 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 83 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 84 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 85 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 86 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 87 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 88 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 89 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 90 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 91 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 96 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 120 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 184 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 193 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 208 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 209 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 210 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 213 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 214 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 215 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 216 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 217 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 218 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 219 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 220 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 221 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 222 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 223 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 224 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 225 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 229 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 244 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 245 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 246 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 247 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 248 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 249 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 250 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 251 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 252 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 253 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 254 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 270 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 271 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 272 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 273 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 274 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 275 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 278 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 290 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 291 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.69 |
| Metatranscriptomes | 0 |
| Isolates | 3.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.28 |
| Nodule | 0.55 |
| Rhizoplane | 1.93 |
| Rhizosphere | 91.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C7209 | 2010549000 | Bacteria | 1650 |
| 2 | JGI24746J21847_1004962 | 3300001977 | Unclassified | 2085 |
| 3 | JGI24750J21931_1031514 | 3300002070 | Unclassified | 779 |
| 4 | JGI24748J21848_1024759 | 3300002074 | Unclassified | 731 |
| 5 | Ga0058692_1010703 | 3300003856 | Bacteria | 2256 |
| 6 | Ga0065714_10153851 | 3300005288 | Bacteria | 1090 |
| 7 | Ga0065712_10006027 | 3300005290 | Bacteria | 2886 |
| 8 | Ga0065712_10083231 | 3300005290 | Bacteria | 2853 |
| 9 | Ga0065712_10139486 | 3300005290 | Bacteria | 1460 |
| 10 | Ga0065712_10230042 | 3300005290 | Bacteria | 1014 |
| 11 | Ga0065715_10003216 | 3300005293 | Bacteria | 6801 |
| 12 | Ga0065715_10091582 | 3300005293 | Bacteria | 5690 |
| 13 | Ga0065715_10357900 | 3300005293 | Bacteria | 922 |
| 14 | Ga0065707_10262348 | 3300005295 | Bacteria | 1079 |
| 15 | Ga0065707_10587687 | 3300005295 | Bacteria | 698 |
| 16 | Ga0070676_10001803 | 3300005328 | Bacteria | 10896 |
| 17 | Ga0070676_10011233 | 3300005328 | Bacteria | 4870 |
| 18 | Ga0070676_10029452 | 3300005328 | Bacteria | 3122 |
| 19 | Ga0070683_100153201 | 3300005329 | Bacteria | 2185 |
| 20 | Ga0070683_100460795 | 3300005329 | Bacteria | 1213 |
| 21 | Ga0070690_100013980 | 3300005330 | Bacteria | 4759 |
| 22 | Ga0070690_100015578 | 3300005330 | Bacteria | 4540 |
| 23 | Ga0070690_100307723 | 3300005330 | Bacteria | 1138 |
| 24 | Ga0070670_100018731 | 3300005331 | Bacteria | 5935 |
| 25 | Ga0070670_100021290 | 3300005331 | Bacteria | 5578 |
| 26 | Ga0070670_100118295 | 3300005331 | Bacteria | 2285 |
| 27 | Ga0070670_100763984 | 3300005331 | Unclassified | 871 |
| 28 | Ga0070677_10001704 | 3300005333 | Bacteria | 6959 |
| 29 | Ga0070677_10016661 | 3300005333 | Bacteria | 2619 |
| 30 | Ga0070677_10019971 | 3300005333 | Bacteria | 2435 |
| 31 | Ga0070677_10070904 | 3300005333 | Bacteria | 1466 |
| 32 | Ga0070677_10447767 | 3300005333 | Bacteria | 690 |
| 33 | Ga0070677_10456214 | 3300005333 | Unclassified | 685 |
| 34 | Ga0068869_100001451 | 3300005334 | Bacteria | 14018 |
| 35 | Ga0068869_100074093 | 3300005334 | Bacteria | 2526 |
| 36 | Ga0070666_10038935 | 3300005335 | Bacteria | 3165 |
| 37 | Ga0070666_10602350 | 3300005335 | Bacteria | 802 |
| 38 | Ga0070666_10777080 | 3300005335 | Bacteria | 705 |
| 39 | Ga0070666_11074445 | 3300005335 | Unclassified | 598 |
| 40 | Ga0068868_100100155 | 3300005338 | Bacteria | 2344 |
| 41 | Ga0068868_100139496 | 3300005338 | Bacteria | 1989 |
| 42 | Ga0070689_100065087 | 3300005340 | Bacteria | 2838 |
| 43 | Ga0070689_100077049 | 3300005340 | Bacteria | 2612 |
| 44 | Ga0070689_100107321 | 3300005340 | Bacteria | 2217 |
| 45 | Ga0070689_101234337 | 3300005340 | Unclassified | 672 |
| 46 | Ga0070691_10096726 | 3300005341 | Bacteria | 1462 |
| 47 | Ga0070687_100022049 | 3300005343 | Bacteria | 3005 |
| 48 | Ga0070687_100135038 | 3300005343 | Bacteria | 1429 |
| 49 | Ga0070661_100028138 | 3300005344 | Bacteria | 4053 |
| 50 | Ga0070661_100038268 | 3300005344 | Bacteria | 3491 |
| 51 | Ga0070661_100269055 | 3300005344 | Unclassified | 1319 |
| 52 | Ga0070692_10047812 | 3300005345 | Bacteria | 2215 |
| 53 | Ga0070668_100007025 | 3300005347 | Bacteria | 8342 |
| 54 | Ga0070668_100149585 | 3300005347 | Bacteria | 1887 |
| 55 | Ga0070668_100538501 | 3300005347 | Bacteria | 1015 |
| 56 | Ga0070669_100017527 | 3300005353 | Bacteria | 5108 |
| 57 | Ga0070669_100019575 | 3300005353 | Bacteria | 4834 |
| 58 | Ga0070669_100031277 | 3300005353 | Bacteria | 3845 |
| 59 | Ga0070669_100079044 | 3300005353 | Bacteria | 2445 |
| 60 | Ga0070669_100102313 | 3300005353 | Bacteria | 2163 |
| 61 | Ga0070669_100162736 | 3300005353 | Unclassified | 1735 |
| 62 | Ga0070669_100181322 | 3300005353 | Bacteria | 1647 |
| 63 | Ga0070669_100230981 | 3300005353 | Unclassified | 1466 |
| 64 | Ga0070669_100612755 | 3300005353 | Bacteria | 913 |
| 65 | Ga0070675_100001179 | 3300005354 | Bacteria | 18976 |
| 66 | Ga0070675_100001525 | 3300005354 | Bacteria | 17133 |
| 67 | Ga0070675_100001605 | 3300005354 | Bacteria | 16679 |
| 68 | Ga0070675_100002993 | 3300005354 | Bacteria | 12766 |
| 69 | Ga0070675_100006002 | 3300005354 | Bacteria | 9309 |
| 70 | Ga0070675_100041401 | 3300005354 | Bacteria | 3763 |
| 71 | Ga0070675_100084418 | 3300005354 | Bacteria | 2652 |
| 72 | Ga0070675_100093838 | 3300005354 | Bacteria | 2517 |
| 73 | Ga0070675_100537906 | 3300005354 | Bacteria | 1055 |
| 74 | Ga0070675_100556280 | 3300005354 | Bacteria | 1038 |
| 75 | Ga0070675_101164549 | 3300005354 | Bacteria | 709 |
| 76 | Ga0070671_100014421 | 3300005355 | Bacteria | 6386 |
| 77 | Ga0070671_100027688 | 3300005355 | Bacteria | 4666 |
| 78 | Ga0070671_100838867 | 3300005355 | Bacteria | 801 |
| 79 | Ga0070674_100001218 | 3300005356 | Bacteria | 13509 |
| 80 | Ga0070674_100023270 | 3300005356 | Bacteria | 4007 |
| 81 | Ga0070674_100203049 | 3300005356 | Unclassified | 1532 |
| 82 | Ga0070674_100458571 | 3300005356 | Unclassified | 1053 |
| 83 | Ga0070674_100671268 | 3300005356 | Unclassified | 883 |
| 84 | Ga0070673_100005331 | 3300005364 | Bacteria | 8210 |
| 85 | Ga0070673_100005380 | 3300005364 | Bacteria | 8182 |
| 86 | Ga0070673_100041029 | 3300005364 | Bacteria | 3554 |
| 87 | Ga0070673_100058601 | 3300005364 | Bacteria | 3045 |
| 88 | Ga0070673_100061220 | 3300005364 | Bacteria | 2986 |
| 89 | Ga0070673_100107103 | 3300005364 | Bacteria | 2312 |
| 90 | Ga0070673_100269605 | 3300005364 | Bacteria | 1489 |
| 91 | Ga0070673_100542719 | 3300005364 | Bacteria | 1055 |
| 92 | Ga0070673_100770985 | 3300005364 | Bacteria | 887 |
| 93 | Ga0070688_100015922 | 3300005365 | Bacteria | 4288 |
| 94 | Ga0070688_100078062 | 3300005365 | Bacteria | 2135 |
| 95 | Ga0070688_100143865 | 3300005365 | Bacteria | 1623 |
| 96 | Ga0070659_100056589 | 3300005366 | Bacteria | 3092 |
| 97 | Ga0070659_100160483 | 3300005366 | Bacteria | 1838 |
| 98 | Ga0070667_100008511 | 3300005367 | Bacteria | 8505 |
| 99 | Ga0070667_100145274 | 3300005367 | Unclassified | 2080 |
| 100 | Ga0070703_10136695 | 3300005406 | Bacteria | 906 |
| 101 | Ga0070701_10053071 | 3300005438 | Bacteria | 2109 |
| 102 | Ga0070701_10213041 | 3300005438 | Unclassified | 1148 |
| 103 | Ga0070701_10322737 | 3300005438 | Unclassified | 956 |
| 104 | Ga0070700_100006546 | 3300005441 | Bacteria | 6231 |
| 105 | Ga0070700_100040351 | 3300005441 | Bacteria | 2856 |
| 106 | Ga0070700_100192320 | 3300005441 | Bacteria | 1427 |
| 107 | Ga0070700_100387809 | 3300005441 | Bacteria | 1047 |
| 108 | Ga0070694_100198467 | 3300005444 | Bacteria | 1494 |
| 109 | Ga0070694_101285768 | 3300005444 | Bacteria | 615 |
| 110 | Ga0070663_100067841 | 3300005455 | Bacteria | 2589 |
| 111 | Ga0070663_100359417 | 3300005455 | Bacteria | 1181 |
| 112 | Ga0070678_100002418 | 3300005456 | Bacteria | 10229 |
| 113 | Ga0070678_100116757 | 3300005456 | Bacteria | 2097 |
| 114 | Ga0070678_100120593 | 3300005456 | Bacteria | 2067 |
| 115 | Ga0070678_100227524 | 3300005456 | Bacteria | 1553 |
| 116 | Ga0070678_100431331 | 3300005456 | Bacteria | 1151 |
| 117 | Ga0070662_100171368 | 3300005457 | Bacteria | 1705 |
| 118 | Ga0070662_100290512 | 3300005457 | Bacteria | 1325 |
| 119 | Ga0068867_100005657 | 3300005459 | Bacteria | 8863 |
| 120 | Ga0068867_100049711 | 3300005459 | Bacteria | 3087 |
| 121 | Ga0068867_100089462 | 3300005459 | Bacteria | 2334 |
| 122 | Ga0070685_10003652 | 3300005466 | Bacteria | 7805 |
| 123 | Ga0070706_101132316 | 3300005467 | Bacteria | 720 |
| 124 | Ga0070707_101712296 | 3300005468 | Bacteria | 596 |
| 125 | Ga0070698_100493644 | 3300005471 | Bacteria | 1162 |
| 126 | Ga0070699_100010424 | 3300005518 | Bacteria | 8044 |
| 127 | Ga0070699_100384682 | 3300005518 | Bacteria | 1267 |
| 128 | Ga0070699_100405400 | 3300005518 | Bacteria | 1233 |
| 129 | Ga0070679_100624897 | 3300005530 | Bacteria | 1020 |
| 130 | Ga0070697_100070893 | 3300005536 | Bacteria | 2858 |
| 131 | Ga0070697_100789195 | 3300005536 | Bacteria | 840 |
| 132 | Ga0070672_100043126 | 3300005543 | Unclassified | 3476 |
| 133 | Ga0070672_100048076 | 3300005543 | Bacteria | 3313 |
| 134 | Ga0070672_100083932 | 3300005543 | Bacteria | 2557 |
| 135 | Ga0070672_100088957 | 3300005543 | Bacteria | 2487 |
| 136 | Ga0070672_100147289 | 3300005543 | Bacteria | 1946 |
| 137 | Ga0070672_100432042 | 3300005543 | Bacteria | 1132 |
| 138 | Ga0070672_100822524 | 3300005543 | Bacteria | 818 |
| 139 | Ga0070686_100002140 | 3300005544 | Bacteria | 10884 |
| 140 | Ga0070686_100102268 | 3300005544 | Bacteria | 1938 |
| 141 | Ga0070695_100404924 | 3300005545 | Bacteria | 1035 |
| 142 | Ga0070696_100619570 | 3300005546 | Bacteria | 874 |
| 143 | Ga0070665_100000936 | 3300005548 | Bacteria | 37365 |
| 144 | Ga0070665_100499857 | 3300005548 | Unclassified | 1227 |
| 145 | Ga0070704_100038367 | 3300005549 | Bacteria | 3281 |
| 146 | Ga0070704_100102018 | 3300005549 | Bacteria | 2164 |
| 147 | Ga0070704_100469227 | 3300005549 | Bacteria | 1087 |
| 148 | Ga0070664_100008661 | 3300005564 | Bacteria | 8233 |
| 149 | Ga0070664_100011840 | 3300005564 | Bacteria | 7081 |
| 150 | Ga0070664_100018755 | 3300005564 | Bacteria | 5691 |
| 151 | Ga0070664_100023467 | 3300005564 | Bacteria | 5096 |
| 152 | Ga0070664_100646018 | 3300005564 | Unclassified | 983 |
| 153 | Ga0068857_100137571 | 3300005577 | Unclassified | 2206 |
| 154 | Ga0068857_100535873 | 3300005577 | Bacteria | 1102 |
| 155 | Ga0068854_100240643 | 3300005578 | Bacteria | 1441 |
| 156 | Ga0070702_100091704 | 3300005615 | Bacteria | 1844 |
| 157 | Ga0070702_100268119 | 3300005615 | Unclassified | 1166 |
| 158 | Ga0068852_100470248 | 3300005616 | Bacteria | 1248 |
| 159 | Ga0068859_100032983 | 3300005617 | Bacteria | 5202 |
| 160 | Ga0068859_100078453 | 3300005617 | Bacteria | 3343 |
| 161 | Ga0068859_100079161 | 3300005617 | Bacteria | 3326 |
| 162 | Ga0068859_100149357 | 3300005617 | Bacteria | 2412 |
| 163 | Ga0068859_100296970 | 3300005617 | Bacteria | 1709 |
| 164 | Ga0068859_100695037 | 3300005617 | Unclassified | 1108 |
| 165 | Ga0068859_101519377 | 3300005617 | Bacteria | 739 |
| 166 | Ga0068859_101946027 | 3300005617 | Bacteria | 649 |
| 167 | Ga0068864_100034893 | 3300005618 | Bacteria | 4281 |
| 168 | Ga0068864_100113074 | 3300005618 | Bacteria | 2420 |
| 169 | Ga0068864_100149930 | 3300005618 | Bacteria | 2112 |
| 170 | Ga0068864_100179373 | 3300005618 | Bacteria | 1935 |
| 171 | Ga0068864_100577556 | 3300005618 | Bacteria | 1089 |
| 172 | Ga0068866_10016871 | 3300005718 | Bacteria | 3274 |
| 173 | Ga0068866_10020245 | 3300005718 | Bacteria | 3046 |
| 174 | Ga0068866_10088854 | 3300005718 | Bacteria | 1678 |
| 175 | Ga0068861_100001769 | 3300005719 | Bacteria | 13895 |
| 176 | Ga0068861_100035452 | 3300005719 | Bacteria | 3695 |
| 177 | Ga0068861_100114692 | 3300005719 | Unclassified | 2164 |
| 178 | Ga0068861_100167128 | 3300005719 | Bacteria | 1820 |
| 179 | Ga0068861_100339224 | 3300005719 | Bacteria | 1315 |
| 180 | Ga0068861_100795250 | 3300005719 | Bacteria | 887 |
| 181 | Ga0068870_10000294 | 3300005840 | Bacteria | 18487 |
| 182 | Ga0068870_10014325 | 3300005840 | Bacteria | 3745 |
| 183 | Ga0068870_10221415 | 3300005840 | Bacteria | 1158 |
| 184 | Ga0068870_10286436 | 3300005840 | Bacteria | 1035 |
| 185 | Ga0068863_100012272 | 3300005841 | Bacteria | 8273 |
| 186 | Ga0068863_100457180 | 3300005841 | Bacteria | 1253 |
| 187 | Ga0068858_100025311 | 3300005842 | Bacteria | 5522 |
| 188 | Ga0068858_101183928 | 3300005842 | Unclassified | 751 |
| 189 | Ga0068860_100010293 | 3300005843 | Bacteria | 9251 |
| 190 | Ga0068860_100560539 | 3300005843 | Unclassified | 1145 |
| 191 | Ga0068860_102075576 | 3300005843 | Unclassified | 590 |
| 192 | Ga0068862_100004508 | 3300005844 | Bacteria | 11744 |
| 193 | Ga0068862_100428228 | 3300005844 | Bacteria | 1243 |
| 194 | Ga0068862_100458063 | 3300005844 | Unclassified | 1203 |
| 195 | Ga0068862_100504247 | 3300005844 | Unclassified | 1149 |
| 196 | Ga0068862_101315279 | 3300005844 | Bacteria | 724 |
| 197 | Ga0068862_101574063 | 3300005844 | Bacteria | 664 |
| 198 | Ga0081455_10018672 | 3300005937 | Bacteria | 6588 |
| 199 | Ga0075364_10013924 | 3300006051 | Bacteria | 4957 |
| 200 | Ga0075432_10151231 | 3300006058 | Bacteria | 892 |
| 201 | Ga0097621_100020236 | 3300006237 | Bacteria | 5126 |
| 202 | Ga0097621_102110613 | 3300006237 | Bacteria | 539 |
| 203 | Ga0068871_101066518 | 3300006358 | Unclassified | 755 |
| 204 | Ga0068871_101727700 | 3300006358 | Bacteria | 594 |
| 205 | Ga0075428_100001914 | 3300006844 | Bacteria | 22338 |
| 206 | Ga0075428_100003245 | 3300006844 | Bacteria | 17800 |
| 207 | Ga0075428_100053787 | 3300006844 | Bacteria | 4412 |
| 208 | Ga0075428_100055045 | 3300006844 | Bacteria | 4360 |
| 209 | Ga0075428_100301188 | 3300006844 | Bacteria | 1723 |
| 210 | Ga0075428_100375660 | 3300006844 | Bacteria | 1524 |
| 211 | Ga0075428_100965784 | 3300006844 | Unclassified | 903 |
| 212 | Ga0075430_100008097 | 3300006846 | Bacteria | 8884 |
| 213 | Ga0075430_100008767 | 3300006846 | Bacteria | 8534 |
| 214 | Ga0075430_100017358 | 3300006846 | Bacteria | 6130 |
| 215 | Ga0075430_100185512 | 3300006846 | Unclassified | 1730 |
| 216 | Ga0075431_100020297 | 3300006847 | Bacteria | 6787 |
| 217 | Ga0075431_100050732 | 3300006847 | Bacteria | 4278 |
| 218 | Ga0075431_100254018 | 3300006847 | Bacteria | 1785 |
| 219 | Ga0075431_100338840 | 3300006847 | Bacteria | 1513 |
| 220 | Ga0075433_10003776 | 3300006852 | Bacteria | 11725 |
| 221 | Ga0075433_10012257 | 3300006852 | Bacteria | 6914 |
| 222 | Ga0075433_10160450 | 3300006852 | Bacteria | 2001 |
| 223 | Ga0075434_100002389 | 3300006871 | Bacteria | 16482 |
| 224 | Ga0075434_100004765 | 3300006871 | Bacteria | 12281 |
| 225 | Ga0075434_100193277 | 3300006871 | Unclassified | 2055 |
| 226 | Ga0075434_100241783 | 3300006871 | Unclassified | 1825 |
| 227 | Ga0075429_100014564 | 3300006880 | Bacteria | 6815 |
| 228 | Ga0075429_100017259 | 3300006880 | Bacteria | 6242 |
| 229 | Ga0075429_100063369 | 3300006880 | Unclassified | 3221 |
| 230 | Ga0075429_100082120 | 3300006880 | Bacteria | 2809 |
| 231 | Ga0075429_100132770 | 3300006880 | Bacteria | 2178 |
| 232 | Ga0075429_100186601 | 3300006880 | Bacteria | 1817 |
| 233 | Ga0068865_100005969 | 3300006881 | Bacteria | 7421 |
| 234 | Ga0068865_100013650 | 3300006881 | Bacteria | 5142 |
| 235 | Ga0068865_100085681 | 3300006881 | Bacteria | 2273 |
| 236 | Ga0068865_101106331 | 3300006881 | Unclassified | 698 |
| 237 | Ga0097620_100032982 | 3300006931 | Bacteria | 5202 |
| 238 | Ga0097620_100078451 | 3300006931 | Bacteria | 3343 |
| 239 | Ga0097620_100079160 | 3300006931 | Bacteria | 3326 |
| 240 | Ga0097620_100149357 | 3300006931 | Bacteria | 2412 |
| 241 | Ga0097620_100296976 | 3300006931 | Bacteria | 1709 |
| 242 | Ga0097620_100695033 | 3300006931 | Unclassified | 1108 |
| 243 | Ga0097620_101519209 | 3300006931 | Bacteria | 739 |
| 244 | Ga0097620_101945913 | 3300006931 | Bacteria | 649 |
| 245 | Ga0079104_1000107 | 3300006946 | Bacteria | 122549 |
| 246 | Ga0079104_1000113 | 3300006946 | Bacteria | 116001 |
| 247 | Ga0075435_100014136 | 3300007076 | Bacteria | 5957 |
| 248 | Ga0075435_101224708 | 3300007076 | Bacteria | 657 |
| 249 | Ga0105251_10000273 | 3300009011 | Bacteria | 51739 |
| 250 | Ga0105251_10001705 | 3300009011 | Bacteria | 18401 |
| 251 | Ga0105251_10006895 | 3300009011 | Bacteria | 7127 |
| 252 | Ga0105251_10077069 | 3300009011 | Bacteria | 1546 |
| 253 | Ga0105251_10157986 | 3300009011 | Bacteria | 1022 |
| 254 | Ga0105244_10002761 | 3300009036 | Bacteria | 13093 |
| 255 | Ga0105244_10002809 | 3300009036 | Bacteria | 12928 |
| 256 | Ga0105250_10000057 | 3300009092 | Bacteria | 112440 |
| 257 | Ga0111539_10000065 | 3300009094 | Bacteria | 106698 |
| 258 | Ga0111539_10001128 | 3300009094 | Bacteria | 35328 |
| 259 | Ga0111539_10003932 | 3300009094 | Bacteria | 19530 |
| 260 | Ga0111539_10010451 | 3300009094 | Bacteria | 11682 |
| 261 | Ga0111539_10029612 | 3300009094 | Bacteria | 6665 |
| 262 | Ga0111539_10123724 | 3300009094 | Bacteria | 3032 |
| 263 | Ga0111539_10128168 | 3300009094 | Bacteria | 2972 |
| 264 | Ga0111539_10132048 | 3300009094 | Bacteria | 2924 |
| 265 | Ga0111539_10454386 | 3300009094 | Bacteria | 1492 |
| 266 | Ga0111539_11593827 | 3300009094 | Unclassified | 757 |
| 267 | Ga0111539_13426845 | 3300009094 | Unclassified | 510 |
| 268 | Ga0105245_10439202 | 3300009098 | Bacteria | 1311 |
| 269 | Ga0105245_10530098 | 3300009098 | Bacteria | 1197 |
| 270 | Ga0105247_10121777 | 3300009101 | Bacteria | 1691 |
| 271 | Ga0105247_10715924 | 3300009101 | Bacteria | 755 |
| 272 | Ga0114129_10007052 | 3300009147 | Bacteria | 15997 |
| 273 | Ga0114129_10013734 | 3300009147 | Bacteria | 11544 |
| 274 | Ga0114129_10069282 | 3300009147 | Bacteria | 4917 |
| 275 | Ga0114129_10086513 | 3300009147 | Bacteria | 4347 |
| 276 | Ga0114129_10904545 | 3300009147 | Bacteria | 1118 |
| 277 | Ga0114129_10948927 | 3300009147 | Bacteria | 1087 |
| 278 | Ga0105243_10368431 | 3300009148 | Bacteria | 1325 |
| 279 | Ga0105243_10528754 | 3300009148 | Bacteria | 1123 |
| 280 | Ga0105243_12261467 | 3300009148 | Unclassified | 581 |
| 281 | Ga0105242_10089084 | 3300009176 | Bacteria | 2593 |
| 282 | Ga0105242_10921389 | 3300009176 | Bacteria | 876 |
| 283 | Ga0105248_10132152 | 3300009177 | Bacteria | 2816 |
| 284 | Ga0105248_10175637 | 3300009177 | Bacteria | 2414 |
| 285 | Ga0105237_11289279 | 3300009545 | Bacteria | 737 |
| 286 | Ga0105238_10018652 | 3300009551 | Bacteria | 7064 |
| 287 | Ga0105249_10001042 | 3300009553 | Bacteria | 24508 |
| 288 | Ga0105249_10709088 | 3300009553 | Unclassified | 1067 |
| 289 | Ga0099796_10018538 | 3300010159 | Unclassified | 2093 |
| 290 | Ga0105246_10066755 | 3300011119 | Bacteria | 2519 |
| 291 | Ga0105246_10728112 | 3300011119 | Bacteria | 872 |
| 292 | Ga0157319_1020816 | 3300012497 | Bacteria | 635 |
| 293 | Ga0157315_1007777 | 3300012508 | Bacteria | 879 |
| 294 | Ga0157373_10281616 | 3300013100 | Bacteria | 1178 |
| 295 | Ga0157371_10069695 | 3300013102 | Bacteria | 2490 |
| 296 | Ga0157370_10004416 | 3300013104 | Bacteria | 16115 |
| 297 | Ga0157374_10059837 | 3300013296 | Bacteria | 3563 |
| 298 | Ga0157374_10069372 | 3300013296 | Bacteria | 3319 |
| 299 | Ga0157374_10888260 | 3300013296 | Bacteria | 909 |
| 300 | Ga0157378_10308181 | 3300013297 | Bacteria | 1535 |
| 301 | Ga0157378_12666120 | 3300013297 | Unclassified | 552 |
| 302 | Ga0163162_10003027 | 3300013306 | Bacteria | 16062 |
| 303 | Ga0163162_10325311 | 3300013306 | Unclassified | 1670 |
| 304 | Ga0163162_12864463 | 3300013306 | Unclassified | 555 |
| 305 | Ga0157375_10025152 | 3300013308 | Bacteria | 5524 |
| 306 | Ga0157375_10209635 | 3300013308 | Bacteria | 2106 |
| 307 | Ga0157375_10286120 | 3300013308 | Bacteria | 1811 |
| 308 | Ga0157375_10924287 | 3300013308 | Bacteria | 1015 |
| 309 | Ga0157375_10983940 | 3300013308 | Bacteria | 984 |
| 310 | Ga0157375_11216360 | 3300013308 | Bacteria | 884 |
| 311 | Ga0157375_11736685 | 3300013308 | Bacteria | 739 |
| 312 | Ga0163163_10029464 | 3300014325 | Bacteria | 5281 |
| 313 | Ga0163163_10050630 | 3300014325 | Bacteria | 4090 |
| 314 | Ga0163163_10377985 | 3300014325 | Bacteria | 1474 |
| 315 | Ga0157380_10009450 | 3300014326 | Bacteria | 6986 |
| 316 | Ga0157380_10045860 | 3300014326 | Bacteria | 3433 |
| 317 | Ga0157380_10069366 | 3300014326 | Bacteria | 2844 |
| 318 | Ga0157380_10074956 | 3300014326 | Bacteria | 2749 |
| 319 | Ga0157380_10095697 | 3300014326 | Unclassified | 2461 |
| 320 | Ga0157380_10110572 | 3300014326 | Bacteria | 2308 |
| 321 | Ga0157380_10217281 | 3300014326 | Bacteria | 1708 |
| 322 | Ga0157380_10427951 | 3300014326 | Bacteria | 1264 |
| 323 | Ga0157380_11038230 | 3300014326 | Bacteria | 855 |
| 324 | Ga0157380_11800383 | 3300014326 | Bacteria | 671 |
| 325 | Ga0157377_10004519 | 3300014745 | Bacteria | 6421 |
| 326 | Ga0157377_10044839 | 3300014745 | Unclassified | 2467 |
| 327 | Ga0157377_10108759 | 3300014745 | Bacteria | 1663 |
| 328 | Ga0157377_10123198 | 3300014745 | Bacteria | 1574 |
| 329 | Ga0157377_10223128 | 3300014745 | Unclassified | 1208 |
| 330 | Ga0157379_10003743 | 3300014968 | Bacteria | 12937 |
| 331 | Ga0157379_10131137 | 3300014968 | Bacteria | 2256 |
| 332 | Ga0157376_10705222 | 3300014969 | Bacteria | 1015 |
| 333 | Ga0157376_11878163 | 3300014969 | Bacteria | 636 |
| 334 | Ga0163161_10006354 | 3300017792 | Bacteria | 8176 |
| 335 | Ga0213876_10383765 | 3300021384 | Unclassified | 747 |
| 336 | Ga0207673_1030846 | 3300025290 | Bacteria | 742 |
| 337 | Ga0207697_10000085 | 3300025315 | Bacteria | 41401 |
| 338 | Ga0207697_10089054 | 3300025315 | Bacteria | 1307 |
| 339 | Ga0207696_1000049 | 3300025711 | Bacteria | 281296 |
| 340 | Ga0207655_1001063 | 3300025728 | Bacteria | 27348 |
| 341 | Ga0207655_1006353 | 3300025728 | Bacteria | 7843 |
| 342 | Ga0207713_1000105 | 3300025735 | Bacteria | 138195 |
| 343 | Ga0207713_1000111 | 3300025735 | Bacteria | 133625 |
| 344 | Ga0207713_1020893 | 3300025735 | Bacteria | 3154 |
| 345 | Ga0207713_1098683 | 3300025735 | Bacteria | 1012 |
| 346 | Ga0207713_1223296 | 3300025735 | Bacteria | 567 |
| 347 | Ga0207653_10215231 | 3300025885 | Bacteria | 728 |
| 348 | Ga0207653_10222722 | 3300025885 | Bacteria | 717 |
| 349 | Ga0207682_10005915 | 3300025893 | Bacteria | 4950 |
| 350 | Ga0207682_10021779 | 3300025893 | Bacteria | 2522 |
| 351 | Ga0207682_10067630 | 3300025893 | Bacteria | 1508 |
| 352 | Ga0207682_10174524 | 3300025893 | Bacteria | 979 |
| 353 | Ga0207642_10038792 | 3300025899 | Unclassified | 2064 |
| 354 | Ga0207710_10065406 | 3300025900 | Bacteria | 1657 |
| 355 | Ga0207688_10000477 | 3300025901 | Bacteria | 19238 |
| 356 | Ga0207688_10013379 | 3300025901 | Bacteria | 4457 |
| 357 | Ga0207688_10129377 | 3300025901 | Bacteria | 1479 |
| 358 | Ga0207688_10196070 | 3300025901 | Bacteria | 1209 |
| 359 | Ga0207680_10067608 | 3300025903 | Bacteria | 2202 |
| 360 | Ga0207680_10294839 | 3300025903 | Bacteria | 1129 |
| 361 | Ga0207680_10365300 | 3300025903 | Bacteria | 1015 |
| 362 | Ga0207647_10263199 | 3300025904 | Bacteria | 987 |
| 363 | Ga0207645_10003970 | 3300025907 | Bacteria | 11042 |
| 364 | Ga0207645_10051127 | 3300025907 | Bacteria | 2640 |
| 365 | Ga0207645_10117354 | 3300025907 | Bacteria | 1726 |
| 366 | Ga0207645_10435744 | 3300025907 | Bacteria | 884 |
| 367 | Ga0207643_10000621 | 3300025908 | Bacteria | 22386 |
| 368 | Ga0207643_10016413 | 3300025908 | Bacteria | 4040 |
| 369 | Ga0207643_10062822 | 3300025908 | Bacteria | 2122 |
| 370 | Ga0207643_10079881 | 3300025908 | Bacteria | 1894 |
| 371 | Ga0207643_10170537 | 3300025908 | Bacteria | 1313 |
| 372 | Ga0207662_10026171 | 3300025918 | Bacteria | 3364 |
| 373 | Ga0207662_10090519 | 3300025918 | Bacteria | 1881 |
| 374 | Ga0207662_10144691 | 3300025918 | Bacteria | 1508 |
| 375 | Ga0207662_10158149 | 3300025918 | Bacteria | 1446 |
| 376 | Ga0207649_10013216 | 3300025920 | Bacteria | 4607 |
| 377 | Ga0207646_11312930 | 3300025922 | Bacteria | 631 |
| 378 | Ga0207681_10010515 | 3300025923 | Bacteria | 5668 |
| 379 | Ga0207681_10015267 | 3300025923 | Bacteria | 4788 |
| 380 | Ga0207681_10056309 | 3300025923 | Bacteria | 2681 |
| 381 | Ga0207681_10062868 | 3300025923 | Bacteria | 2558 |
| 382 | Ga0207681_10146646 | 3300025923 | Bacteria | 1764 |
| 383 | Ga0207681_10246435 | 3300025923 | Bacteria | 1393 |
| 384 | Ga0207681_10294491 | 3300025923 | Bacteria | 1282 |
| 385 | Ga0207681_10388804 | 3300025923 | Bacteria | 1124 |
| 386 | Ga0207681_10509707 | 3300025923 | Bacteria | 986 |
| 387 | Ga0207650_10013100 | 3300025925 | Bacteria | 5736 |
| 388 | Ga0207650_10025991 | 3300025925 | Bacteria | 4173 |
| 389 | Ga0207650_10042734 | 3300025925 | Bacteria | 3325 |
| 390 | Ga0207659_10000692 | 3300025926 | Bacteria | 20033 |
| 391 | Ga0207659_10002253 | 3300025926 | Bacteria | 11480 |
| 392 | Ga0207659_10002334 | 3300025926 | Bacteria | 11293 |
| 393 | Ga0207659_10005341 | 3300025926 | Bacteria | 7783 |
| 394 | Ga0207659_10005376 | 3300025926 | Bacteria | 7758 |
| 395 | Ga0207659_10009720 | 3300025926 | Bacteria | 6015 |
| 396 | Ga0207659_10059269 | 3300025926 | Bacteria | 2751 |
| 397 | Ga0207659_10614617 | 3300025926 | Bacteria | 927 |
| 398 | Ga0207687_10524784 | 3300025927 | Bacteria | 991 |
| 399 | Ga0207644_10023860 | 3300025931 | Bacteria | 4195 |
| 400 | Ga0207644_10041012 | 3300025931 | Bacteria | 3273 |
| 401 | Ga0207690_10929727 | 3300025932 | Unclassified | 722 |
| 402 | Ga0207706_10020983 | 3300025933 | Bacteria | 5867 |
| 403 | Ga0207706_10067256 | 3300025933 | Bacteria | 3152 |
| 404 | Ga0207706_11007238 | 3300025933 | Bacteria | 700 |
| 405 | Ga0207686_10008848 | 3300025934 | Bacteria | 5445 |
| 406 | Ga0207709_10000279 | 3300025935 | Bacteria | 58969 |
| 407 | Ga0207709_10107108 | 3300025935 | Bacteria | 1861 |
| 408 | Ga0207709_11219072 | 3300025935 | Unclassified | 620 |
| 409 | Ga0207670_10020894 | 3300025936 | Bacteria | 4030 |
| 410 | Ga0207670_10102115 | 3300025936 | Bacteria | 2050 |
| 411 | Ga0207670_10123319 | 3300025936 | Unclassified | 1887 |
| 412 | Ga0207670_10402231 | 3300025936 | Bacteria | 1095 |
| 413 | Ga0207669_10006212 | 3300025937 | Bacteria | 5439 |
| 414 | Ga0207669_10023277 | 3300025937 | Bacteria | 3306 |
| 415 | Ga0207669_10026241 | 3300025937 | Bacteria | 3165 |
| 416 | Ga0207669_10703087 | 3300025937 | Bacteria | 831 |
| 417 | Ga0207669_10937624 | 3300025937 | Bacteria | 725 |
| 418 | Ga0207669_10941425 | 3300025937 | Bacteria | 723 |
| 419 | Ga0207704_10033092 | 3300025938 | Bacteria | 2936 |
| 420 | Ga0207691_10011647 | 3300025940 | Bacteria | 8443 |
| 421 | Ga0207691_10013433 | 3300025940 | Bacteria | 7839 |
| 422 | Ga0207691_10014601 | 3300025940 | Bacteria | 7486 |
| 423 | Ga0207691_10024570 | 3300025940 | Bacteria | 5667 |
| 424 | Ga0207691_10042244 | 3300025940 | Bacteria | 4204 |
| 425 | Ga0207691_10128406 | 3300025940 | Bacteria | 2241 |
| 426 | Ga0207691_10384175 | 3300025940 | Bacteria | 1198 |
| 427 | Ga0207711_10524783 | 3300025941 | Bacteria | 1104 |
| 428 | Ga0207689_10000730 | 3300025942 | Bacteria | 31588 |
| 429 | Ga0207689_10001141 | 3300025942 | Bacteria | 25628 |
| 430 | Ga0207689_10429191 | 3300025942 | Unclassified | 1103 |
| 431 | Ga0207679_10060645 | 3300025945 | Bacteria | 2812 |
| 432 | Ga0207679_10135080 | 3300025945 | Unclassified | 1985 |
| 433 | Ga0207679_10201060 | 3300025945 | Unclassified | 1664 |
| 434 | Ga0207679_10204814 | 3300025945 | Bacteria | 1650 |
| 435 | Ga0207679_10445404 | 3300025945 | Unclassified | 1148 |
| 436 | Ga0207651_10010034 | 3300025960 | Bacteria | 5224 |
| 437 | Ga0207651_10019391 | 3300025960 | Bacteria | 4074 |
| 438 | Ga0207651_10143677 | 3300025960 | Bacteria | 1847 |
| 439 | Ga0207651_10155988 | 3300025960 | Bacteria | 1783 |
| 440 | Ga0207651_10279215 | 3300025960 | Bacteria | 1379 |
| 441 | Ga0207651_10296033 | 3300025960 | Bacteria | 1344 |
| 442 | Ga0207651_10500287 | 3300025960 | Unclassified | 1050 |
| 443 | Ga0207651_10737438 | 3300025960 | Bacteria | 870 |
| 444 | Ga0207712_11172752 | 3300025961 | Unclassified | 685 |
| 445 | Ga0207712_11298353 | 3300025961 | Bacteria | 650 |
| 446 | Ga0207668_10071060 | 3300025972 | Bacteria | 2485 |
| 447 | Ga0207668_10075524 | 3300025972 | Bacteria | 2423 |
| 448 | Ga0207668_10273445 | 3300025972 | Bacteria | 1382 |
| 449 | Ga0207668_11065095 | 3300025972 | Bacteria | 724 |
| 450 | Ga0207658_10009526 | 3300025986 | Bacteria | 6594 |
| 451 | Ga0207658_10137717 | 3300025986 | Bacteria | 1971 |
| 452 | Ga0207677_10127989 | 3300026023 | Bacteria | 1922 |
| 453 | Ga0207677_10254377 | 3300026023 | Bacteria | 1428 |
| 454 | Ga0207677_10430273 | 3300026023 | Bacteria | 1126 |
| 455 | Ga0207703_10130310 | 3300026035 | Bacteria | 2171 |
| 456 | Ga0207703_10898755 | 3300026035 | Unclassified | 848 |
| 457 | Ga0207678_10062622 | 3300026067 | Bacteria | 3197 |
| 458 | Ga0207708_10004080 | 3300026075 | Bacteria | 10735 |
| 459 | Ga0207708_10028056 | 3300026075 | Bacteria | 4263 |
| 460 | Ga0207708_10102407 | 3300026075 | Bacteria | 2217 |
| 461 | Ga0207708_10193451 | 3300026075 | Bacteria | 1620 |
| 462 | Ga0207708_10325607 | 3300026075 | Bacteria | 1255 |
| 463 | Ga0207641_10007106 | 3300026088 | Bacteria | 9351 |
| 464 | Ga0207641_10437609 | 3300026088 | Bacteria | 1262 |
| 465 | Ga0207641_11311625 | 3300026088 | Bacteria | 724 |
| 466 | Ga0207648_10004031 | 3300026089 | Bacteria | 15246 |
| 467 | Ga0207648_10017303 | 3300026089 | Bacteria | 6566 |
| 468 | Ga0207648_10065561 | 3300026089 | Bacteria | 3166 |
| 469 | Ga0207648_10239740 | 3300026089 | Bacteria | 1614 |
| 470 | Ga0207676_10014347 | 3300026095 | Bacteria | 5699 |
| 471 | Ga0207676_10052910 | 3300026095 | Bacteria | 3176 |
| 472 | Ga0207676_10074447 | 3300026095 | Bacteria | 2736 |
| 473 | Ga0207676_10118025 | 3300026095 | Bacteria | 2232 |
| 474 | Ga0207674_10190798 | 3300026116 | Bacteria | 1999 |
| 475 | Ga0207674_10260550 | 3300026116 | Bacteria | 1681 |
| 476 | Ga0207674_10384615 | 3300026116 | Unclassified | 1357 |
| 477 | Ga0207675_100011628 | 3300026118 | Bacteria | 8229 |
| 478 | Ga0207675_100019821 | 3300026118 | Bacteria | 6277 |
| 479 | Ga0207675_100063425 | 3300026118 | Bacteria | 3452 |
| 480 | Ga0207675_100065951 | 3300026118 | Bacteria | 3383 |
| 481 | Ga0207675_100230078 | 3300026118 | Bacteria | 1788 |
| 482 | Ga0207683_10001698 | 3300026121 | Bacteria | 19704 |
| 483 | Ga0207683_10045500 | 3300026121 | Bacteria | 3838 |
| 484 | Ga0207683_10065930 | 3300026121 | Bacteria | 3192 |
| 485 | Ga0207683_10344897 | 3300026121 | Bacteria | 1366 |
| 486 | Ga0207683_10590181 | 3300026121 | Unclassified | 1028 |
| 487 | Ga0207698_10067048 | 3300026142 | Bacteria | 2829 |
| 488 | Ga0209281_1000121 | 3300027111 | Bacteria | 205883 |
| 489 | Ga0209281_1000220 | 3300027111 | Bacteria | 122558 |
| 490 | Ga0209371_1000046 | 3300027312 | Bacteria | 306549 |
| 491 | Ga0209995_1043435 | 3300027471 | Bacteria | 760 |
| 492 | Ga0209983_1021183 | 3300027665 | Bacteria | 1358 |
| 493 | Ga0209974_10034958 | 3300027876 | Unclassified | 1668 |
| 494 | Ga0207428_10000345 | 3300027907 | Bacteria | 60424 |
| 495 | Ga0207428_10000936 | 3300027907 | Bacteria | 32455 |
| 496 | Ga0207428_10001419 | 3300027907 | Bacteria | 25210 |
| 497 | Ga0207428_10021344 | 3300027907 | Bacteria | 5484 |
| 498 | Ga0207428_10198661 | 3300027907 | Bacteria | 1509 |
| 499 | Ga0207428_10208783 | 3300027907 | Unclassified | 1468 |
| 500 | Ga0207428_10445993 | 3300027907 | Bacteria | 944 |
| 501 | Ga0207428_10825286 | 3300027907 | Unclassified | 658 |
| 502 | Ga0268266_10000179 | 3300028379 | Bacteria | 112622 |
| 503 | Ga0268266_10128409 | 3300028379 | Bacteria | 2265 |
| 504 | Ga0268265_10020045 | 3300028380 | Bacteria | 4660 |
| 505 | Ga0268265_10370622 | 3300028380 | Bacteria | 1314 |
| 506 | Ga0268265_10390580 | 3300028380 | Bacteria | 1283 |
| 507 | Ga0268265_10405794 | 3300028380 | Unclassified | 1261 |
| 508 | Ga0268265_10636131 | 3300028380 | Unclassified | 1024 |
| 509 | Ga0268265_11168192 | 3300028380 | Bacteria | 766 |
| 510 | Ga0268264_10034170 | 3300028381 | Bacteria | 4181 |
| 511 | Ga0268264_10086550 | 3300028381 | Bacteria | 2692 |
| 512 | Ga0268264_11251891 | 3300028381 | Unclassified | 752 |
| 513 | Ga0268264_11504774 | 3300028381 | Unclassified | 684 |
| 514 | Ga0268256_1000012 | 3300030500 | Bacteria | 794553 |
| 515 | Ga0265316_10005214 | 3300031344 | Bacteria | 12709 |
| 516 | Ga0307408_100043399 | 3300031548 | Bacteria | 3199 |
| 517 | Ga0316576_10522118 | 3300031727 | Bacteria | 872 |
| 518 | Ga0307405_10007377 | 3300031731 | Bacteria | 5493 |
| 519 | Ga0307405_10062237 | 3300031731 | Bacteria | 2362 |
| 520 | Ga0307413_10000281 | 3300031824 | Bacteria | 15624 |
| 521 | Ga0307413_10003677 | 3300031824 | Bacteria | 6515 |
| 522 | Ga0307410_10001116 | 3300031852 | Bacteria | 11737 |
| 523 | Ga0307410_10037158 | 3300031852 | Bacteria | 3178 |
| 524 | Ga0307410_10602543 | 3300031852 | Unclassified | 916 |
| 525 | Ga0307406_10025196 | 3300031901 | Bacteria | 3559 |
| 526 | Ga0307407_10000476 | 3300031903 | Bacteria | 12313 |
| 527 | Ga0307407_10003129 | 3300031903 | Bacteria | 6698 |
| 528 | Ga0307412_11372604 | 3300031911 | Bacteria | 638 |
| 529 | Ga0307412_12024752 | 3300031911 | Bacteria | 533 |
| 530 | Ga0307409_100034031 | 3300031995 | Bacteria | 3716 |
| 531 | Ga0307409_100533910 | 3300031995 | Bacteria | 1148 |
| 532 | Ga0307409_102521853 | 3300031995 | Unclassified | 543 |
| 533 | Ga0307416_100005491 | 3300032002 | Bacteria | 7790 |
| 534 | Ga0307416_100515664 | 3300032002 | Unclassified | 1263 |
| 535 | Ga0307414_10005544 | 3300032004 | Bacteria | 6960 |
| 536 | Ga0307414_10274610 | 3300032004 | Bacteria | 1413 |
| 537 | Ga0307414_10438564 | 3300032004 | Unclassified | 1143 |
| 538 | Ga0307414_11478359 | 3300032004 | Bacteria | 632 |
| 539 | Ga0307411_10004778 | 3300032005 | Bacteria | 6559 |
| 540 | Ga0307411_10038452 | 3300032005 | Bacteria | 3018 |
| 541 | Ga0307411_10058683 | 3300032005 | Bacteria | 2548 |
| 542 | Ga0307411_10082164 | 3300032005 | Bacteria | 2221 |
| 543 | Ga0307411_11240261 | 3300032005 | Bacteria | 677 |
| 544 | Ga0307415_100053252 | 3300032126 | Bacteria | 2756 |
| 545 | Ga0307415_100230738 | 3300032126 | Bacteria | 1490 |
| 546 | Ga0316583_10016559 | 3300032133 | Bacteria | 2653 |
| 547 | Ga0373958_0000446 | 3300034819 | Bacteria | 5048 |
| 548 | Ga0373959_0081535 | 3300034820 | Bacteria | 746 |
| 549 | Ga0373940_0021496 | 3300035088 | Bacteria | 1649 |
| 550 | Ga0373941_0063958 | 3300035115 | Bacteria | 1204 |
| 551 | Ga0316574_0154085 | 3300035398 | Bacteria | 1481 |
| 552 | Ga0436365_0951881 | 3300039437 | Unclassified | 1591 |
| 553 | Ga0436365_1565946 | 3300039437 | Bacteria | 4038 |
| 554 | Ga0439450_047153 | 3300042008 | Bacteria | 1015 |
| 555 | Ga0439452_000127 | 3300042010 | Bacteria | 58547 |
| 556 | Ga0450923_100480 | 3300042125 | Bacteria | 667 |
| 557 | Ga0450890_011237 | 3300042127 | Bacteria | 1155 |
| 558 | Ga0439446_0124927 | 3300042156 | Bacteria | 831 |
| 559 | Ga0439435_0016335 | 3300042436 | Unclassified | 1860 |
| 560 | Ga0439444_0034805 | 3300042437 | Bacteria | 963 |
| 561 | Ga0439464_0000268 | 3300042439 | Bacteria | 9702 |
| 562 | Ga0439464_0035573 | 3300042439 | Bacteria | 1407 |
| 563 | Ga0450918_034876 | 3300042531 | Bacteria | 894 |
| 564 | Ga0439440_0133066 | 3300042993 | Bacteria | 701 |
| 565 | Ga0466963_0026723 | 3300044694 | Bacteria | 3693 |
| 566 | Ga0466964_0093290 | 3300044706 | Bacteria | 1314 |
| 567 | Ga0466957_0095199 | 3300044842 | Bacteria | 1870 |
| 568 | Ga0451576_0039560 | 3300045051 | Bacteria | 4991 |
| 569 | Ga0466967_0484594 | 3300045976 | Bacteria | 1212 |
| 570 | Ga0495650_0012587 | 3300046471 | Bacteria | 4541 |
| 571 | Ga0495580_0702650 | 3300046472 | Bacteria | 662 |
| 572 | Ga0495598_0010801 | 3300046537 | Bacteria | 2197 |
| 573 | Ga0495621_0164547 | 3300046539 | Bacteria | 879 |
| 574 | Ga0495658_0872520 | 3300046683 | Unclassified | 575 |
| 575 | Ga0495671_0035129 | 3300046692 | Bacteria | 2547 |
| 576 | Ga0495679_031093 | 3300047446 | Bacteria | 1725 |
| 577 | Ga0496104_0056842 | 3300048907 | Bacteria | 3702 |
| 578 | Ga0496105_0183214 | 3300048908 | Bacteria | 1714 |
| 579 | Ga0496108_0267844 | 3300048911 | Bacteria | 1487 |
| 580 | Ga0496109_0119298 | 3300048912 | Bacteria | 2456 |
| 581 | Ga0496110_0474136 | 3300048913 | Bacteria | 1140 |
| 582 | Ga0496112_0725412 | 3300048915 | Unclassified | 921 |
| 583 | Ga0496113_0155747 | 3300048916 | Bacteria | 1804 |
| 584 | Ga0496116_0000854 | 3300048919 | Bacteria | 38099 |
| 585 | Ga0496116_0286995 | 3300048919 | Bacteria | 793 |
| 586 | Ga0496116_0421600 | 3300048919 | Bacteria | 582 |
| 587 | Ga0496117_0014636 | 3300048920 | Bacteria | 6746 |
| 588 | Ga0496117_0019737 | 3300048920 | Bacteria | 5523 |
| 589 | Ga0496117_0091762 | 3300048920 | Bacteria | 1952 |
| 590 | Ga0496117_0092891 | 3300048920 | Bacteria | 1937 |
| 591 | Ga0496118_0014184 | 3300048921 | Bacteria | 7473 |
| 592 | Ga0496118_0027919 | 3300048921 | Bacteria | 4766 |
| 593 | Ga0496119_0001986 | 3300048922 | Bacteria | 23211 |
| 594 | Ga0496119_0003423 | 3300048922 | Bacteria | 16479 |
| 595 | Ga0496119_0004874 | 3300048922 | Bacteria | 13139 |
| 596 | Ga0496119_0039265 | 3300048922 | Bacteria | 3043 |
| 597 | Ga0496120_0001616 | 3300048923 | Bacteria | 26133 |
| 598 | Ga0496120_0001967 | 3300048923 | Bacteria | 22449 |
| 599 | Ga0496120_0010047 | 3300048923 | Bacteria | 6644 |
| 600 | Ga0496120_0030080 | 3300048923 | Bacteria | 3306 |
| 601 | Ga0496121_0055686 | 3300048924 | Bacteria | 3292 |
| 602 | Ga0496121_0333953 | 3300048924 | Bacteria | 1015 |
| 603 | Ga0496122_0000726 | 3300048925 | Bacteria | 64443 |
| 604 | Ga0496122_0014742 | 3300048925 | Bacteria | 7536 |
| 605 | Ga0496122_0064596 | 3300048925 | Bacteria | 2661 |
| 606 | Ga0496122_0380652 | 3300048925 | Bacteria | 724 |
| 607 | Ga0496123_0000371 | 3300048926 | Bacteria | 84281 |
| 608 | Ga0496123_0018262 | 3300048926 | Bacteria | 5585 |
| 609 | Ga0496123_0078233 | 3300048926 | Bacteria | 2027 |
| 610 | Ga0496124_0132695 | 3300048927 | Bacteria | 1976 |
| 611 | Ga0496124_0173426 | 3300048927 | Bacteria | 1667 |
| 612 | Ga0496124_0335135 | 3300048927 | Bacteria | 1077 |
| 613 | Ga0496125_0002592 | 3300048928 | Bacteria | 23222 |
| 614 | Ga0496125_0035821 | 3300048928 | Bacteria | 4345 |
| 615 | Ga0496126_0002346 | 3300048929 | Bacteria | 25880 |
| 616 | Ga0496126_0023911 | 3300048929 | Bacteria | 5908 |
| 617 | Ga0496126_0069617 | 3300048929 | Bacteria | 3138 |
| 618 | Ga0496126_0282821 | 3300048929 | Bacteria | 1373 |
| 619 | Ga0496126_0466698 | 3300048929 | Bacteria | 1014 |
| 620 | Ga0496126_0475067 | 3300048929 | Bacteria | 1002 |
| 621 | Ga0501031_0433610 | 3300049568 | Bacteria | 849 |
| 622 | Ga0501032_0336641 | 3300049569 | Bacteria | 973 |
| 623 | Ga0501038_0082234 | 3300049574 | Bacteria | 2712 |
| 624 | Ga0501040_0054284 | 3300049576 | Bacteria | 2747 |
| 625 | Ga0501041_0241320 | 3300049577 | Unclassified | 1136 |
| 626 | Ga0501041_0612176 | 3300049577 | Bacteria | 695 |
| 627 | Ga0501042_0036839 | 3300049578 | Bacteria | 3471 |
| 628 | Ga0501043_0304440 | 3300049579 | Bacteria | 1217 |
| 629 | Ga0501046_0039552 | 3300049580 | Bacteria | 3776 |
| 630 | Ga0501048_0067007 | 3300049582 | Bacteria | 2538 |
| 631 | Ga0501071_0132168 | 3300049587 | Bacteria | 1855 |
| 632 | Ga0501072_0089143 | 3300049588 | Bacteria | 2448 |
| 633 | Ga0501074_0103590 | 3300049590 | Bacteria | 2037 |
| 634 | Ga0501074_1309443 | 3300049590 | Bacteria | 508 |
| 635 | Ga0501075_0009791 | 3300049591 | Bacteria | 6717 |
| 636 | Ga0501075_0242918 | 3300049591 | Bacteria | 1373 |
| 637 | Ga0501075_0378828 | 3300049591 | Bacteria | 1079 |
| 638 | Ga0501075_0922201 | 3300049591 | Bacteria | 664 |
| 639 | Ga0501076_0058919 | 3300049592 | Bacteria | 3054 |
| 640 | Ga0501076_0797822 | 3300049592 | Bacteria | 779 |
| 641 | Ga0501077_0015193 | 3300049593 | Bacteria | 4843 |
| 642 | Ga0501077_0472641 | 3300049593 | Bacteria | 803 |
| 643 | Ga0501202_009257 | 3300049652 | Unclassified | 1808 |
| 644 | Ga0501209_183744 | 3300049656 | Bacteria | 639 |
| 645 | Ga0501230_029022 | 3300049667 | Bacteria | 1020 |
| 646 | Ga0501246_048480 | 3300049676 | Unclassified | 526 |
| 647 | Ga0501247_034864 | 3300049677 | Bacteria | 701 |
| 648 | Ga0501258_022530 | 3300049687 | Unclassified | 750 |
| 649 | Ga0501079_1475745 | 3300049741 | Unclassified | 535 |
| 650 | Ga0501081_0001556 | 3300049743 | Bacteria | 14107 |
| 651 | Ga0501283_135030 | 3300049779 | Unclassified | 503 |
| 652 | Ga0501035_0180313 | 3300049822 | Bacteria | 1820 |
| 653 | nmdc:mga05p37_102700_c1 | 3300050507 | Bacteria | 3520 |
| 654 | nmdc:mga05p37_12086_c1 | 3300050507 | Bacteria | 10305 |
| 655 | nmdc:mga05p37_1218360_c1 | 3300050507 | Unclassified | 776 |
| 656 | nmdc:mga05p37_248276_c1 | 3300050507 | Bacteria | 2136 |
| 657 | nmdc:mga05p37_253725_c1 | 3300050507 | Bacteria | 2108 |
| 658 | nmdc:mga05p37_406774_c1 | 3300050507 | Bacteria | 1588 |
| 659 | nmdc:mga05p37_49819_c1 | 3300050507 | Bacteria | 5151 |
| 660 | nmdc:mga05p37_65850_c1 | 3300050507 | Bacteria | 4457 |
| 661 | nmdc:mga09592_104658_c1 | 3300050508 | Bacteria | 2425 |
| 662 | nmdc:mga09592_126849_c1 | 3300050508 | Unclassified | 2194 |
| 663 | nmdc:mga09592_269428_c1 | 3300050508 | Bacteria | 1477 |
| 664 | nmdc:mga09592_2939_c1 | 3300050508 | Bacteria | 13808 |
| 665 | nmdc:mga09592_3519_c1 | 3300050508 | Bacteria | 12655 |
| 666 | nmdc:mga09592_435821_c1 | 3300050508 | Unclassified | 1131 |
| 667 | nmdc:mga09592_491204_c1 | 3300050508 | Bacteria | 1057 |
| 668 | nmdc:mga09592_55672_c1 | 3300050508 | Bacteria | 3342 |
| 669 | nmdc:mga09592_67022_c1 | 3300050508 | Bacteria | 3044 |
| 670 | nmdc:mga0qj67_258809_c1 | 3300050509 | Bacteria | 1412 |
| 671 | nmdc:mga0qj67_293166_c1 | 3300050509 | Bacteria | 1318 |
| 672 | nmdc:mga0qj67_33112_c1 | 3300050509 | Bacteria | 4032 |
| 673 | nmdc:mga0qj67_3596_c1 | 3300050509 | Bacteria | 11187 |
| 674 | nmdc:mga0qj67_43434_c1 | 3300050509 | Bacteria | 3540 |
| 675 | nmdc:mga0qj67_67785_c1 | 3300050509 | Unclassified | 2843 |
| 676 | nmdc:mga06r32_1265990_c1 | 3300050510 | Bacteria | 682 |
| 677 | nmdc:mga06r32_180607_c1 | 3300050510 | Bacteria | 2096 |
| 678 | nmdc:mga06r32_23370_c1 | 3300050510 | Bacteria | 5718 |
| 679 | nmdc:mga06r32_596059_c1 | 3300050510 | Bacteria | 1076 |
| 680 | nmdc:mga06r32_88268_c1 | 3300050510 | Archaea | 3027 |
| 681 | nmdc:mga06r32_98953_c2 | 3300050510 | Bacteria | 1483 |
| 682 | nmdc:mga08y16_1091333_c1 | 3300050511 | Bacteria | 774 |
| 683 | nmdc:mga08y16_1706_c1 | 3300050511 | Bacteria | 22281 |
| 684 | nmdc:mga08y16_22565_c1 | 3300050511 | Bacteria | 6646 |
| 685 | nmdc:mga08y16_325461_c1 | 3300050511 | Bacteria | 1582 |
| 686 | nmdc:mga08y16_3381_c1 | 3300050511 | Bacteria | 16532 |
| 687 | nmdc:mga08y16_365845_c1 | 3300050511 | Bacteria | 1480 |
| 688 | nmdc:mga08y16_381231_c1 | 3300050511 | Unclassified | 1095 |
| 689 | nmdc:mga08y16_655_c1 | 3300050511 | Bacteria | 32531 |
| 690 | nmdc:mga08y16_73712_c1 | 3300050511 | Unclassified | 3557 |
| 691 | nmdc:mga0n895_21708_c1 | 3300050512 | Bacteria | 6008 |
| 692 | nmdc:mga0n895_6535_c1 | 3300050512 | Bacteria | 9921 |
| 693 | nmdc:mga0rr50_1036980_c1 | 3300050513 | Bacteria | 698 |
| 694 | nmdc:mga0rr50_28569_c1 | 3300050513 | Bacteria | 3922 |
| 695 | nmdc:mga0a205_1056_c1 | 3300050515 | Bacteria | 22922 |
| 696 | nmdc:mga0a205_3281_c1 | 3300050515 | Bacteria | 14393 |
| 697 | nmdc:mga0a205_577_c1 | 3300050515 | Bacteria | 29054 |
| 698 | nmdc:mga0a205_60114_c1 | 3300050515 | Bacteria | 3670 |
| 699 | Ga0495619_0552465 | 3300053085 | Unclassified | 790 |
| 700 | Ga0501084_0051977 | 3300054114 | Bacteria | 3429 |
| 701 | Ga0501084_1243032 | 3300054114 | Bacteria | 625 |
| 702 | Ga0530510_0668847 | 3300061734 | Bacteria | 791 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044706 | Ga0466964_0093290 | Ga0466964_0093290_386_856 | 134 |
| 2 | 3300045976 | Ga0466967_0484594 | Ga0466967_0484594_423_893 | 134 |
| 3 | 3300031727 | Ga0316576_10522118 | Ga0316576_105221181 | 138 |
| 4 | 3300035398 | Ga0316574_0154085 | Ga0316574_0154085_688_1143 | 138 |
| 5 | 3300032005 | Ga0307411_11240261 | Ga0307411_112402611 | 139 |
| 6 | 3300032004 | Ga0307414_10438564 | Ga0307414_104385642 | 140 |
| 7 | 3300005295 | Ga0065707_10262348 | Ga0065707_102623482 | 141 |
| 8 | 3300009094 | Ga0111539_13426845 | Ga0111539_134268451 | 141 |
| 9 | 3300044694 | Ga0466963_0026723 | Ga0466963_0026723_599_1063 | 142 |
| 10 | 3300044842 | Ga0466957_0095199 | Ga0466957_0095199_1058_1522 | 142 |
| 11 | 3300009545 | Ga0105237_11289279 | Ga0105237_112892792 | 143 |
| 12 | iso_pu_bacteria | 8055092621 | 8055094725 | 143 |
| 13 | 3300001977 | JGI24746J21847_1004962 | JGI24746J21847_10049622 | 145 |
| 14 | 3300002070 | JGI24750J21931_1031514 | JGI24750J21931_10315141 | 145 |
| 15 | 3300002074 | JGI24748J21848_1024759 | JGI24748J21848_10247591 | 145 |
| 16 | 3300005288 | Ga0065714_10153851 | Ga0065714_101538512 | 145 |
| 17 | 3300005290 | Ga0065712_10006027 | Ga0065712_100060273 | 145 |
| 18 | 3300005290 | Ga0065712_10083231 | Ga0065712_100832312 | 145 |
| 19 | 3300005290 | Ga0065712_10139486 | Ga0065712_101394862 | 145 |
| 20 | 3300005293 | Ga0065715_10003216 | Ga0065715_100032163 | 145 |
| 21 | 3300005293 | Ga0065715_10091582 | Ga0065715_100915824 | 145 |
| 22 | 3300005293 | Ga0065715_10357900 | Ga0065715_103579001 | 145 |
| 23 | 3300005295 | Ga0065707_10587687 | Ga0065707_105876872 | 145 |
| 24 | 3300005328 | Ga0070676_10001803 | Ga0070676_100018034 | 145 |
| 25 | 3300005328 | Ga0070676_10011233 | Ga0070676_100112331 | 145 |
| 26 | 3300005328 | Ga0070676_10029452 | Ga0070676_100294523 | 145 |
| 27 | 3300005329 | Ga0070683_100153201 | Ga0070683_1001532012 | 145 |
| 28 | 3300005329 | Ga0070683_100460795 | Ga0070683_1004607952 | 145 |
| 29 | 3300005330 | Ga0070690_100013980 | Ga0070690_1000139804 | 145 |
| 30 | 3300005330 | Ga0070690_100015578 | Ga0070690_1000155781 | 145 |
| 31 | 3300005330 | Ga0070690_100307723 | Ga0070690_1003077232 | 145 |
| 32 | 3300005331 | Ga0070670_100018731 | Ga0070670_1000187317 | 145 |
| 33 | 3300005331 | Ga0070670_100021290 | Ga0070670_1000212903 | 145 |
| 34 | 3300005331 | Ga0070670_100118295 | Ga0070670_1001182952 | 145 |
| 35 | 3300005331 | Ga0070670_100763984 | Ga0070670_1007639842 | 145 |
| 36 | 3300005333 | Ga0070677_10016661 | Ga0070677_100166613 | 145 |
| 37 | 3300005333 | Ga0070677_10019971 | Ga0070677_100199712 | 145 |
| 38 | 3300005333 | Ga0070677_10070904 | Ga0070677_100709042 | 145 |
| 39 | 3300005333 | Ga0070677_10447767 | Ga0070677_104477671 | 145 |
| 40 | 3300005333 | Ga0070677_10456214 | Ga0070677_104562141 | 145 |
| 41 | 3300005334 | Ga0068869_100001451 | Ga0068869_10000145115 | 145 |
| 42 | 3300005334 | Ga0068869_100074093 | Ga0068869_1000740933 | 145 |
| 43 | 3300005335 | Ga0070666_10038935 | Ga0070666_100389352 | 145 |
| 44 | 3300005335 | Ga0070666_10602350 | Ga0070666_106023502 | 145 |
| 45 | 3300005335 | Ga0070666_10777080 | Ga0070666_107770802 | 145 |
| 46 | 3300005335 | Ga0070666_11074445 | Ga0070666_110744452 | 145 |
| 47 | 3300005338 | Ga0068868_100100155 | Ga0068868_1001001552 | 145 |
| 48 | 3300005338 | Ga0068868_100139496 | Ga0068868_1001394962 | 145 |
| 49 | 3300005340 | Ga0070689_100065087 | Ga0070689_1000650873 | 145 |
| 50 | 3300005340 | Ga0070689_100077049 | Ga0070689_1000770492 | 145 |
| 51 | 3300005340 | Ga0070689_100107321 | Ga0070689_1001073213 | 145 |
| 52 | 3300005340 | Ga0070689_101234337 | Ga0070689_1012343372 | 145 |
| 53 | 3300005341 | Ga0070691_10096726 | Ga0070691_100967263 | 145 |
| 54 | 3300005343 | Ga0070687_100022049 | Ga0070687_1000220492 | 145 |
| 55 | 3300005343 | Ga0070687_100135038 | Ga0070687_1001350382 | 145 |
| 56 | 3300005344 | Ga0070661_100028138 | Ga0070661_1000281384 | 145 |
| 57 | 3300005344 | Ga0070661_100038268 | Ga0070661_1000382684 | 145 |
| 58 | 3300005344 | Ga0070661_100269055 | Ga0070661_1002690552 | 145 |
| 59 | 3300005345 | Ga0070692_10047812 | Ga0070692_100478123 | 145 |
| 60 | 3300005347 | Ga0070668_100007025 | Ga0070668_1000070253 | 145 |
| 61 | 3300005347 | Ga0070668_100149585 | Ga0070668_1001495852 | 145 |
| 62 | 3300005347 | Ga0070668_100538501 | Ga0070668_1005385011 | 145 |
| 63 | 3300005353 | Ga0070669_100017527 | Ga0070669_1000175276 | 145 |
| 64 | 3300005353 | Ga0070669_100019575 | Ga0070669_1000195754 | 145 |
| 65 | 3300005353 | Ga0070669_100031277 | Ga0070669_1000312773 | 145 |
| 66 | 3300005353 | Ga0070669_100079044 | Ga0070669_1000790441 | 145 |
| 67 | 3300005353 | Ga0070669_100162736 | Ga0070669_1001627362 | 145 |
| 68 | 3300005353 | Ga0070669_100181322 | Ga0070669_1001813222 | 145 |
| 69 | 3300005353 | Ga0070669_100230981 | Ga0070669_1002309812 | 145 |
| 70 | 3300005353 | Ga0070669_100612755 | Ga0070669_1006127551 | 145 |
| 71 | 3300005354 | Ga0070675_100001179 | Ga0070675_10000117915 | 145 |
| 72 | 3300005354 | Ga0070675_100001525 | Ga0070675_10000152518 | 145 |
| 73 | 3300005354 | Ga0070675_100001605 | Ga0070675_10000160519 | 145 |
| 74 | 3300005354 | Ga0070675_100002993 | Ga0070675_1000029934 | 145 |
| 75 | 3300005354 | Ga0070675_100006002 | Ga0070675_1000060024 | 145 |
| 76 | 3300005354 | Ga0070675_100041401 | Ga0070675_1000414012 | 145 |
| 77 | 3300005354 | Ga0070675_100084418 | Ga0070675_1000844184 | 145 |
| 78 | 3300005354 | Ga0070675_100093838 | Ga0070675_1000938382 | 145 |
| 79 | 3300005354 | Ga0070675_100537906 | Ga0070675_1005379061 | 145 |
| 80 | 3300005354 | Ga0070675_100556280 | Ga0070675_1005562801 | 145 |
| 81 | 3300005354 | Ga0070675_101164549 | Ga0070675_1011645492 | 145 |
| 82 | 3300005355 | Ga0070671_100014421 | Ga0070671_1000144215 | 145 |
| 83 | 3300005355 | Ga0070671_100027688 | Ga0070671_1000276883 | 145 |
| 84 | 3300005355 | Ga0070671_100838867 | Ga0070671_1008388672 | 145 |
| 85 | 3300005356 | Ga0070674_100023270 | Ga0070674_1000232704 | 145 |
| 86 | 3300005356 | Ga0070674_100203049 | Ga0070674_1002030492 | 145 |
| 87 | 3300005356 | Ga0070674_100458571 | Ga0070674_1004585712 | 145 |
| 88 | 3300005356 | Ga0070674_100671268 | Ga0070674_1006712682 | 145 |
| 89 | 3300005364 | Ga0070673_100005331 | Ga0070673_1000053317 | 145 |
| 90 | 3300005364 | Ga0070673_100005380 | Ga0070673_1000053806 | 145 |
| 91 | 3300005364 | Ga0070673_100041029 | Ga0070673_1000410292 | 145 |
| 92 | 3300005364 | Ga0070673_100058601 | Ga0070673_1000586012 | 145 |
| 93 | 3300005364 | Ga0070673_100061220 | Ga0070673_1000612203 | 145 |
| 94 | 3300005364 | Ga0070673_100107103 | Ga0070673_1001071032 | 145 |
| 95 | 3300005364 | Ga0070673_100269605 | Ga0070673_1002696052 | 145 |
| 96 | 3300005364 | Ga0070673_100542719 | Ga0070673_1005427192 | 145 |
| 97 | 3300005364 | Ga0070673_100770985 | Ga0070673_1007709851 | 145 |
| 98 | 3300005365 | Ga0070688_100015922 | Ga0070688_1000159224 | 145 |
| 99 | 3300005365 | Ga0070688_100078062 | Ga0070688_1000780623 | 145 |
| 100 | 3300005365 | Ga0070688_100143865 | Ga0070688_1001438652 | 145 |
| 101 | 3300005366 | Ga0070659_100056589 | Ga0070659_1000565892 | 145 |
| 102 | 3300005366 | Ga0070659_100160483 | Ga0070659_1001604832 | 145 |
| 103 | 3300005367 | Ga0070667_100008511 | Ga0070667_1000085117 | 145 |
| 104 | 3300005367 | Ga0070667_100145274 | Ga0070667_1001452742 | 145 |
| 105 | 3300005406 | Ga0070703_10136695 | Ga0070703_101366951 | 145 |
| 106 | 3300005438 | Ga0070701_10053071 | Ga0070701_100530713 | 145 |
| 107 | 3300005438 | Ga0070701_10213041 | Ga0070701_102130412 | 145 |
| 108 | 3300005438 | Ga0070701_10322737 | Ga0070701_103227371 | 145 |
| 109 | 3300005441 | Ga0070700_100006546 | Ga0070700_1000065465 | 145 |
| 110 | 3300005441 | Ga0070700_100040351 | Ga0070700_1000403515 | 145 |
| 111 | 3300005441 | Ga0070700_100192320 | Ga0070700_1001923202 | 145 |
| 112 | 3300005444 | Ga0070694_100198467 | Ga0070694_1001984672 | 145 |
| 113 | 3300005444 | Ga0070694_101285768 | Ga0070694_1012857681 | 145 |
| 114 | 3300005455 | Ga0070663_100067841 | Ga0070663_1000678412 | 145 |
| 115 | 3300005455 | Ga0070663_100359417 | Ga0070663_1003594171 | 145 |
| 116 | 3300005456 | Ga0070678_100002418 | Ga0070678_1000024188 | 145 |
| 117 | 3300005456 | Ga0070678_100116757 | Ga0070678_1001167572 | 145 |
| 118 | 3300005456 | Ga0070678_100120593 | Ga0070678_1001205932 | 145 |
| 119 | 3300005456 | Ga0070678_100431331 | Ga0070678_1004313312 | 145 |
| 120 | 3300005457 | Ga0070662_100171368 | Ga0070662_1001713682 | 145 |
| 121 | 3300005457 | Ga0070662_100290512 | Ga0070662_1002905122 | 145 |
| 122 | 3300005459 | Ga0068867_100005657 | Ga0068867_1000056576 | 145 |
| 123 | 3300005459 | Ga0068867_100049711 | Ga0068867_1000497112 | 145 |
| 124 | 3300005459 | Ga0068867_100089462 | Ga0068867_1000894622 | 145 |
| 125 | 3300005466 | Ga0070685_10003652 | Ga0070685_100036522 | 145 |
| 126 | 3300005467 | Ga0070706_101132316 | Ga0070706_1011323161 | 145 |
| 127 | 3300005468 | Ga0070707_101712296 | Ga0070707_1017122961 | 145 |
| 128 | 3300005471 | Ga0070698_100493644 | Ga0070698_1004936442 | 145 |
| 129 | 3300005518 | Ga0070699_100010424 | Ga0070699_1000104246 | 145 |
| 130 | 3300005518 | Ga0070699_100384682 | Ga0070699_1003846822 | 145 |
| 131 | 3300005518 | Ga0070699_100405400 | Ga0070699_1004054002 | 145 |
| 132 | 3300005530 | Ga0070679_100624897 | Ga0070679_1006248971 | 145 |
| 133 | 3300005536 | Ga0070697_100070893 | Ga0070697_1000708932 | 145 |
| 134 | 3300005536 | Ga0070697_100789195 | Ga0070697_1007891951 | 145 |
| 135 | 3300005543 | Ga0070672_100043126 | Ga0070672_1000431264 | 145 |
| 136 | 3300005543 | Ga0070672_100048076 | Ga0070672_1000480763 | 145 |
| 137 | 3300005543 | Ga0070672_100083932 | Ga0070672_1000839323 | 145 |
| 138 | 3300005543 | Ga0070672_100088957 | Ga0070672_1000889574 | 145 |
| 139 | 3300005543 | Ga0070672_100147289 | Ga0070672_1001472892 | 145 |
| 140 | 3300005543 | Ga0070672_100432042 | Ga0070672_1004320422 | 145 |
| 141 | 3300005543 | Ga0070672_100822524 | Ga0070672_1008225242 | 145 |
| 142 | 3300005544 | Ga0070686_100002140 | Ga0070686_1000021407 | 145 |
| 143 | 3300005544 | Ga0070686_100102268 | Ga0070686_1001022682 | 145 |
| 144 | 3300005545 | Ga0070695_100404924 | Ga0070695_1004049241 | 145 |
| 145 | 3300005546 | Ga0070696_100619570 | Ga0070696_1006195702 | 145 |
| 146 | 3300005549 | Ga0070704_100102018 | Ga0070704_1001020182 | 145 |
| 147 | 3300005549 | Ga0070704_100469227 | Ga0070704_1004692272 | 145 |
| 148 | 3300005564 | Ga0070664_100008661 | Ga0070664_1000086619 | 145 |
| 149 | 3300005564 | Ga0070664_100011840 | Ga0070664_1000118405 | 145 |
| 150 | 3300005564 | Ga0070664_100018755 | Ga0070664_1000187552 | 145 |
| 151 | 3300005564 | Ga0070664_100023467 | Ga0070664_1000234673 | 145 |
| 152 | 3300005564 | Ga0070664_100646018 | Ga0070664_1006460182 | 145 |
| 153 | 3300005577 | Ga0068857_100137571 | Ga0068857_1001375712 | 145 |
| 154 | 3300005578 | Ga0068854_100240643 | Ga0068854_1002406432 | 145 |
| 155 | 3300005615 | Ga0070702_100091704 | Ga0070702_1000917042 | 145 |
| 156 | 3300005615 | Ga0070702_100268119 | Ga0070702_1002681192 | 145 |
| 157 | 3300005616 | Ga0068852_100470248 | Ga0068852_1004702482 | 145 |
| 158 | 3300005617 | Ga0068859_100032983 | Ga0068859_1000329832 | 145 |
| 159 | 3300005617 | Ga0068859_100078453 | Ga0068859_1000784531 | 145 |
| 160 | 3300005617 | Ga0068859_100079161 | Ga0068859_1000791613 | 145 |
| 161 | 3300005617 | Ga0068859_100149357 | Ga0068859_1001493573 | 145 |
| 162 | 3300005617 | Ga0068859_100296970 | Ga0068859_1002969702 | 145 |
| 163 | 3300005617 | Ga0068859_100695037 | Ga0068859_1006950372 | 145 |
| 164 | 3300005617 | Ga0068859_101946027 | Ga0068859_1019460271 | 145 |
| 165 | 3300005618 | Ga0068864_100034893 | Ga0068864_1000348933 | 145 |
| 166 | 3300005618 | Ga0068864_100113074 | Ga0068864_1001130742 | 145 |
| 167 | 3300005618 | Ga0068864_100149930 | Ga0068864_1001499302 | 145 |
| 168 | 3300005618 | Ga0068864_100179373 | Ga0068864_1001793732 | 145 |
| 169 | 3300005618 | Ga0068864_100577556 | Ga0068864_1005775561 | 145 |
| 170 | 3300005718 | Ga0068866_10016871 | Ga0068866_100168713 | 145 |
| 171 | 3300005718 | Ga0068866_10020245 | Ga0068866_100202452 | 145 |
| 172 | 3300005718 | Ga0068866_10088854 | Ga0068866_100888541 | 145 |
| 173 | 3300005719 | Ga0068861_100001769 | Ga0068861_1000017696 | 145 |
| 174 | 3300005719 | Ga0068861_100035452 | Ga0068861_1000354522 | 145 |
| 175 | 3300005719 | Ga0068861_100114692 | Ga0068861_1001146922 | 145 |
| 176 | 3300005719 | Ga0068861_100167128 | Ga0068861_1001671281 | 145 |
| 177 | 3300005719 | Ga0068861_100339224 | Ga0068861_1003392241 | 145 |
| 178 | 3300005719 | Ga0068861_100795250 | Ga0068861_1007952502 | 145 |
| 179 | 3300005840 | Ga0068870_10000294 | Ga0068870_100002944 | 145 |
| 180 | 3300005840 | Ga0068870_10014325 | Ga0068870_100143253 | 145 |
| 181 | 3300005840 | Ga0068870_10286436 | Ga0068870_102864361 | 145 |
| 182 | 3300005841 | Ga0068863_100012272 | Ga0068863_1000122723 | 145 |
| 183 | 3300005841 | Ga0068863_100457180 | Ga0068863_1004571802 | 145 |
| 184 | 3300005842 | Ga0068858_100025311 | Ga0068858_1000253114 | 145 |
| 185 | 3300005842 | Ga0068858_101183928 | Ga0068858_1011839282 | 145 |
| 186 | 3300005843 | Ga0068860_100010293 | Ga0068860_1000102937 | 145 |
| 187 | 3300005843 | Ga0068860_102075576 | Ga0068860_1020755761 | 145 |
| 188 | 3300005844 | Ga0068862_100004508 | Ga0068862_10000450810 | 145 |
| 189 | 3300005844 | Ga0068862_100428228 | Ga0068862_1004282282 | 145 |
| 190 | 3300005844 | Ga0068862_100458063 | Ga0068862_1004580631 | 145 |
| 191 | 3300005844 | Ga0068862_100504247 | Ga0068862_1005042472 | 145 |
| 192 | 3300005844 | Ga0068862_101315279 | Ga0068862_1013152792 | 145 |
| 193 | 3300005844 | Ga0068862_101574063 | Ga0068862_1015740631 | 145 |
| 194 | 3300005937 | Ga0081455_10018672 | Ga0081455_100186727 | 145 |
| 195 | 3300006058 | Ga0075432_10151231 | Ga0075432_101512312 | 145 |
| 196 | 3300006237 | Ga0097621_100020236 | Ga0097621_1000202362 | 145 |
| 197 | 3300006237 | Ga0097621_102110613 | Ga0097621_1021106131 | 145 |
| 198 | 3300006358 | Ga0068871_101066518 | Ga0068871_1010665182 | 145 |
| 199 | 3300006358 | Ga0068871_101727700 | Ga0068871_1017277001 | 145 |
| 200 | 3300006844 | Ga0075428_100001914 | Ga0075428_1000019145 | 145 |
| 201 | 3300006844 | Ga0075428_100003245 | Ga0075428_10000324512 | 145 |
| 202 | 3300006844 | Ga0075428_100055045 | Ga0075428_1000550454 | 145 |
| 203 | 3300006844 | Ga0075428_100301188 | Ga0075428_1003011882 | 145 |
| 204 | 3300006844 | Ga0075428_100375660 | Ga0075428_1003756602 | 145 |
| 205 | 3300006844 | Ga0075428_100965784 | Ga0075428_1009657842 | 145 |
| 206 | 3300006846 | Ga0075430_100008767 | Ga0075430_1000087677 | 145 |
| 207 | 3300006846 | Ga0075430_100017358 | Ga0075430_1000173587 | 145 |
| 208 | 3300006846 | Ga0075430_100185512 | Ga0075430_1001855123 | 145 |
| 209 | 3300006847 | Ga0075431_100020297 | Ga0075431_1000202974 | 145 |
| 210 | 3300006847 | Ga0075431_100050732 | Ga0075431_1000507322 | 145 |
| 211 | 3300006847 | Ga0075431_100338840 | Ga0075431_1003388402 | 145 |
| 212 | 3300006852 | Ga0075433_10003776 | Ga0075433_100037769 | 145 |
| 213 | 3300006852 | Ga0075433_10160450 | Ga0075433_101604502 | 145 |
| 214 | 3300006871 | Ga0075434_100004765 | Ga0075434_10000476510 | 145 |
| 215 | 3300006871 | Ga0075434_100193277 | Ga0075434_1001932772 | 145 |
| 216 | 3300006871 | Ga0075434_100241783 | Ga0075434_1002417832 | 145 |
| 217 | 3300006880 | Ga0075429_100014564 | Ga0075429_1000145647 | 145 |
| 218 | 3300006880 | Ga0075429_100017259 | Ga0075429_1000172598 | 145 |
| 219 | 3300006880 | Ga0075429_100063369 | Ga0075429_1000633692 | 145 |
| 220 | 3300006880 | Ga0075429_100082120 | Ga0075429_1000821203 | 145 |
| 221 | 3300006880 | Ga0075429_100186601 | Ga0075429_1001866012 | 145 |
| 222 | 3300006881 | Ga0068865_100005969 | Ga0068865_1000059696 | 145 |
| 223 | 3300006881 | Ga0068865_100013650 | Ga0068865_1000136506 | 145 |
| 224 | 3300006881 | Ga0068865_100085681 | Ga0068865_1000856812 | 145 |
| 225 | 3300006931 | Ga0097620_100032982 | Ga0097620_1000329822 | 145 |
| 226 | 3300006931 | Ga0097620_100078451 | Ga0097620_1000784511 | 145 |
| 227 | 3300006931 | Ga0097620_100079160 | Ga0097620_1000791603 | 145 |
| 228 | 3300006931 | Ga0097620_100149357 | Ga0097620_1001493573 | 145 |
| 229 | 3300006931 | Ga0097620_100296976 | Ga0097620_1002969762 | 145 |
| 230 | 3300006931 | Ga0097620_100695033 | Ga0097620_1006950332 | 145 |
| 231 | 3300006931 | Ga0097620_101945913 | Ga0097620_1019459131 | 145 |
| 232 | 3300007076 | Ga0075435_101224708 | Ga0075435_1012247081 | 145 |
| 233 | 3300009094 | Ga0111539_10000065 | Ga0111539_1000006576 | 145 |
| 234 | 3300009094 | Ga0111539_10003932 | Ga0111539_100039324 | 145 |
| 235 | 3300009094 | Ga0111539_10010451 | Ga0111539_100104513 | 145 |
| 236 | 3300009094 | Ga0111539_10029612 | Ga0111539_100296122 | 145 |
| 237 | 3300009094 | Ga0111539_10123724 | Ga0111539_101237242 | 145 |
| 238 | 3300009094 | Ga0111539_10128168 | Ga0111539_101281683 | 145 |
| 239 | 3300009094 | Ga0111539_10132048 | Ga0111539_101320482 | 145 |
| 240 | 3300009094 | Ga0111539_10454386 | Ga0111539_104543862 | 145 |
| 241 | 3300009098 | Ga0105245_10439202 | Ga0105245_104392023 | 145 |
| 242 | 3300009098 | Ga0105245_10530098 | Ga0105245_105300982 | 145 |
| 243 | 3300009101 | Ga0105247_10121777 | Ga0105247_101217772 | 145 |
| 244 | 3300009101 | Ga0105247_10715924 | Ga0105247_107159241 | 145 |
| 245 | 3300009147 | Ga0114129_10007052 | Ga0114129_100070525 | 145 |
| 246 | 3300009147 | Ga0114129_10013734 | Ga0114129_1001373411 | 145 |
| 247 | 3300009147 | Ga0114129_10069282 | Ga0114129_100692826 | 145 |
| 248 | 3300009147 | Ga0114129_10904545 | Ga0114129_109045452 | 145 |
| 249 | 3300009148 | Ga0105243_10368431 | Ga0105243_103684312 | 145 |
| 250 | 3300009148 | Ga0105243_10528754 | Ga0105243_105287542 | 145 |
| 251 | 3300009176 | Ga0105242_10089084 | Ga0105242_100890843 | 145 |
| 252 | 3300009176 | Ga0105242_10921389 | Ga0105242_109213892 | 145 |
| 253 | 3300009177 | Ga0105248_10132152 | Ga0105248_101321523 | 145 |
| 254 | 3300009177 | Ga0105248_10175637 | Ga0105248_101756371 | 145 |
| 255 | 3300009551 | Ga0105238_10018652 | Ga0105238_100186528 | 145 |
| 256 | 3300009553 | Ga0105249_10001042 | Ga0105249_1000104215 | 145 |
| 257 | 3300009553 | Ga0105249_10709088 | Ga0105249_107090882 | 145 |
| 258 | 3300011119 | Ga0105246_10066755 | Ga0105246_100667553 | 145 |
| 259 | 3300011119 | Ga0105246_10728112 | Ga0105246_107281121 | 145 |
| 260 | 3300012497 | Ga0157319_1020816 | Ga0157319_10208161 | 145 |
| 261 | 3300012508 | Ga0157315_1007777 | Ga0157315_10077772 | 145 |
| 262 | 3300013296 | Ga0157374_10059837 | Ga0157374_100598374 | 145 |
| 263 | 3300013296 | Ga0157374_10069372 | Ga0157374_100693724 | 145 |
| 264 | 3300013296 | Ga0157374_10888260 | Ga0157374_108882602 | 145 |
| 265 | 3300013297 | Ga0157378_10308181 | Ga0157378_103081812 | 145 |
| 266 | 3300013297 | Ga0157378_12666120 | Ga0157378_126661201 | 145 |
| 267 | 3300013306 | Ga0163162_10003027 | Ga0163162_100030278 | 145 |
| 268 | 3300013306 | Ga0163162_10325311 | Ga0163162_103253112 | 145 |
| 269 | 3300013306 | Ga0163162_12864463 | Ga0163162_128644631 | 145 |
| 270 | 3300013308 | Ga0157375_10025152 | Ga0157375_100251527 | 145 |
| 271 | 3300013308 | Ga0157375_10209635 | Ga0157375_102096352 | 145 |
| 272 | 3300013308 | Ga0157375_10286120 | Ga0157375_102861202 | 145 |
| 273 | 3300013308 | Ga0157375_10924287 | Ga0157375_109242872 | 145 |
| 274 | 3300013308 | Ga0157375_10983940 | Ga0157375_109839401 | 145 |
| 275 | 3300013308 | Ga0157375_11216360 | Ga0157375_112163601 | 145 |
| 276 | 3300013308 | Ga0157375_11736685 | Ga0157375_117366852 | 145 |
| 277 | 3300014325 | Ga0163163_10029464 | Ga0163163_100294642 | 145 |
| 278 | 3300014325 | Ga0163163_10050630 | Ga0163163_100506303 | 145 |
| 279 | 3300014325 | Ga0163163_10377985 | Ga0163163_103779852 | 145 |
| 280 | 3300014326 | Ga0157380_10009450 | Ga0157380_100094502 | 145 |
| 281 | 3300014326 | Ga0157380_10045860 | Ga0157380_100458603 | 145 |
| 282 | 3300014326 | Ga0157380_10069366 | Ga0157380_100693663 | 145 |
| 283 | 3300014326 | Ga0157380_10074956 | Ga0157380_100749561 | 145 |
| 284 | 3300014326 | Ga0157380_10095697 | Ga0157380_100956973 | 145 |
| 285 | 3300014326 | Ga0157380_10110572 | Ga0157380_101105723 | 145 |
| 286 | 3300014326 | Ga0157380_10217281 | Ga0157380_102172813 | 145 |
| 287 | 3300014326 | Ga0157380_10427951 | Ga0157380_104279512 | 145 |
| 288 | 3300014326 | Ga0157380_11038230 | Ga0157380_110382302 | 145 |
| 289 | 3300014326 | Ga0157380_11800383 | Ga0157380_118003831 | 145 |
| 290 | 3300014745 | Ga0157377_10004519 | Ga0157377_100045194 | 145 |
| 291 | 3300014745 | Ga0157377_10044839 | Ga0157377_100448394 | 145 |
| 292 | 3300014745 | Ga0157377_10108759 | Ga0157377_101087592 | 145 |
| 293 | 3300014745 | Ga0157377_10123198 | Ga0157377_101231982 | 145 |
| 294 | 3300014745 | Ga0157377_10223128 | Ga0157377_102231282 | 145 |
| 295 | 3300014968 | Ga0157379_10003743 | Ga0157379_100037434 | 145 |
| 296 | 3300014968 | Ga0157379_10131137 | Ga0157379_101311372 | 145 |
| 297 | 3300014969 | Ga0157376_10705222 | Ga0157376_107052222 | 145 |
| 298 | 3300014969 | Ga0157376_11878163 | Ga0157376_118781632 | 145 |
| 299 | 3300017792 | Ga0163161_10006354 | Ga0163161_100063541 | 145 |
| 300 | 3300021384 | Ga0213876_10383765 | Ga0213876_103837651 | 145 |
| 301 | 3300025290 | Ga0207673_1030846 | Ga0207673_10308461 | 145 |
| 302 | 3300025315 | Ga0207697_10000085 | Ga0207697_1000008517 | 145 |
| 303 | 3300025315 | Ga0207697_10089054 | Ga0207697_100890541 | 145 |
| 304 | 3300025885 | Ga0207653_10215231 | Ga0207653_102152311 | 145 |
| 305 | 3300025893 | Ga0207682_10005915 | Ga0207682_100059154 | 145 |
| 306 | 3300025893 | Ga0207682_10021779 | Ga0207682_100217794 | 145 |
| 307 | 3300025893 | Ga0207682_10067630 | Ga0207682_100676302 | 145 |
| 308 | 3300025893 | Ga0207682_10174524 | Ga0207682_101745242 | 145 |
| 309 | 3300025899 | Ga0207642_10038792 | Ga0207642_100387922 | 145 |
| 310 | 3300025900 | Ga0207710_10065406 | Ga0207710_100654063 | 145 |
| 311 | 3300025901 | Ga0207688_10000477 | Ga0207688_1000047719 | 145 |
| 312 | 3300025901 | Ga0207688_10013379 | Ga0207688_100133792 | 145 |
| 313 | 3300025901 | Ga0207688_10129377 | Ga0207688_101293771 | 145 |
| 314 | 3300025901 | Ga0207688_10196070 | Ga0207688_101960702 | 145 |
| 315 | 3300025903 | Ga0207680_10067608 | Ga0207680_100676082 | 145 |
| 316 | 3300025903 | Ga0207680_10294839 | Ga0207680_102948392 | 145 |
| 317 | 3300025903 | Ga0207680_10365300 | Ga0207680_103653002 | 145 |
| 318 | 3300025904 | Ga0207647_10263199 | Ga0207647_102631992 | 145 |
| 319 | 3300025907 | Ga0207645_10003970 | Ga0207645_100039709 | 145 |
| 320 | 3300025907 | Ga0207645_10051127 | Ga0207645_100511274 | 145 |
| 321 | 3300025907 | Ga0207645_10435744 | Ga0207645_104357442 | 145 |
| 322 | 3300025908 | Ga0207643_10000621 | Ga0207643_1000062113 | 145 |
| 323 | 3300025908 | Ga0207643_10016413 | Ga0207643_100164134 | 145 |
| 324 | 3300025908 | Ga0207643_10062822 | Ga0207643_100628224 | 145 |
| 325 | 3300025908 | Ga0207643_10079881 | Ga0207643_100798813 | 145 |
| 326 | 3300025908 | Ga0207643_10170537 | Ga0207643_101705371 | 145 |
| 327 | 3300025918 | Ga0207662_10026171 | Ga0207662_100261713 | 145 |
| 328 | 3300025918 | Ga0207662_10090519 | Ga0207662_100905192 | 145 |
| 329 | 3300025918 | Ga0207662_10144691 | Ga0207662_101446912 | 145 |
| 330 | 3300025920 | Ga0207649_10013216 | Ga0207649_100132164 | 145 |
| 331 | 3300025922 | Ga0207646_11312930 | Ga0207646_113129302 | 145 |
| 332 | 3300025923 | Ga0207681_10010515 | Ga0207681_100105152 | 145 |
| 333 | 3300025923 | Ga0207681_10015267 | Ga0207681_100152672 | 145 |
| 334 | 3300025923 | Ga0207681_10062868 | Ga0207681_100628684 | 145 |
| 335 | 3300025923 | Ga0207681_10146646 | Ga0207681_101466461 | 145 |
| 336 | 3300025923 | Ga0207681_10294491 | Ga0207681_102944912 | 145 |
| 337 | 3300025923 | Ga0207681_10388804 | Ga0207681_103888042 | 145 |
| 338 | 3300025923 | Ga0207681_10509707 | Ga0207681_105097072 | 145 |
| 339 | 3300025925 | Ga0207650_10013100 | Ga0207650_100131003 | 145 |
| 340 | 3300025925 | Ga0207650_10025991 | Ga0207650_100259914 | 145 |
| 341 | 3300025925 | Ga0207650_10042734 | Ga0207650_100427343 | 145 |
| 342 | 3300025926 | Ga0207659_10000692 | Ga0207659_100006926 | 145 |
| 343 | 3300025926 | Ga0207659_10002253 | Ga0207659_100022537 | 145 |
| 344 | 3300025926 | Ga0207659_10002334 | Ga0207659_1000233411 | 145 |
| 345 | 3300025926 | Ga0207659_10005341 | Ga0207659_100053417 | 145 |
| 346 | 3300025926 | Ga0207659_10005376 | Ga0207659_100053762 | 145 |
| 347 | 3300025926 | Ga0207659_10009720 | Ga0207659_100097204 | 145 |
| 348 | 3300025926 | Ga0207659_10059269 | Ga0207659_100592691 | 145 |
| 349 | 3300025927 | Ga0207687_10524784 | Ga0207687_105247841 | 145 |
| 350 | 3300025931 | Ga0207644_10023860 | Ga0207644_100238603 | 145 |
| 351 | 3300025931 | Ga0207644_10041012 | Ga0207644_100410123 | 145 |
| 352 | 3300025932 | Ga0207690_10929727 | Ga0207690_109297272 | 145 |
| 353 | 3300025933 | Ga0207706_10020983 | Ga0207706_100209836 | 145 |
| 354 | 3300025933 | Ga0207706_10067256 | Ga0207706_100672562 | 145 |
| 355 | 3300025933 | Ga0207706_11007238 | Ga0207706_110072382 | 145 |
| 356 | 3300025934 | Ga0207686_10008848 | Ga0207686_100088482 | 145 |
| 357 | 3300025935 | Ga0207709_10107108 | Ga0207709_101071081 | 145 |
| 358 | 3300025936 | Ga0207670_10020894 | Ga0207670_100208943 | 145 |
| 359 | 3300025936 | Ga0207670_10102115 | Ga0207670_101021152 | 145 |
| 360 | 3300025936 | Ga0207670_10123319 | Ga0207670_101233192 | 145 |
| 361 | 3300025936 | Ga0207670_10402231 | Ga0207670_104022312 | 145 |
| 362 | 3300025937 | Ga0207669_10006212 | Ga0207669_100062123 | 145 |
| 363 | 3300025937 | Ga0207669_10023277 | Ga0207669_100232773 | 145 |
| 364 | 3300025937 | Ga0207669_10026241 | Ga0207669_100262412 | 145 |
| 365 | 3300025938 | Ga0207704_10033092 | Ga0207704_100330925 | 145 |
| 366 | 3300025940 | Ga0207691_10011647 | Ga0207691_100116479 | 145 |
| 367 | 3300025940 | Ga0207691_10013433 | Ga0207691_100134333 | 145 |
| 368 | 3300025940 | Ga0207691_10014601 | Ga0207691_100146016 | 145 |
| 369 | 3300025940 | Ga0207691_10024570 | Ga0207691_100245702 | 145 |
| 370 | 3300025940 | Ga0207691_10042244 | Ga0207691_100422444 | 145 |
| 371 | 3300025940 | Ga0207691_10128406 | Ga0207691_101284062 | 145 |
| 372 | 3300025940 | Ga0207691_10384175 | Ga0207691_103841752 | 145 |
| 373 | 3300025941 | Ga0207711_10524783 | Ga0207711_105247832 | 145 |
| 374 | 3300025942 | Ga0207689_10000730 | Ga0207689_1000073011 | 145 |
| 375 | 3300025942 | Ga0207689_10001141 | Ga0207689_100011418 | 145 |
| 376 | 3300025942 | Ga0207689_10429191 | Ga0207689_104291911 | 145 |
| 377 | 3300025945 | Ga0207679_10060645 | Ga0207679_100606452 | 145 |
| 378 | 3300025945 | Ga0207679_10135080 | Ga0207679_101350802 | 145 |
| 379 | 3300025945 | Ga0207679_10201060 | Ga0207679_102010602 | 145 |
| 380 | 3300025945 | Ga0207679_10204814 | Ga0207679_102048142 | 145 |
| 381 | 3300025945 | Ga0207679_10445404 | Ga0207679_104454042 | 145 |
| 382 | 3300025960 | Ga0207651_10010034 | Ga0207651_100100343 | 145 |
| 383 | 3300025960 | Ga0207651_10019391 | Ga0207651_100193913 | 145 |
| 384 | 3300025960 | Ga0207651_10143677 | Ga0207651_101436772 | 145 |
| 385 | 3300025960 | Ga0207651_10155988 | Ga0207651_101559882 | 145 |
| 386 | 3300025960 | Ga0207651_10279215 | Ga0207651_102792152 | 145 |
| 387 | 3300025960 | Ga0207651_10296033 | Ga0207651_102960332 | 145 |
| 388 | 3300025960 | Ga0207651_10500287 | Ga0207651_105002872 | 145 |
| 389 | 3300025960 | Ga0207651_10737438 | Ga0207651_107374382 | 145 |
| 390 | 3300025961 | Ga0207712_11172752 | Ga0207712_111727522 | 145 |
| 391 | 3300025961 | Ga0207712_11298353 | Ga0207712_112983531 | 145 |
| 392 | 3300025972 | Ga0207668_10071060 | Ga0207668_100710602 | 145 |
| 393 | 3300025972 | Ga0207668_10075524 | Ga0207668_100755243 | 145 |
| 394 | 3300025972 | Ga0207668_10273445 | Ga0207668_102734452 | 145 |
| 395 | 3300025972 | Ga0207668_11065095 | Ga0207668_110650951 | 145 |
| 396 | 3300025986 | Ga0207658_10009526 | Ga0207658_100095267 | 145 |
| 397 | 3300025986 | Ga0207658_10137717 | Ga0207658_101377172 | 145 |
| 398 | 3300026023 | Ga0207677_10127989 | Ga0207677_101279891 | 145 |
| 399 | 3300026023 | Ga0207677_10254377 | Ga0207677_102543772 | 145 |
| 400 | 3300026023 | Ga0207677_10430273 | Ga0207677_104302732 | 145 |
| 401 | 3300026035 | Ga0207703_10130310 | Ga0207703_101303103 | 145 |
| 402 | 3300026035 | Ga0207703_10898755 | Ga0207703_108987552 | 145 |
| 403 | 3300026067 | Ga0207678_10062622 | Ga0207678_100626223 | 145 |
| 404 | 3300026075 | Ga0207708_10004080 | Ga0207708_100040804 | 145 |
| 405 | 3300026075 | Ga0207708_10028056 | Ga0207708_100280565 | 145 |
| 406 | 3300026075 | Ga0207708_10102407 | Ga0207708_101024074 | 145 |
| 407 | 3300026075 | Ga0207708_10193451 | Ga0207708_101934512 | 145 |
| 408 | 3300026075 | Ga0207708_10325607 | Ga0207708_103256072 | 145 |
| 409 | 3300026088 | Ga0207641_10007106 | Ga0207641_100071062 | 145 |
| 410 | 3300026088 | Ga0207641_10437609 | Ga0207641_104376092 | 145 |
| 411 | 3300026088 | Ga0207641_11311625 | Ga0207641_113116252 | 145 |
| 412 | 3300026089 | Ga0207648_10004031 | Ga0207648_100040316 | 145 |
| 413 | 3300026089 | Ga0207648_10017303 | Ga0207648_100173034 | 145 |
| 414 | 3300026089 | Ga0207648_10065561 | Ga0207648_100655613 | 145 |
| 415 | 3300026089 | Ga0207648_10239740 | Ga0207648_102397402 | 145 |
| 416 | 3300026095 | Ga0207676_10014347 | Ga0207676_100143471 | 145 |
| 417 | 3300026095 | Ga0207676_10052910 | Ga0207676_100529104 | 145 |
| 418 | 3300026095 | Ga0207676_10074447 | Ga0207676_100744472 | 145 |
| 419 | 3300026095 | Ga0207676_10118025 | Ga0207676_101180253 | 145 |
| 420 | 3300026116 | Ga0207674_10190798 | Ga0207674_101907982 | 145 |
| 421 | 3300026116 | Ga0207674_10260550 | Ga0207674_102605502 | 145 |
| 422 | 3300026116 | Ga0207674_10384615 | Ga0207674_103846151 | 145 |
| 423 | 3300026118 | Ga0207675_100011628 | Ga0207675_1000116286 | 145 |
| 424 | 3300026118 | Ga0207675_100019821 | Ga0207675_1000198215 | 145 |
| 425 | 3300026118 | Ga0207675_100063425 | Ga0207675_1000634254 | 145 |
| 426 | 3300026118 | Ga0207675_100065951 | Ga0207675_1000659512 | 145 |
| 427 | 3300026118 | Ga0207675_100230078 | Ga0207675_1002300782 | 145 |
| 428 | 3300026121 | Ga0207683_10001698 | Ga0207683_1000169810 | 145 |
| 429 | 3300026121 | Ga0207683_10045500 | Ga0207683_100455004 | 145 |
| 430 | 3300026121 | Ga0207683_10065930 | Ga0207683_100659303 | 145 |
| 431 | 3300026121 | Ga0207683_10590181 | Ga0207683_105901812 | 145 |
| 432 | 3300026142 | Ga0207698_10067048 | Ga0207698_100670483 | 145 |
| 433 | 3300027471 | Ga0209995_1043435 | Ga0209995_10434352 | 145 |
| 434 | 3300027665 | Ga0209983_1021183 | Ga0209983_10211831 | 145 |
| 435 | 3300027876 | Ga0209974_10034958 | Ga0209974_100349582 | 145 |
| 436 | 3300027907 | Ga0207428_10000345 | Ga0207428_1000034513 | 145 |
| 437 | 3300027907 | Ga0207428_10000936 | Ga0207428_1000093623 | 145 |
| 438 | 3300027907 | Ga0207428_10021344 | Ga0207428_100213447 | 145 |
| 439 | 3300027907 | Ga0207428_10198661 | Ga0207428_101986611 | 145 |
| 440 | 3300027907 | Ga0207428_10208783 | Ga0207428_102087832 | 145 |
| 441 | 3300027907 | Ga0207428_10445993 | Ga0207428_104459932 | 145 |
| 442 | 3300028379 | Ga0268266_10128409 | Ga0268266_101284092 | 145 |
| 443 | 3300028380 | Ga0268265_10020045 | Ga0268265_100200452 | 145 |
| 444 | 3300028380 | Ga0268265_10370622 | Ga0268265_103706222 | 145 |
| 445 | 3300028380 | Ga0268265_10390580 | Ga0268265_103905802 | 145 |
| 446 | 3300028380 | Ga0268265_10636131 | Ga0268265_106361312 | 145 |
| 447 | 3300028380 | Ga0268265_11168192 | Ga0268265_111681922 | 145 |
| 448 | 3300028381 | Ga0268264_10034170 | Ga0268264_100341701 | 145 |
| 449 | 3300028381 | Ga0268264_10086550 | Ga0268264_100865502 | 145 |
| 450 | 3300028381 | Ga0268264_11251891 | Ga0268264_112518911 | 145 |
| 451 | 3300028381 | Ga0268264_11504774 | Ga0268264_115047741 | 145 |
| 452 | 3300031548 | Ga0307408_100043399 | Ga0307408_1000433993 | 145 |
| 453 | 3300031731 | Ga0307405_10007377 | Ga0307405_100073772 | 145 |
| 454 | 3300031731 | Ga0307405_10062237 | Ga0307405_100622372 | 145 |
| 455 | 3300031824 | Ga0307413_10000281 | Ga0307413_1000028110 | 145 |
| 456 | 3300031824 | Ga0307413_10003677 | Ga0307413_100036772 | 145 |
| 457 | 3300031852 | Ga0307410_10001116 | Ga0307410_100011165 | 145 |
| 458 | 3300031852 | Ga0307410_10037158 | Ga0307410_100371583 | 145 |
| 459 | 3300031852 | Ga0307410_10602543 | Ga0307410_106025432 | 145 |
| 460 | 3300031901 | Ga0307406_10025196 | Ga0307406_100251962 | 145 |
| 461 | 3300031903 | Ga0307407_10000476 | Ga0307407_100004766 | 145 |
| 462 | 3300031903 | Ga0307407_10003129 | Ga0307407_100031292 | 145 |
| 463 | 3300031911 | Ga0307412_11372604 | Ga0307412_113726042 | 145 |
| 464 | 3300031911 | Ga0307412_12024752 | Ga0307412_120247521 | 145 |
| 465 | 3300031995 | Ga0307409_100034031 | Ga0307409_1000340314 | 145 |
| 466 | 3300031995 | Ga0307409_100533910 | Ga0307409_1005339102 | 145 |
| 467 | 3300031995 | Ga0307409_102521853 | Ga0307409_1025218531 | 145 |
| 468 | 3300032002 | Ga0307416_100005491 | Ga0307416_1000054919 | 145 |
| 469 | 3300032002 | Ga0307416_100515664 | Ga0307416_1005156641 | 145 |
| 470 | 3300032004 | Ga0307414_10005544 | Ga0307414_100055442 | 145 |
| 471 | 3300032004 | Ga0307414_10274610 | Ga0307414_102746102 | 145 |
| 472 | 3300032004 | Ga0307414_11478359 | Ga0307414_114783591 | 145 |
| 473 | 3300032005 | Ga0307411_10004778 | Ga0307411_100047786 | 145 |
| 474 | 3300032005 | Ga0307411_10038452 | Ga0307411_100384523 | 145 |
| 475 | 3300032005 | Ga0307411_10058683 | Ga0307411_100586832 | 145 |
| 476 | 3300032005 | Ga0307411_10082164 | Ga0307411_100821643 | 145 |
| 477 | 3300032126 | Ga0307415_100053252 | Ga0307415_1000532522 | 145 |
| 478 | 3300032126 | Ga0307415_100230738 | Ga0307415_1002307382 | 145 |
| 479 | 3300032133 | Ga0316583_10016559 | Ga0316583_100165593 | 145 |
| 480 | 3300034819 | Ga0373958_0000446 | Ga0373958_0000446_2997_3455 | 145 |
| 481 | 3300034820 | Ga0373959_0081535 | Ga0373959_0081535_196_654 | 145 |
| 482 | 3300035088 | Ga0373940_0021496 | Ga0373940_0021496_906_1364 | 145 |
| 483 | 3300035115 | Ga0373941_0063958 | Ga0373941_0063958_228_686 | 145 |
| 484 | 3300039437 | Ga0436365_1565946 | Ga0436365_1565946_1797_2246 | 145 |
| 485 | 3300042008 | Ga0439450_047153 | Ga0439450_047153_403_861 | 145 |
| 486 | 3300042125 | Ga0450923_100480 | Ga0450923_100480_100_552 | 145 |
| 487 | 3300042127 | Ga0450890_011237 | Ga0450890_011237_552_1010 | 145 |
| 488 | 3300042156 | Ga0439446_0124927 | Ga0439446_0124927_351_809 | 145 |
| 489 | 3300042436 | Ga0439435_0016335 | Ga0439435_0016335_973_1452 | 145 |
| 490 | 3300042437 | Ga0439444_0034805 | Ga0439444_0034805_453_920 | 145 |
| 491 | 3300042439 | Ga0439464_0035573 | Ga0439464_0035573_330_788 | 145 |
| 492 | 3300042531 | Ga0450918_034876 | Ga0450918_034876_283_735 | 145 |
| 493 | 3300042993 | Ga0439440_0133066 | Ga0439440_0133066_185_643 | 145 |
| 494 | 3300045051 | Ga0451576_0039560 | Ga0451576_0039560_900_1358 | 145 |
| 495 | 3300046472 | Ga0495580_0702650 | Ga0495580_0702650_46_507 | 145 |
| 496 | 3300046537 | Ga0495598_0010801 | Ga0495598_0010801_1074_1535 | 145 |
| 497 | 3300046539 | Ga0495621_0164547 | Ga0495621_0164547_222_683 | 145 |
| 498 | 3300046683 | Ga0495658_0872520 | Ga0495658_0872520_16_477 | 145 |
| 499 | 3300048911 | Ga0496108_0267844 | Ga0496108_0267844_83_541 | 145 |
| 500 | 3300048912 | Ga0496109_0119298 | Ga0496109_0119298_701_1159 | 145 |
| 501 | 3300048913 | Ga0496110_0474136 | Ga0496110_0474136_420_899 | 145 |
| 502 | 3300048915 | Ga0496112_0725412 | Ga0496112_0725412_398_877 | 145 |
| 503 | 3300048916 | Ga0496113_0155747 | Ga0496113_0155747_536_994 | 145 |
| 504 | 3300049568 | Ga0501031_0433610 | Ga0501031_0433610_325_783 | 145 |
| 505 | 3300049569 | Ga0501032_0336641 | Ga0501032_0336641_431_886 | 145 |
| 506 | 3300049574 | Ga0501038_0082234 | Ga0501038_0082234_533_988 | 145 |
| 507 | 3300049576 | Ga0501040_0054284 | Ga0501040_0054284_1614_2069 | 145 |
| 508 | 3300049577 | Ga0501041_0241320 | Ga0501041_0241320_344_802 | 145 |
| 509 | 3300049577 | Ga0501041_0612176 | Ga0501041_0612176_75_530 | 145 |
| 510 | 3300049578 | Ga0501042_0036839 | Ga0501042_0036839_1410_1865 | 145 |
| 511 | 3300049579 | Ga0501043_0304440 | Ga0501043_0304440_468_923 | 145 |
| 512 | 3300049580 | Ga0501046_0039552 | Ga0501046_0039552_1632_2087 | 145 |
| 513 | 3300049582 | Ga0501048_0067007 | Ga0501048_0067007_792_1247 | 145 |
| 514 | 3300049587 | Ga0501071_0132168 | Ga0501071_0132168_611_1066 | 145 |
| 515 | 3300049588 | Ga0501072_0089143 | Ga0501072_0089143_829_1284 | 145 |
| 516 | 3300049590 | Ga0501074_0103590 | Ga0501074_0103590_1466_1921 | 145 |
| 517 | 3300049590 | Ga0501074_1309443 | Ga0501074_1309443_14_469 | 145 |
| 518 | 3300049591 | Ga0501075_0009791 | Ga0501075_0009791_2393_2848 | 145 |
| 519 | 3300049591 | Ga0501075_0242918 | Ga0501075_0242918_750_1214 | 145 |
| 520 | 3300049591 | Ga0501075_0378828 | Ga0501075_0378828_195_662 | 145 |
| 521 | 3300049591 | Ga0501075_0922201 | Ga0501075_0922201_66_524 | 145 |
| 522 | 3300049592 | Ga0501076_0058919 | Ga0501076_0058919_2259_2714 | 145 |
| 523 | 3300049592 | Ga0501076_0797822 | Ga0501076_0797822_241_699 | 145 |
| 524 | 3300049593 | Ga0501077_0015193 | Ga0501077_0015193_1935_2390 | 145 |
| 525 | 3300049593 | Ga0501077_0472641 | Ga0501077_0472641_35_490 | 145 |
| 526 | 3300049656 | Ga0501209_183744 | Ga0501209_183744_157_615 | 145 |
| 527 | 3300049667 | Ga0501230_029022 | Ga0501230_029022_68_526 | 145 |
| 528 | 3300049677 | Ga0501247_034864 | Ga0501247_034864_86_544 | 145 |
| 529 | 3300049741 | Ga0501079_1475745 | Ga0501079_1475745_61_519 | 145 |
| 530 | 3300049743 | Ga0501081_0001556 | Ga0501081_0001556_9134_9589 | 145 |
| 531 | 3300049779 | Ga0501283_135030 | Ga0501283_135030_16_480 | 145 |
| 532 | 3300049822 | Ga0501035_0180313 | Ga0501035_0180313_751_1206 | 145 |
| 533 | 3300050507 | nmdc:mga05p37_102700_c1 | nmdc:mga05p37_102700_c1_1009_1488 | 145 |
| 534 | 3300050507 | nmdc:mga05p37_12086_c1 | nmdc:mga05p37_12086_c1_120_578 | 145 |
| 535 | 3300050507 | nmdc:mga05p37_1218360_c1 | nmdc:mga05p37_1218360_c1_127_582 | 145 |
| 536 | 3300050507 | nmdc:mga05p37_248276_c1 | nmdc:mga05p37_248276_c1_316_768 | 145 |
| 537 | 3300050507 | nmdc:mga05p37_253725_c1 | nmdc:mga05p37_253725_c1_1380_1859 | 145 |
| 538 | 3300050507 | nmdc:mga05p37_65850_c1 | nmdc:mga05p37_65850_c1_2138_2617 | 145 |
| 539 | 3300050508 | nmdc:mga09592_104658_c1 | nmdc:mga09592_104658_c1_1748_2227 | 145 |
| 540 | 3300050508 | nmdc:mga09592_126849_c1 | nmdc:mga09592_126849_c1_865_1320 | 145 |
| 541 | 3300050508 | nmdc:mga09592_269428_c1 | nmdc:mga09592_269428_c1_174_632 | 145 |
| 542 | 3300050508 | nmdc:mga09592_2939_c1 | nmdc:mga09592_2939_c1_661_1119 | 145 |
| 543 | 3300050508 | nmdc:mga09592_3519_c1 | nmdc:mga09592_3519_c1_5884_6342 | 145 |
| 544 | 3300050508 | nmdc:mga09592_435821_c1 | nmdc:mga09592_435821_c1_616_1077 | 145 |
| 545 | 3300050508 | nmdc:mga09592_491204_c1 | nmdc:mga09592_491204_c1_380_859 | 145 |
| 546 | 3300050508 | nmdc:mga09592_55672_c1 | nmdc:mga09592_55672_c1_111_590 | 145 |
| 547 | 3300050508 | nmdc:mga09592_67022_c1 | nmdc:mga09592_67022_c1_258_710 | 145 |
| 548 | 3300050509 | nmdc:mga0qj67_258809_c1 | nmdc:mga0qj67_258809_c1_446_925 | 145 |
| 549 | 3300050509 | nmdc:mga0qj67_293166_c1 | nmdc:mga0qj67_293166_c1_298_750 | 145 |
| 550 | 3300050509 | nmdc:mga0qj67_33112_c1 | nmdc:mga0qj67_33112_c1_1632_2090 | 145 |
| 551 | 3300050509 | nmdc:mga0qj67_3596_c1 | nmdc:mga0qj67_3596_c1_6412_6870 | 145 |
| 552 | 3300050509 | nmdc:mga0qj67_43434_c1 | nmdc:mga0qj67_43434_c1_3013_3468 | 145 |
| 553 | 3300050509 | nmdc:mga0qj67_67785_c1 | nmdc:mga0qj67_67785_c1_1657_2115 | 145 |
| 554 | 3300050510 | nmdc:mga06r32_1265990_c1 | nmdc:mga06r32_1265990_c1_62_541 | 145 |
| 555 | 3300050510 | nmdc:mga06r32_180607_c1 | nmdc:mga06r32_180607_c1_1517_1996 | 145 |
| 556 | 3300050510 | nmdc:mga06r32_23370_c1 | nmdc:mga06r32_23370_c1_3727_4179 | 145 |
| 557 | 3300050510 | nmdc:mga06r32_596059_c1 | nmdc:mga06r32_596059_c1_243_722 | 145 |
| 558 | 3300050510 | nmdc:mga06r32_88268_c1 | nmdc:mga06r32_88268_c1_243_698 | 145 |
| 559 | 3300050510 | nmdc:mga06r32_98953_c2 | nmdc:mga06r32_98953_c2_862_1320 | 145 |
| 560 | 3300050511 | nmdc:mga08y16_1091333_c1 | nmdc:mga08y16_1091333_c1_231_710 | 145 |
| 561 | 3300050511 | nmdc:mga08y16_22565_c1 | nmdc:mga08y16_22565_c1_1031_1489 | 145 |
| 562 | 3300050511 | nmdc:mga08y16_325461_c1 | nmdc:mga08y16_325461_c1_888_1343 | 145 |
| 563 | 3300050511 | nmdc:mga08y16_3381_c1 | nmdc:mga08y16_3381_c1_7634_8101 | 145 |
| 564 | 3300050511 | nmdc:mga08y16_365845_c1 | nmdc:mga08y16_365845_c1_542_994 | 145 |
| 565 | 3300050511 | nmdc:mga08y16_381231_c1 | nmdc:mga08y16_381231_c1_448_912 | 145 |
| 566 | 3300050511 | nmdc:mga08y16_655_c1 | nmdc:mga08y16_655_c1_26887_27342 | 145 |
| 567 | 3300050511 | nmdc:mga08y16_73712_c1 | nmdc:mga08y16_73712_c1_1181_1660 | 145 |
| 568 | 3300050512 | nmdc:mga0n895_6535_c1 | nmdc:mga0n895_6535_c1_1008_1466 | 145 |
| 569 | 3300050513 | nmdc:mga0rr50_1036980_c1 | nmdc:mga0rr50_1036980_c1_148_606 | 145 |
| 570 | 3300050515 | nmdc:mga0a205_1056_c1 | nmdc:mga0a205_1056_c1_12968_13426 | 145 |
| 571 | 3300050515 | nmdc:mga0a205_60114_c1 | nmdc:mga0a205_60114_c1_309_788 | 145 |
| 572 | 3300054114 | Ga0501084_0051977 | Ga0501084_0051977_255_710 | 145 |
| 573 | 3300054114 | Ga0501084_1243032 | Ga0501084_1243032_82_537 | 145 |
| 574 | 3300061734 | Ga0530510_0668847 | Ga0530510_0668847_57_524 | 145 |
| 575 | iso_pu_bacteria | 2554235234 | 2555261640 | 145 |
| 576 | iso_pu_bacteria | 2667528172 | 2671105671 | 145 |
| 577 | iso_pu_bacteria | 2671180115 | 2671586716 | 145 |
| 578 | iso_pu_bacteria | 2721755693 | 2723602020 | 145 |
| 579 | iso_pu_bacteria | 2728369359 | 2730138092 | 145 |
| 580 | iso_pu_bacteria | 2751185905 | 2753812430 | 145 |
| 581 | iso_pu_bacteria | 2765235842 | 2765587108 | 145 |
| 582 | iso_pu_bacteria | 2823373977 | 2823378335 | 145 |
| 583 | iso_pu_bacteria | 2889276214 | 2889278094 | 145 |
| 584 | iso_pu_bacteria | 2908669403 | 2908671146 | 145 |
| 585 | iso_pu_bacteria | 2919108558 | 2919113192 | 145 |
| 586 | iso_pu_bacteria | 2971820967 | 2971826097 | 145 |
| 587 | iso_pu_bacteria | 2974310843 | 2974314014 | 145 |
| 588 | iso_pu_bacteria | 2996706504 | 2996712652 | 145 |
| 589 | iso_pu_bacteria | 8018405270 | 8018405566 | 145 |
| 590 | 3300005333 | Ga0070677_10001704 | Ga0070677_100017045 | 146 |
| 591 | 3300005353 | Ga0070669_100102313 | Ga0070669_1001023132 | 146 |
| 592 | 3300005356 | Ga0070674_100001218 | Ga0070674_10000121810 | 146 |
| 593 | 3300005441 | Ga0070700_100387809 | Ga0070700_1003878092 | 146 |
| 594 | 3300005548 | Ga0070665_100499857 | Ga0070665_1004998572 | 146 |
| 595 | 3300005549 | Ga0070704_100038367 | Ga0070704_1000383672 | 146 |
| 596 | 3300005577 | Ga0068857_100535873 | Ga0068857_1005358732 | 146 |
| 597 | 3300005617 | Ga0068859_101519377 | Ga0068859_1015193771 | 146 |
| 598 | 3300005840 | Ga0068870_10221415 | Ga0068870_102214152 | 146 |
| 599 | 3300005843 | Ga0068860_100560539 | Ga0068860_1005605391 | 146 |
| 600 | 3300006844 | Ga0075428_100053787 | Ga0075428_1000537873 | 146 |
| 601 | 3300006846 | Ga0075430_100008097 | Ga0075430_1000080975 | 146 |
| 602 | 3300006847 | Ga0075431_100254018 | Ga0075431_1002540182 | 146 |
| 603 | 3300006852 | Ga0075433_10012257 | Ga0075433_100122575 | 146 |
| 604 | 3300006871 | Ga0075434_100002389 | Ga0075434_10000238917 | 146 |
| 605 | 3300006880 | Ga0075429_100132770 | Ga0075429_1001327702 | 146 |
| 606 | 3300006881 | Ga0068865_101106331 | Ga0068865_1011063312 | 146 |
| 607 | 3300006931 | Ga0097620_101519209 | Ga0097620_1015192091 | 146 |
| 608 | 3300007076 | Ga0075435_100014136 | Ga0075435_1000141362 | 146 |
| 609 | 3300009094 | Ga0111539_10001128 | Ga0111539_1000112814 | 146 |
| 610 | 3300009094 | Ga0111539_11593827 | Ga0111539_115938272 | 146 |
| 611 | 3300009147 | Ga0114129_10086513 | Ga0114129_100865132 | 146 |
| 612 | 3300009147 | Ga0114129_10948927 | Ga0114129_109489271 | 146 |
| 613 | 3300009148 | Ga0105243_12261467 | Ga0105243_122614671 | 146 |
| 614 | 3300025885 | Ga0207653_10222722 | Ga0207653_102227221 | 146 |
| 615 | 3300025907 | Ga0207645_10117354 | Ga0207645_101173542 | 146 |
| 616 | 3300025918 | Ga0207662_10158149 | Ga0207662_101581492 | 146 |
| 617 | 3300025923 | Ga0207681_10056309 | Ga0207681_100563092 | 146 |
| 618 | 3300025923 | Ga0207681_10246435 | Ga0207681_102464352 | 146 |
| 619 | 3300025926 | Ga0207659_10614617 | Ga0207659_106146171 | 146 |
| 620 | 3300025935 | Ga0207709_11219072 | Ga0207709_112190721 | 146 |
| 621 | 3300025937 | Ga0207669_10703087 | Ga0207669_107030872 | 146 |
| 622 | 3300025937 | Ga0207669_10941425 | Ga0207669_109414251 | 146 |
| 623 | 3300027907 | Ga0207428_10001419 | Ga0207428_100014199 | 146 |
| 624 | 3300027907 | Ga0207428_10825286 | Ga0207428_108252861 | 146 |
| 625 | 3300028380 | Ga0268265_10405794 | Ga0268265_104057942 | 146 |
| 626 | 3300039437 | Ga0436365_0951881 | Ga0436365_0951881_1004_1486 | 146 |
| 627 | 3300049652 | Ga0501202_009257 | Ga0501202_009257_1265_1750 | 146 |
| 628 | 3300049676 | Ga0501246_048480 | Ga0501246_048480_12_497 | 146 |
| 629 | 3300049687 | Ga0501258_022530 | Ga0501258_022530_205_690 | 146 |
| 630 | 3300050507 | nmdc:mga05p37_406774_c1 | nmdc:mga05p37_406774_c1_222_707 | 146 |
| 631 | 3300050507 | nmdc:mga05p37_49819_c1 | nmdc:mga05p37_49819_c1_1443_1925 | 146 |
| 632 | 3300050511 | nmdc:mga08y16_1706_c1 | nmdc:mga08y16_1706_c1_2260_2745 | 146 |
| 633 | 3300050512 | nmdc:mga0n895_21708_c1 | nmdc:mga0n895_21708_c1_1381_1866 | 146 |
| 634 | 3300050513 | nmdc:mga0rr50_28569_c1 | nmdc:mga0rr50_28569_c1_1216_1698 | 146 |
| 635 | 3300050515 | nmdc:mga0a205_3281_c1 | nmdc:mga0a205_3281_c1_8291_8773 | 146 |
| 636 | 3300050515 | nmdc:mga0a205_577_c1 | nmdc:mga0a205_577_c1_5433_5918 | 146 |
| 637 | 3300053085 | Ga0495619_0552465 | Ga0495619_0552465_206_709 | 146 |
| 638 | iso_pu_bacteria | 3006969106 | 3006973354 | 146 |
| 639 | 3300010159 | Ga0099796_10018538 | Ga0099796_100185381 | 147 |
| 640 | 3300031344 | Ga0265316_10005214 | Ga0265316_100052143 | 148 |
| 641 | 3300005548 | Ga0070665_100000936 | Ga0070665_10000093616 | 149 |
| 642 | 3300006051 | Ga0075364_10013924 | Ga0075364_100139245 | 149 |
| 643 | 3300006946 | Ga0079104_1000107 | Ga0079104_100010732 | 149 |
| 644 | 3300006946 | Ga0079104_1000113 | Ga0079104_100011387 | 149 |
| 645 | 3300009011 | Ga0105251_10000273 | Ga0105251_1000027335 | 149 |
| 646 | 3300009011 | Ga0105251_10001705 | Ga0105251_100017057 | 149 |
| 647 | 3300009011 | Ga0105251_10006895 | Ga0105251_100068957 | 149 |
| 648 | 3300009011 | Ga0105251_10077069 | Ga0105251_100770693 | 149 |
| 649 | 3300009011 | Ga0105251_10157986 | Ga0105251_101579861 | 149 |
| 650 | 3300009036 | Ga0105244_10002761 | Ga0105244_100027617 | 149 |
| 651 | 3300009092 | Ga0105250_10000057 | Ga0105250_1000005713 | 149 |
| 652 | 3300013100 | Ga0157373_10281616 | Ga0157373_102816161 | 149 |
| 653 | 3300013102 | Ga0157371_10069695 | Ga0157371_100696951 | 149 |
| 654 | 3300013104 | Ga0157370_10004416 | Ga0157370_1000441614 | 149 |
| 655 | 3300025711 | Ga0207696_1000049 | Ga0207696_1000049265 | 149 |
| 656 | 3300025728 | Ga0207655_1001063 | Ga0207655_10010631 | 149 |
| 657 | 3300025735 | Ga0207713_1000105 | Ga0207713_100010587 | 149 |
| 658 | 3300025735 | Ga0207713_1000111 | Ga0207713_100011186 | 149 |
| 659 | 3300025735 | Ga0207713_1020893 | Ga0207713_10208931 | 149 |
| 660 | 3300025735 | Ga0207713_1098683 | Ga0207713_10986832 | 149 |
| 661 | 3300025735 | Ga0207713_1223296 | Ga0207713_12232961 | 149 |
| 662 | 3300025935 | Ga0207709_10000279 | Ga0207709_1000027940 | 149 |
| 663 | 3300027111 | Ga0209281_1000121 | Ga0209281_100012192 | 149 |
| 664 | 3300027111 | Ga0209281_1000220 | Ga0209281_100022031 | 149 |
| 665 | 3300028379 | Ga0268266_10000179 | Ga0268266_1000017983 | 149 |
| 666 | 3300042010 | Ga0439452_000127 | Ga0439452_000127_20736_21185 | 149 |
| 667 | 3300042439 | Ga0439464_0000268 | Ga0439464_0000268_4205_4654 | 149 |
| 668 | 3300046471 | Ga0495650_0012587 | Ga0495650_0012587_677_1126 | 149 |
| 669 | 3300046692 | Ga0495671_0035129 | Ga0495671_0035129_1401_1850 | 149 |
| 670 | 3300047446 | Ga0495679_031093 | Ga0495679_031093_530_979 | 149 |
| 671 | 3300048907 | Ga0496104_0056842 | Ga0496104_0056842_2199_2648 | 149 |
| 672 | 3300048908 | Ga0496105_0183214 | Ga0496105_0183214_582_1031 | 149 |
| 673 | 3300048919 | Ga0496116_0000854 | Ga0496116_0000854_20385_20834 | 149 |
| 674 | 3300048919 | Ga0496116_0421600 | Ga0496116_0421600_84_533 | 149 |
| 675 | 3300048920 | Ga0496117_0014636 | Ga0496117_0014636_4844_5293 | 149 |
| 676 | 3300048920 | Ga0496117_0019737 | Ga0496117_0019737_4316_4765 | 149 |
| 677 | 3300048920 | Ga0496117_0091762 | Ga0496117_0091762_125_574 | 149 |
| 678 | 3300048920 | Ga0496117_0092891 | Ga0496117_0092891_398_847 | 149 |
| 679 | 3300048921 | Ga0496118_0014184 | Ga0496118_0014184_5920_6369 | 149 |
| 680 | 3300048921 | Ga0496118_0027919 | Ga0496118_0027919_3840_4289 | 149 |
| 681 | 3300048922 | Ga0496119_0001986 | Ga0496119_0001986_19030_19479 | 149 |
| 682 | 3300048922 | Ga0496119_0003423 | Ga0496119_0003423_9477_9926 | 149 |
| 683 | 3300048922 | Ga0496119_0004874 | Ga0496119_0004874_287_736 | 149 |
| 684 | 3300048922 | Ga0496119_0039265 | Ga0496119_0039265_1660_2109 | 149 |
| 685 | 3300048923 | Ga0496120_0001616 | Ga0496120_0001616_19961_20410 | 149 |
| 686 | 3300048923 | Ga0496120_0001967 | Ga0496120_0001967_5451_5900 | 149 |
| 687 | 3300048923 | Ga0496120_0010047 | Ga0496120_0010047_3721_4170 | 149 |
| 688 | 3300048923 | Ga0496120_0030080 | Ga0496120_0030080_939_1388 | 149 |
| 689 | 3300048924 | Ga0496121_0055686 | Ga0496121_0055686_2720_3169 | 149 |
| 690 | 3300048924 | Ga0496121_0333953 | Ga0496121_0333953_381_830 | 149 |
| 691 | 3300048925 | Ga0496122_0000726 | Ga0496122_0000726_55064_55513 | 149 |
| 692 | 3300048925 | Ga0496122_0064596 | Ga0496122_0064596_1324_1773 | 149 |
| 693 | 3300048925 | Ga0496122_0380652 | Ga0496122_0380652_170_619 | 149 |
| 694 | 3300048926 | Ga0496123_0000371 | Ga0496123_0000371_74902_75351 | 149 |
| 695 | 3300048926 | Ga0496123_0018262 | Ga0496123_0018262_767_1216 | 149 |
| 696 | 3300048926 | Ga0496123_0078233 | Ga0496123_0078233_1184_1633 | 149 |
| 697 | 3300048927 | Ga0496124_0132695 | Ga0496124_0132695_660_1109 | 149 |
| 698 | 3300048927 | Ga0496124_0173426 | Ga0496124_0173426_649_1098 | 149 |
| 699 | 3300048927 | Ga0496124_0335135 | Ga0496124_0335135_61_510 | 149 |
| 700 | 3300048928 | Ga0496125_0002592 | Ga0496125_0002592_19341_19790 | 149 |
| 701 | 3300048928 | Ga0496125_0035821 | Ga0496125_0035821_955_1404 | 149 |
| 702 | 3300048929 | Ga0496126_0002346 | Ga0496126_0002346_8988_9437 | 149 |
| 703 | 3300048929 | Ga0496126_0023911 | Ga0496126_0023911_2167_2616 | 149 |
| 704 | 3300048929 | Ga0496126_0069617 | Ga0496126_0069617_2404_2853 | 149 |
| 705 | 3300048929 | Ga0496126_0282821 | Ga0496126_0282821_424_873 | 149 |
| 706 | 3300048929 | Ga0496126_0466698 | Ga0496126_0466698_466_915 | 149 |
| 707 | 3300048929 | Ga0496126_0475067 | Ga0496126_0475067_360_809 | 149 |
| 708 | iso_pu_bacteria | 2600255256 | 2601535543 | 149 |
| 709 | iso_pu_bacteria | 2600255257 | 2601541580 | 149 |
| 710 | iso_pu_bacteria | 2600255310 | 2601759870 | 149 |
| 711 | iso_pu_bacteria | 2600255311 | 2601762338 | 149 |
| 712 | iso_pu_bacteria | 2602042046 | 2603640911 | 149 |
| 713 | iso_pu_bacteria | 2811995292 | 2813731015 | 149 |
| 714 | iso_pu_bacteria | 2814123068 | 2814698638 | 149 |
| 715 | 3300005290 | Ga0065712_10230042 | Ga0065712_102300422 | 151 |
| 716 | 3300005456 | Ga0070678_100227524 | Ga0070678_1002275242 | 151 |
| 717 | 3300009036 | Ga0105244_10002809 | Ga0105244_100028096 | 151 |
| 718 | 3300025728 | Ga0207655_1006353 | Ga0207655_10063534 | 151 |
| 719 | 3300025937 | Ga0207669_10937624 | Ga0207669_109376241 | 151 |
| 720 | 3300026121 | Ga0207683_10344897 | Ga0207683_103448972 | 151 |
| 721 | 3300048919 | Ga0496116_0286995 | Ga0496116_0286995_70_549 | 151 |
| 722 | 3300048925 | Ga0496122_0014742 | Ga0496122_0014742_6792_7271 | 151 |
| 723 | 2010549000 | RicEn_C7209 | RicEn_127370 | 153 |
| 724 | 3300003856 | Ga0058692_1010703 | Ga0058692_10107031 | 153 |
| 725 | 3300027312 | Ga0209371_1000046 | Ga0209371_1000046106 | 153 |
| 726 | 3300030500 | Ga0268256_1000012 | Ga0268256_1000012126 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ph4-assembly1.cif.gz_A | clostridium thermocellum ribose-5-phosphate isomerase b with d-allose | 0.993 | 3 | 146 |
| 2vvr-assembly1.cif.gz_A | crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate | 0.9922 | 1 | 147 |
| 1nn4-assembly1.cif.gz_A | structural genomics, rpib/alsb | 0.9917 | 1 | 146 |
| 2vvr-assembly1.cif.gz_A | crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate | 0.9856 | 1 | 147 |
| 1o1x-assembly1.cif.gz_A | crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution | 0.9785 | 2 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1nn4D00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9918 | 1 | 147 | 3.40.1400.10 |
| 1o1xA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9753 | 2 | 143 | 3.40.1400.10 |
| 3s5pB00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9695 | 2 | 130 | 3.40.1400.10 |
| 6fxsA00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9644 | 1 | 144 | 3.40.1400.10 |
| 4lfkB00 | Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB | 0.9599 | 3 | 149 | 3.40.1400.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4MLN9-F1-model_v4 | Ribose 5-phosphate isomerase B | 0.9976 | 3 | 145 |
GO:0004725
GO:0005975 GO:0016861 |
| AF-A0A835KZ10-F1-model_v4 | Ribose-5-phosphate isomerase | 0.9975 | 3 | 145 |
GO:0005975
GO:0016857 |
| AF-A0A3M2AKR7-F1-model_v4 | Ribose 5-phosphate isomerase B (EC 5.3.1.6) | 0.9963 | 3 | 145 |
GO:0004751
GO:0005975 |
| AF-A0A1G0SL72-F1-model_v4 | Ribose 5-phosphate isomerase B | 0.996 | 3 | 145 |
GO:0004751
GO:0009052 GO:0019316 |
| AF-D1AKE7-F1-model_v4 | Sugar-phosphate isomerase, RpiB/LacA/LacB family (EC 5.3.1.26) | 0.9959 | 3 | 143 |
GO:0004751
GO:0009052 GO:0019316 GO:0050044 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar