F477659

General Info

Members Datasets Scaffolds Average Seq Length
726 291 702 153

Family's Representative Sequence

Representative Sequence 3300005333|Ga0070677_10001704|Ga0070677_100017045
Length 177
Sequence MAKVYSAALDLTTEPGIRPVYSVRRMRIALAADHAGFELKQQMGAYLTRQGHDVVDLGTHSTAPVDYPDSAEAVAQTIFDGHADRGVIVCGSGAGVSIAANKFPGIRAAVCHDTYTAHQAVEHDDMNVLCVGSRVIGSALACEIVDAFLRAQFSHEDRHQRRLNKIFAIERRFVVRS

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
3 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
4 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
5 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
6 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
7 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
8 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
9 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
10 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
11 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
12 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
13 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
14 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
15 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
16 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
17 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
18 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
19 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
20 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
21 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
22 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
23 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
24 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
25 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
26 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
27 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
34 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
35 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
36 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
43 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
55 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
65 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
66 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
67 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
68 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
69 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
70 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
71 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
74 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
79 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
80 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
81 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
82 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
83 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
90 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
91 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
120 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
184 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
193 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
208 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
209 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
210 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
213 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
214 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
215 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
216 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
217 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
218 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
219 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
220 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
221 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
222 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
223 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
233 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
244 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
245 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
246 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
270 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
271 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
272 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
273 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
274 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
277 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
280 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
281 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
282 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
290 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
291 8055092621 Silvania confinis H4N4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.69
Metatranscriptomes 0
Isolates 3.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.28
Nodule 0.55
Rhizoplane 1.93
Rhizosphere 91.05
Stem 0
Stem Tuber 0
Unclassified 6.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C7209 2010549000 Bacteria 1650
2 JGI24746J21847_1004962 3300001977 Unclassified 2085
3 JGI24750J21931_1031514 3300002070 Unclassified 779
4 JGI24748J21848_1024759 3300002074 Unclassified 731
5 Ga0058692_1010703 3300003856 Bacteria 2256
6 Ga0065714_10153851 3300005288 Bacteria 1090
7 Ga0065712_10006027 3300005290 Bacteria 2886
8 Ga0065712_10083231 3300005290 Bacteria 2853
9 Ga0065712_10139486 3300005290 Bacteria 1460
10 Ga0065712_10230042 3300005290 Bacteria 1014
11 Ga0065715_10003216 3300005293 Bacteria 6801
12 Ga0065715_10091582 3300005293 Bacteria 5690
13 Ga0065715_10357900 3300005293 Bacteria 922
14 Ga0065707_10262348 3300005295 Bacteria 1079
15 Ga0065707_10587687 3300005295 Bacteria 698
16 Ga0070676_10001803 3300005328 Bacteria 10896
17 Ga0070676_10011233 3300005328 Bacteria 4870
18 Ga0070676_10029452 3300005328 Bacteria 3122
19 Ga0070683_100153201 3300005329 Bacteria 2185
20 Ga0070683_100460795 3300005329 Bacteria 1213
21 Ga0070690_100013980 3300005330 Bacteria 4759
22 Ga0070690_100015578 3300005330 Bacteria 4540
23 Ga0070690_100307723 3300005330 Bacteria 1138
24 Ga0070670_100018731 3300005331 Bacteria 5935
25 Ga0070670_100021290 3300005331 Bacteria 5578
26 Ga0070670_100118295 3300005331 Bacteria 2285
27 Ga0070670_100763984 3300005331 Unclassified 871
28 Ga0070677_10001704 3300005333 Bacteria 6959
29 Ga0070677_10016661 3300005333 Bacteria 2619
30 Ga0070677_10019971 3300005333 Bacteria 2435
31 Ga0070677_10070904 3300005333 Bacteria 1466
32 Ga0070677_10447767 3300005333 Bacteria 690
33 Ga0070677_10456214 3300005333 Unclassified 685
34 Ga0068869_100001451 3300005334 Bacteria 14018
35 Ga0068869_100074093 3300005334 Bacteria 2526
36 Ga0070666_10038935 3300005335 Bacteria 3165
37 Ga0070666_10602350 3300005335 Bacteria 802
38 Ga0070666_10777080 3300005335 Bacteria 705
39 Ga0070666_11074445 3300005335 Unclassified 598
40 Ga0068868_100100155 3300005338 Bacteria 2344
41 Ga0068868_100139496 3300005338 Bacteria 1989
42 Ga0070689_100065087 3300005340 Bacteria 2838
43 Ga0070689_100077049 3300005340 Bacteria 2612
44 Ga0070689_100107321 3300005340 Bacteria 2217
45 Ga0070689_101234337 3300005340 Unclassified 672
46 Ga0070691_10096726 3300005341 Bacteria 1462
47 Ga0070687_100022049 3300005343 Bacteria 3005
48 Ga0070687_100135038 3300005343 Bacteria 1429
49 Ga0070661_100028138 3300005344 Bacteria 4053
50 Ga0070661_100038268 3300005344 Bacteria 3491
51 Ga0070661_100269055 3300005344 Unclassified 1319
52 Ga0070692_10047812 3300005345 Bacteria 2215
53 Ga0070668_100007025 3300005347 Bacteria 8342
54 Ga0070668_100149585 3300005347 Bacteria 1887
55 Ga0070668_100538501 3300005347 Bacteria 1015
56 Ga0070669_100017527 3300005353 Bacteria 5108
57 Ga0070669_100019575 3300005353 Bacteria 4834
58 Ga0070669_100031277 3300005353 Bacteria 3845
59 Ga0070669_100079044 3300005353 Bacteria 2445
60 Ga0070669_100102313 3300005353 Bacteria 2163
61 Ga0070669_100162736 3300005353 Unclassified 1735
62 Ga0070669_100181322 3300005353 Bacteria 1647
63 Ga0070669_100230981 3300005353 Unclassified 1466
64 Ga0070669_100612755 3300005353 Bacteria 913
65 Ga0070675_100001179 3300005354 Bacteria 18976
66 Ga0070675_100001525 3300005354 Bacteria 17133
67 Ga0070675_100001605 3300005354 Bacteria 16679
68 Ga0070675_100002993 3300005354 Bacteria 12766
69 Ga0070675_100006002 3300005354 Bacteria 9309
70 Ga0070675_100041401 3300005354 Bacteria 3763
71 Ga0070675_100084418 3300005354 Bacteria 2652
72 Ga0070675_100093838 3300005354 Bacteria 2517
73 Ga0070675_100537906 3300005354 Bacteria 1055
74 Ga0070675_100556280 3300005354 Bacteria 1038
75 Ga0070675_101164549 3300005354 Bacteria 709
76 Ga0070671_100014421 3300005355 Bacteria 6386
77 Ga0070671_100027688 3300005355 Bacteria 4666
78 Ga0070671_100838867 3300005355 Bacteria 801
79 Ga0070674_100001218 3300005356 Bacteria 13509
80 Ga0070674_100023270 3300005356 Bacteria 4007
81 Ga0070674_100203049 3300005356 Unclassified 1532
82 Ga0070674_100458571 3300005356 Unclassified 1053
83 Ga0070674_100671268 3300005356 Unclassified 883
84 Ga0070673_100005331 3300005364 Bacteria 8210
85 Ga0070673_100005380 3300005364 Bacteria 8182
86 Ga0070673_100041029 3300005364 Bacteria 3554
87 Ga0070673_100058601 3300005364 Bacteria 3045
88 Ga0070673_100061220 3300005364 Bacteria 2986
89 Ga0070673_100107103 3300005364 Bacteria 2312
90 Ga0070673_100269605 3300005364 Bacteria 1489
91 Ga0070673_100542719 3300005364 Bacteria 1055
92 Ga0070673_100770985 3300005364 Bacteria 887
93 Ga0070688_100015922 3300005365 Bacteria 4288
94 Ga0070688_100078062 3300005365 Bacteria 2135
95 Ga0070688_100143865 3300005365 Bacteria 1623
96 Ga0070659_100056589 3300005366 Bacteria 3092
97 Ga0070659_100160483 3300005366 Bacteria 1838
98 Ga0070667_100008511 3300005367 Bacteria 8505
99 Ga0070667_100145274 3300005367 Unclassified 2080
100 Ga0070703_10136695 3300005406 Bacteria 906
101 Ga0070701_10053071 3300005438 Bacteria 2109
102 Ga0070701_10213041 3300005438 Unclassified 1148
103 Ga0070701_10322737 3300005438 Unclassified 956
104 Ga0070700_100006546 3300005441 Bacteria 6231
105 Ga0070700_100040351 3300005441 Bacteria 2856
106 Ga0070700_100192320 3300005441 Bacteria 1427
107 Ga0070700_100387809 3300005441 Bacteria 1047
108 Ga0070694_100198467 3300005444 Bacteria 1494
109 Ga0070694_101285768 3300005444 Bacteria 615
110 Ga0070663_100067841 3300005455 Bacteria 2589
111 Ga0070663_100359417 3300005455 Bacteria 1181
112 Ga0070678_100002418 3300005456 Bacteria 10229
113 Ga0070678_100116757 3300005456 Bacteria 2097
114 Ga0070678_100120593 3300005456 Bacteria 2067
115 Ga0070678_100227524 3300005456 Bacteria 1553
116 Ga0070678_100431331 3300005456 Bacteria 1151
117 Ga0070662_100171368 3300005457 Bacteria 1705
118 Ga0070662_100290512 3300005457 Bacteria 1325
119 Ga0068867_100005657 3300005459 Bacteria 8863
120 Ga0068867_100049711 3300005459 Bacteria 3087
121 Ga0068867_100089462 3300005459 Bacteria 2334
122 Ga0070685_10003652 3300005466 Bacteria 7805
123 Ga0070706_101132316 3300005467 Bacteria 720
124 Ga0070707_101712296 3300005468 Bacteria 596
125 Ga0070698_100493644 3300005471 Bacteria 1162
126 Ga0070699_100010424 3300005518 Bacteria 8044
127 Ga0070699_100384682 3300005518 Bacteria 1267
128 Ga0070699_100405400 3300005518 Bacteria 1233
129 Ga0070679_100624897 3300005530 Bacteria 1020
130 Ga0070697_100070893 3300005536 Bacteria 2858
131 Ga0070697_100789195 3300005536 Bacteria 840
132 Ga0070672_100043126 3300005543 Unclassified 3476
133 Ga0070672_100048076 3300005543 Bacteria 3313
134 Ga0070672_100083932 3300005543 Bacteria 2557
135 Ga0070672_100088957 3300005543 Bacteria 2487
136 Ga0070672_100147289 3300005543 Bacteria 1946
137 Ga0070672_100432042 3300005543 Bacteria 1132
138 Ga0070672_100822524 3300005543 Bacteria 818
139 Ga0070686_100002140 3300005544 Bacteria 10884
140 Ga0070686_100102268 3300005544 Bacteria 1938
141 Ga0070695_100404924 3300005545 Bacteria 1035
142 Ga0070696_100619570 3300005546 Bacteria 874
143 Ga0070665_100000936 3300005548 Bacteria 37365
144 Ga0070665_100499857 3300005548 Unclassified 1227
145 Ga0070704_100038367 3300005549 Bacteria 3281
146 Ga0070704_100102018 3300005549 Bacteria 2164
147 Ga0070704_100469227 3300005549 Bacteria 1087
148 Ga0070664_100008661 3300005564 Bacteria 8233
149 Ga0070664_100011840 3300005564 Bacteria 7081
150 Ga0070664_100018755 3300005564 Bacteria 5691
151 Ga0070664_100023467 3300005564 Bacteria 5096
152 Ga0070664_100646018 3300005564 Unclassified 983
153 Ga0068857_100137571 3300005577 Unclassified 2206
154 Ga0068857_100535873 3300005577 Bacteria 1102
155 Ga0068854_100240643 3300005578 Bacteria 1441
156 Ga0070702_100091704 3300005615 Bacteria 1844
157 Ga0070702_100268119 3300005615 Unclassified 1166
158 Ga0068852_100470248 3300005616 Bacteria 1248
159 Ga0068859_100032983 3300005617 Bacteria 5202
160 Ga0068859_100078453 3300005617 Bacteria 3343
161 Ga0068859_100079161 3300005617 Bacteria 3326
162 Ga0068859_100149357 3300005617 Bacteria 2412
163 Ga0068859_100296970 3300005617 Bacteria 1709
164 Ga0068859_100695037 3300005617 Unclassified 1108
165 Ga0068859_101519377 3300005617 Bacteria 739
166 Ga0068859_101946027 3300005617 Bacteria 649
167 Ga0068864_100034893 3300005618 Bacteria 4281
168 Ga0068864_100113074 3300005618 Bacteria 2420
169 Ga0068864_100149930 3300005618 Bacteria 2112
170 Ga0068864_100179373 3300005618 Bacteria 1935
171 Ga0068864_100577556 3300005618 Bacteria 1089
172 Ga0068866_10016871 3300005718 Bacteria 3274
173 Ga0068866_10020245 3300005718 Bacteria 3046
174 Ga0068866_10088854 3300005718 Bacteria 1678
175 Ga0068861_100001769 3300005719 Bacteria 13895
176 Ga0068861_100035452 3300005719 Bacteria 3695
177 Ga0068861_100114692 3300005719 Unclassified 2164
178 Ga0068861_100167128 3300005719 Bacteria 1820
179 Ga0068861_100339224 3300005719 Bacteria 1315
180 Ga0068861_100795250 3300005719 Bacteria 887
181 Ga0068870_10000294 3300005840 Bacteria 18487
182 Ga0068870_10014325 3300005840 Bacteria 3745
183 Ga0068870_10221415 3300005840 Bacteria 1158
184 Ga0068870_10286436 3300005840 Bacteria 1035
185 Ga0068863_100012272 3300005841 Bacteria 8273
186 Ga0068863_100457180 3300005841 Bacteria 1253
187 Ga0068858_100025311 3300005842 Bacteria 5522
188 Ga0068858_101183928 3300005842 Unclassified 751
189 Ga0068860_100010293 3300005843 Bacteria 9251
190 Ga0068860_100560539 3300005843 Unclassified 1145
191 Ga0068860_102075576 3300005843 Unclassified 590
192 Ga0068862_100004508 3300005844 Bacteria 11744
193 Ga0068862_100428228 3300005844 Bacteria 1243
194 Ga0068862_100458063 3300005844 Unclassified 1203
195 Ga0068862_100504247 3300005844 Unclassified 1149
196 Ga0068862_101315279 3300005844 Bacteria 724
197 Ga0068862_101574063 3300005844 Bacteria 664
198 Ga0081455_10018672 3300005937 Bacteria 6588
199 Ga0075364_10013924 3300006051 Bacteria 4957
200 Ga0075432_10151231 3300006058 Bacteria 892
201 Ga0097621_100020236 3300006237 Bacteria 5126
202 Ga0097621_102110613 3300006237 Bacteria 539
203 Ga0068871_101066518 3300006358 Unclassified 755
204 Ga0068871_101727700 3300006358 Bacteria 594
205 Ga0075428_100001914 3300006844 Bacteria 22338
206 Ga0075428_100003245 3300006844 Bacteria 17800
207 Ga0075428_100053787 3300006844 Bacteria 4412
208 Ga0075428_100055045 3300006844 Bacteria 4360
209 Ga0075428_100301188 3300006844 Bacteria 1723
210 Ga0075428_100375660 3300006844 Bacteria 1524
211 Ga0075428_100965784 3300006844 Unclassified 903
212 Ga0075430_100008097 3300006846 Bacteria 8884
213 Ga0075430_100008767 3300006846 Bacteria 8534
214 Ga0075430_100017358 3300006846 Bacteria 6130
215 Ga0075430_100185512 3300006846 Unclassified 1730
216 Ga0075431_100020297 3300006847 Bacteria 6787
217 Ga0075431_100050732 3300006847 Bacteria 4278
218 Ga0075431_100254018 3300006847 Bacteria 1785
219 Ga0075431_100338840 3300006847 Bacteria 1513
220 Ga0075433_10003776 3300006852 Bacteria 11725
221 Ga0075433_10012257 3300006852 Bacteria 6914
222 Ga0075433_10160450 3300006852 Bacteria 2001
223 Ga0075434_100002389 3300006871 Bacteria 16482
224 Ga0075434_100004765 3300006871 Bacteria 12281
225 Ga0075434_100193277 3300006871 Unclassified 2055
226 Ga0075434_100241783 3300006871 Unclassified 1825
227 Ga0075429_100014564 3300006880 Bacteria 6815
228 Ga0075429_100017259 3300006880 Bacteria 6242
229 Ga0075429_100063369 3300006880 Unclassified 3221
230 Ga0075429_100082120 3300006880 Bacteria 2809
231 Ga0075429_100132770 3300006880 Bacteria 2178
232 Ga0075429_100186601 3300006880 Bacteria 1817
233 Ga0068865_100005969 3300006881 Bacteria 7421
234 Ga0068865_100013650 3300006881 Bacteria 5142
235 Ga0068865_100085681 3300006881 Bacteria 2273
236 Ga0068865_101106331 3300006881 Unclassified 698
237 Ga0097620_100032982 3300006931 Bacteria 5202
238 Ga0097620_100078451 3300006931 Bacteria 3343
239 Ga0097620_100079160 3300006931 Bacteria 3326
240 Ga0097620_100149357 3300006931 Bacteria 2412
241 Ga0097620_100296976 3300006931 Bacteria 1709
242 Ga0097620_100695033 3300006931 Unclassified 1108
243 Ga0097620_101519209 3300006931 Bacteria 739
244 Ga0097620_101945913 3300006931 Bacteria 649
245 Ga0079104_1000107 3300006946 Bacteria 122549
246 Ga0079104_1000113 3300006946 Bacteria 116001
247 Ga0075435_100014136 3300007076 Bacteria 5957
248 Ga0075435_101224708 3300007076 Bacteria 657
249 Ga0105251_10000273 3300009011 Bacteria 51739
250 Ga0105251_10001705 3300009011 Bacteria 18401
251 Ga0105251_10006895 3300009011 Bacteria 7127
252 Ga0105251_10077069 3300009011 Bacteria 1546
253 Ga0105251_10157986 3300009011 Bacteria 1022
254 Ga0105244_10002761 3300009036 Bacteria 13093
255 Ga0105244_10002809 3300009036 Bacteria 12928
256 Ga0105250_10000057 3300009092 Bacteria 112440
257 Ga0111539_10000065 3300009094 Bacteria 106698
258 Ga0111539_10001128 3300009094 Bacteria 35328
259 Ga0111539_10003932 3300009094 Bacteria 19530
260 Ga0111539_10010451 3300009094 Bacteria 11682
261 Ga0111539_10029612 3300009094 Bacteria 6665
262 Ga0111539_10123724 3300009094 Bacteria 3032
263 Ga0111539_10128168 3300009094 Bacteria 2972
264 Ga0111539_10132048 3300009094 Bacteria 2924
265 Ga0111539_10454386 3300009094 Bacteria 1492
266 Ga0111539_11593827 3300009094 Unclassified 757
267 Ga0111539_13426845 3300009094 Unclassified 510
268 Ga0105245_10439202 3300009098 Bacteria 1311
269 Ga0105245_10530098 3300009098 Bacteria 1197
270 Ga0105247_10121777 3300009101 Bacteria 1691
271 Ga0105247_10715924 3300009101 Bacteria 755
272 Ga0114129_10007052 3300009147 Bacteria 15997
273 Ga0114129_10013734 3300009147 Bacteria 11544
274 Ga0114129_10069282 3300009147 Bacteria 4917
275 Ga0114129_10086513 3300009147 Bacteria 4347
276 Ga0114129_10904545 3300009147 Bacteria 1118
277 Ga0114129_10948927 3300009147 Bacteria 1087
278 Ga0105243_10368431 3300009148 Bacteria 1325
279 Ga0105243_10528754 3300009148 Bacteria 1123
280 Ga0105243_12261467 3300009148 Unclassified 581
281 Ga0105242_10089084 3300009176 Bacteria 2593
282 Ga0105242_10921389 3300009176 Bacteria 876
283 Ga0105248_10132152 3300009177 Bacteria 2816
284 Ga0105248_10175637 3300009177 Bacteria 2414
285 Ga0105237_11289279 3300009545 Bacteria 737
286 Ga0105238_10018652 3300009551 Bacteria 7064
287 Ga0105249_10001042 3300009553 Bacteria 24508
288 Ga0105249_10709088 3300009553 Unclassified 1067
289 Ga0099796_10018538 3300010159 Unclassified 2093
290 Ga0105246_10066755 3300011119 Bacteria 2519
291 Ga0105246_10728112 3300011119 Bacteria 872
292 Ga0157319_1020816 3300012497 Bacteria 635
293 Ga0157315_1007777 3300012508 Bacteria 879
294 Ga0157373_10281616 3300013100 Bacteria 1178
295 Ga0157371_10069695 3300013102 Bacteria 2490
296 Ga0157370_10004416 3300013104 Bacteria 16115
297 Ga0157374_10059837 3300013296 Bacteria 3563
298 Ga0157374_10069372 3300013296 Bacteria 3319
299 Ga0157374_10888260 3300013296 Bacteria 909
300 Ga0157378_10308181 3300013297 Bacteria 1535
301 Ga0157378_12666120 3300013297 Unclassified 552
302 Ga0163162_10003027 3300013306 Bacteria 16062
303 Ga0163162_10325311 3300013306 Unclassified 1670
304 Ga0163162_12864463 3300013306 Unclassified 555
305 Ga0157375_10025152 3300013308 Bacteria 5524
306 Ga0157375_10209635 3300013308 Bacteria 2106
307 Ga0157375_10286120 3300013308 Bacteria 1811
308 Ga0157375_10924287 3300013308 Bacteria 1015
309 Ga0157375_10983940 3300013308 Bacteria 984
310 Ga0157375_11216360 3300013308 Bacteria 884
311 Ga0157375_11736685 3300013308 Bacteria 739
312 Ga0163163_10029464 3300014325 Bacteria 5281
313 Ga0163163_10050630 3300014325 Bacteria 4090
314 Ga0163163_10377985 3300014325 Bacteria 1474
315 Ga0157380_10009450 3300014326 Bacteria 6986
316 Ga0157380_10045860 3300014326 Bacteria 3433
317 Ga0157380_10069366 3300014326 Bacteria 2844
318 Ga0157380_10074956 3300014326 Bacteria 2749
319 Ga0157380_10095697 3300014326 Unclassified 2461
320 Ga0157380_10110572 3300014326 Bacteria 2308
321 Ga0157380_10217281 3300014326 Bacteria 1708
322 Ga0157380_10427951 3300014326 Bacteria 1264
323 Ga0157380_11038230 3300014326 Bacteria 855
324 Ga0157380_11800383 3300014326 Bacteria 671
325 Ga0157377_10004519 3300014745 Bacteria 6421
326 Ga0157377_10044839 3300014745 Unclassified 2467
327 Ga0157377_10108759 3300014745 Bacteria 1663
328 Ga0157377_10123198 3300014745 Bacteria 1574
329 Ga0157377_10223128 3300014745 Unclassified 1208
330 Ga0157379_10003743 3300014968 Bacteria 12937
331 Ga0157379_10131137 3300014968 Bacteria 2256
332 Ga0157376_10705222 3300014969 Bacteria 1015
333 Ga0157376_11878163 3300014969 Bacteria 636
334 Ga0163161_10006354 3300017792 Bacteria 8176
335 Ga0213876_10383765 3300021384 Unclassified 747
336 Ga0207673_1030846 3300025290 Bacteria 742
337 Ga0207697_10000085 3300025315 Bacteria 41401
338 Ga0207697_10089054 3300025315 Bacteria 1307
339 Ga0207696_1000049 3300025711 Bacteria 281296
340 Ga0207655_1001063 3300025728 Bacteria 27348
341 Ga0207655_1006353 3300025728 Bacteria 7843
342 Ga0207713_1000105 3300025735 Bacteria 138195
343 Ga0207713_1000111 3300025735 Bacteria 133625
344 Ga0207713_1020893 3300025735 Bacteria 3154
345 Ga0207713_1098683 3300025735 Bacteria 1012
346 Ga0207713_1223296 3300025735 Bacteria 567
347 Ga0207653_10215231 3300025885 Bacteria 728
348 Ga0207653_10222722 3300025885 Bacteria 717
349 Ga0207682_10005915 3300025893 Bacteria 4950
350 Ga0207682_10021779 3300025893 Bacteria 2522
351 Ga0207682_10067630 3300025893 Bacteria 1508
352 Ga0207682_10174524 3300025893 Bacteria 979
353 Ga0207642_10038792 3300025899 Unclassified 2064
354 Ga0207710_10065406 3300025900 Bacteria 1657
355 Ga0207688_10000477 3300025901 Bacteria 19238
356 Ga0207688_10013379 3300025901 Bacteria 4457
357 Ga0207688_10129377 3300025901 Bacteria 1479
358 Ga0207688_10196070 3300025901 Bacteria 1209
359 Ga0207680_10067608 3300025903 Bacteria 2202
360 Ga0207680_10294839 3300025903 Bacteria 1129
361 Ga0207680_10365300 3300025903 Bacteria 1015
362 Ga0207647_10263199 3300025904 Bacteria 987
363 Ga0207645_10003970 3300025907 Bacteria 11042
364 Ga0207645_10051127 3300025907 Bacteria 2640
365 Ga0207645_10117354 3300025907 Bacteria 1726
366 Ga0207645_10435744 3300025907 Bacteria 884
367 Ga0207643_10000621 3300025908 Bacteria 22386
368 Ga0207643_10016413 3300025908 Bacteria 4040
369 Ga0207643_10062822 3300025908 Bacteria 2122
370 Ga0207643_10079881 3300025908 Bacteria 1894
371 Ga0207643_10170537 3300025908 Bacteria 1313
372 Ga0207662_10026171 3300025918 Bacteria 3364
373 Ga0207662_10090519 3300025918 Bacteria 1881
374 Ga0207662_10144691 3300025918 Bacteria 1508
375 Ga0207662_10158149 3300025918 Bacteria 1446
376 Ga0207649_10013216 3300025920 Bacteria 4607
377 Ga0207646_11312930 3300025922 Bacteria 631
378 Ga0207681_10010515 3300025923 Bacteria 5668
379 Ga0207681_10015267 3300025923 Bacteria 4788
380 Ga0207681_10056309 3300025923 Bacteria 2681
381 Ga0207681_10062868 3300025923 Bacteria 2558
382 Ga0207681_10146646 3300025923 Bacteria 1764
383 Ga0207681_10246435 3300025923 Bacteria 1393
384 Ga0207681_10294491 3300025923 Bacteria 1282
385 Ga0207681_10388804 3300025923 Bacteria 1124
386 Ga0207681_10509707 3300025923 Bacteria 986
387 Ga0207650_10013100 3300025925 Bacteria 5736
388 Ga0207650_10025991 3300025925 Bacteria 4173
389 Ga0207650_10042734 3300025925 Bacteria 3325
390 Ga0207659_10000692 3300025926 Bacteria 20033
391 Ga0207659_10002253 3300025926 Bacteria 11480
392 Ga0207659_10002334 3300025926 Bacteria 11293
393 Ga0207659_10005341 3300025926 Bacteria 7783
394 Ga0207659_10005376 3300025926 Bacteria 7758
395 Ga0207659_10009720 3300025926 Bacteria 6015
396 Ga0207659_10059269 3300025926 Bacteria 2751
397 Ga0207659_10614617 3300025926 Bacteria 927
398 Ga0207687_10524784 3300025927 Bacteria 991
399 Ga0207644_10023860 3300025931 Bacteria 4195
400 Ga0207644_10041012 3300025931 Bacteria 3273
401 Ga0207690_10929727 3300025932 Unclassified 722
402 Ga0207706_10020983 3300025933 Bacteria 5867
403 Ga0207706_10067256 3300025933 Bacteria 3152
404 Ga0207706_11007238 3300025933 Bacteria 700
405 Ga0207686_10008848 3300025934 Bacteria 5445
406 Ga0207709_10000279 3300025935 Bacteria 58969
407 Ga0207709_10107108 3300025935 Bacteria 1861
408 Ga0207709_11219072 3300025935 Unclassified 620
409 Ga0207670_10020894 3300025936 Bacteria 4030
410 Ga0207670_10102115 3300025936 Bacteria 2050
411 Ga0207670_10123319 3300025936 Unclassified 1887
412 Ga0207670_10402231 3300025936 Bacteria 1095
413 Ga0207669_10006212 3300025937 Bacteria 5439
414 Ga0207669_10023277 3300025937 Bacteria 3306
415 Ga0207669_10026241 3300025937 Bacteria 3165
416 Ga0207669_10703087 3300025937 Bacteria 831
417 Ga0207669_10937624 3300025937 Bacteria 725
418 Ga0207669_10941425 3300025937 Bacteria 723
419 Ga0207704_10033092 3300025938 Bacteria 2936
420 Ga0207691_10011647 3300025940 Bacteria 8443
421 Ga0207691_10013433 3300025940 Bacteria 7839
422 Ga0207691_10014601 3300025940 Bacteria 7486
423 Ga0207691_10024570 3300025940 Bacteria 5667
424 Ga0207691_10042244 3300025940 Bacteria 4204
425 Ga0207691_10128406 3300025940 Bacteria 2241
426 Ga0207691_10384175 3300025940 Bacteria 1198
427 Ga0207711_10524783 3300025941 Bacteria 1104
428 Ga0207689_10000730 3300025942 Bacteria 31588
429 Ga0207689_10001141 3300025942 Bacteria 25628
430 Ga0207689_10429191 3300025942 Unclassified 1103
431 Ga0207679_10060645 3300025945 Bacteria 2812
432 Ga0207679_10135080 3300025945 Unclassified 1985
433 Ga0207679_10201060 3300025945 Unclassified 1664
434 Ga0207679_10204814 3300025945 Bacteria 1650
435 Ga0207679_10445404 3300025945 Unclassified 1148
436 Ga0207651_10010034 3300025960 Bacteria 5224
437 Ga0207651_10019391 3300025960 Bacteria 4074
438 Ga0207651_10143677 3300025960 Bacteria 1847
439 Ga0207651_10155988 3300025960 Bacteria 1783
440 Ga0207651_10279215 3300025960 Bacteria 1379
441 Ga0207651_10296033 3300025960 Bacteria 1344
442 Ga0207651_10500287 3300025960 Unclassified 1050
443 Ga0207651_10737438 3300025960 Bacteria 870
444 Ga0207712_11172752 3300025961 Unclassified 685
445 Ga0207712_11298353 3300025961 Bacteria 650
446 Ga0207668_10071060 3300025972 Bacteria 2485
447 Ga0207668_10075524 3300025972 Bacteria 2423
448 Ga0207668_10273445 3300025972 Bacteria 1382
449 Ga0207668_11065095 3300025972 Bacteria 724
450 Ga0207658_10009526 3300025986 Bacteria 6594
451 Ga0207658_10137717 3300025986 Bacteria 1971
452 Ga0207677_10127989 3300026023 Bacteria 1922
453 Ga0207677_10254377 3300026023 Bacteria 1428
454 Ga0207677_10430273 3300026023 Bacteria 1126
455 Ga0207703_10130310 3300026035 Bacteria 2171
456 Ga0207703_10898755 3300026035 Unclassified 848
457 Ga0207678_10062622 3300026067 Bacteria 3197
458 Ga0207708_10004080 3300026075 Bacteria 10735
459 Ga0207708_10028056 3300026075 Bacteria 4263
460 Ga0207708_10102407 3300026075 Bacteria 2217
461 Ga0207708_10193451 3300026075 Bacteria 1620
462 Ga0207708_10325607 3300026075 Bacteria 1255
463 Ga0207641_10007106 3300026088 Bacteria 9351
464 Ga0207641_10437609 3300026088 Bacteria 1262
465 Ga0207641_11311625 3300026088 Bacteria 724
466 Ga0207648_10004031 3300026089 Bacteria 15246
467 Ga0207648_10017303 3300026089 Bacteria 6566
468 Ga0207648_10065561 3300026089 Bacteria 3166
469 Ga0207648_10239740 3300026089 Bacteria 1614
470 Ga0207676_10014347 3300026095 Bacteria 5699
471 Ga0207676_10052910 3300026095 Bacteria 3176
472 Ga0207676_10074447 3300026095 Bacteria 2736
473 Ga0207676_10118025 3300026095 Bacteria 2232
474 Ga0207674_10190798 3300026116 Bacteria 1999
475 Ga0207674_10260550 3300026116 Bacteria 1681
476 Ga0207674_10384615 3300026116 Unclassified 1357
477 Ga0207675_100011628 3300026118 Bacteria 8229
478 Ga0207675_100019821 3300026118 Bacteria 6277
479 Ga0207675_100063425 3300026118 Bacteria 3452
480 Ga0207675_100065951 3300026118 Bacteria 3383
481 Ga0207675_100230078 3300026118 Bacteria 1788
482 Ga0207683_10001698 3300026121 Bacteria 19704
483 Ga0207683_10045500 3300026121 Bacteria 3838
484 Ga0207683_10065930 3300026121 Bacteria 3192
485 Ga0207683_10344897 3300026121 Bacteria 1366
486 Ga0207683_10590181 3300026121 Unclassified 1028
487 Ga0207698_10067048 3300026142 Bacteria 2829
488 Ga0209281_1000121 3300027111 Bacteria 205883
489 Ga0209281_1000220 3300027111 Bacteria 122558
490 Ga0209371_1000046 3300027312 Bacteria 306549
491 Ga0209995_1043435 3300027471 Bacteria 760
492 Ga0209983_1021183 3300027665 Bacteria 1358
493 Ga0209974_10034958 3300027876 Unclassified 1668
494 Ga0207428_10000345 3300027907 Bacteria 60424
495 Ga0207428_10000936 3300027907 Bacteria 32455
496 Ga0207428_10001419 3300027907 Bacteria 25210
497 Ga0207428_10021344 3300027907 Bacteria 5484
498 Ga0207428_10198661 3300027907 Bacteria 1509
499 Ga0207428_10208783 3300027907 Unclassified 1468
500 Ga0207428_10445993 3300027907 Bacteria 944
501 Ga0207428_10825286 3300027907 Unclassified 658
502 Ga0268266_10000179 3300028379 Bacteria 112622
503 Ga0268266_10128409 3300028379 Bacteria 2265
504 Ga0268265_10020045 3300028380 Bacteria 4660
505 Ga0268265_10370622 3300028380 Bacteria 1314
506 Ga0268265_10390580 3300028380 Bacteria 1283
507 Ga0268265_10405794 3300028380 Unclassified 1261
508 Ga0268265_10636131 3300028380 Unclassified 1024
509 Ga0268265_11168192 3300028380 Bacteria 766
510 Ga0268264_10034170 3300028381 Bacteria 4181
511 Ga0268264_10086550 3300028381 Bacteria 2692
512 Ga0268264_11251891 3300028381 Unclassified 752
513 Ga0268264_11504774 3300028381 Unclassified 684
514 Ga0268256_1000012 3300030500 Bacteria 794553
515 Ga0265316_10005214 3300031344 Bacteria 12709
516 Ga0307408_100043399 3300031548 Bacteria 3199
517 Ga0316576_10522118 3300031727 Bacteria 872
518 Ga0307405_10007377 3300031731 Bacteria 5493
519 Ga0307405_10062237 3300031731 Bacteria 2362
520 Ga0307413_10000281 3300031824 Bacteria 15624
521 Ga0307413_10003677 3300031824 Bacteria 6515
522 Ga0307410_10001116 3300031852 Bacteria 11737
523 Ga0307410_10037158 3300031852 Bacteria 3178
524 Ga0307410_10602543 3300031852 Unclassified 916
525 Ga0307406_10025196 3300031901 Bacteria 3559
526 Ga0307407_10000476 3300031903 Bacteria 12313
527 Ga0307407_10003129 3300031903 Bacteria 6698
528 Ga0307412_11372604 3300031911 Bacteria 638
529 Ga0307412_12024752 3300031911 Bacteria 533
530 Ga0307409_100034031 3300031995 Bacteria 3716
531 Ga0307409_100533910 3300031995 Bacteria 1148
532 Ga0307409_102521853 3300031995 Unclassified 543
533 Ga0307416_100005491 3300032002 Bacteria 7790
534 Ga0307416_100515664 3300032002 Unclassified 1263
535 Ga0307414_10005544 3300032004 Bacteria 6960
536 Ga0307414_10274610 3300032004 Bacteria 1413
537 Ga0307414_10438564 3300032004 Unclassified 1143
538 Ga0307414_11478359 3300032004 Bacteria 632
539 Ga0307411_10004778 3300032005 Bacteria 6559
540 Ga0307411_10038452 3300032005 Bacteria 3018
541 Ga0307411_10058683 3300032005 Bacteria 2548
542 Ga0307411_10082164 3300032005 Bacteria 2221
543 Ga0307411_11240261 3300032005 Bacteria 677
544 Ga0307415_100053252 3300032126 Bacteria 2756
545 Ga0307415_100230738 3300032126 Bacteria 1490
546 Ga0316583_10016559 3300032133 Bacteria 2653
547 Ga0373958_0000446 3300034819 Bacteria 5048
548 Ga0373959_0081535 3300034820 Bacteria 746
549 Ga0373940_0021496 3300035088 Bacteria 1649
550 Ga0373941_0063958 3300035115 Bacteria 1204
551 Ga0316574_0154085 3300035398 Bacteria 1481
552 Ga0436365_0951881 3300039437 Unclassified 1591
553 Ga0436365_1565946 3300039437 Bacteria 4038
554 Ga0439450_047153 3300042008 Bacteria 1015
555 Ga0439452_000127 3300042010 Bacteria 58547
556 Ga0450923_100480 3300042125 Bacteria 667
557 Ga0450890_011237 3300042127 Bacteria 1155
558 Ga0439446_0124927 3300042156 Bacteria 831
559 Ga0439435_0016335 3300042436 Unclassified 1860
560 Ga0439444_0034805 3300042437 Bacteria 963
561 Ga0439464_0000268 3300042439 Bacteria 9702
562 Ga0439464_0035573 3300042439 Bacteria 1407
563 Ga0450918_034876 3300042531 Bacteria 894
564 Ga0439440_0133066 3300042993 Bacteria 701
565 Ga0466963_0026723 3300044694 Bacteria 3693
566 Ga0466964_0093290 3300044706 Bacteria 1314
567 Ga0466957_0095199 3300044842 Bacteria 1870
568 Ga0451576_0039560 3300045051 Bacteria 4991
569 Ga0466967_0484594 3300045976 Bacteria 1212
570 Ga0495650_0012587 3300046471 Bacteria 4541
571 Ga0495580_0702650 3300046472 Bacteria 662
572 Ga0495598_0010801 3300046537 Bacteria 2197
573 Ga0495621_0164547 3300046539 Bacteria 879
574 Ga0495658_0872520 3300046683 Unclassified 575
575 Ga0495671_0035129 3300046692 Bacteria 2547
576 Ga0495679_031093 3300047446 Bacteria 1725
577 Ga0496104_0056842 3300048907 Bacteria 3702
578 Ga0496105_0183214 3300048908 Bacteria 1714
579 Ga0496108_0267844 3300048911 Bacteria 1487
580 Ga0496109_0119298 3300048912 Bacteria 2456
581 Ga0496110_0474136 3300048913 Bacteria 1140
582 Ga0496112_0725412 3300048915 Unclassified 921
583 Ga0496113_0155747 3300048916 Bacteria 1804
584 Ga0496116_0000854 3300048919 Bacteria 38099
585 Ga0496116_0286995 3300048919 Bacteria 793
586 Ga0496116_0421600 3300048919 Bacteria 582
587 Ga0496117_0014636 3300048920 Bacteria 6746
588 Ga0496117_0019737 3300048920 Bacteria 5523
589 Ga0496117_0091762 3300048920 Bacteria 1952
590 Ga0496117_0092891 3300048920 Bacteria 1937
591 Ga0496118_0014184 3300048921 Bacteria 7473
592 Ga0496118_0027919 3300048921 Bacteria 4766
593 Ga0496119_0001986 3300048922 Bacteria 23211
594 Ga0496119_0003423 3300048922 Bacteria 16479
595 Ga0496119_0004874 3300048922 Bacteria 13139
596 Ga0496119_0039265 3300048922 Bacteria 3043
597 Ga0496120_0001616 3300048923 Bacteria 26133
598 Ga0496120_0001967 3300048923 Bacteria 22449
599 Ga0496120_0010047 3300048923 Bacteria 6644
600 Ga0496120_0030080 3300048923 Bacteria 3306
601 Ga0496121_0055686 3300048924 Bacteria 3292
602 Ga0496121_0333953 3300048924 Bacteria 1015
603 Ga0496122_0000726 3300048925 Bacteria 64443
604 Ga0496122_0014742 3300048925 Bacteria 7536
605 Ga0496122_0064596 3300048925 Bacteria 2661
606 Ga0496122_0380652 3300048925 Bacteria 724
607 Ga0496123_0000371 3300048926 Bacteria 84281
608 Ga0496123_0018262 3300048926 Bacteria 5585
609 Ga0496123_0078233 3300048926 Bacteria 2027
610 Ga0496124_0132695 3300048927 Bacteria 1976
611 Ga0496124_0173426 3300048927 Bacteria 1667
612 Ga0496124_0335135 3300048927 Bacteria 1077
613 Ga0496125_0002592 3300048928 Bacteria 23222
614 Ga0496125_0035821 3300048928 Bacteria 4345
615 Ga0496126_0002346 3300048929 Bacteria 25880
616 Ga0496126_0023911 3300048929 Bacteria 5908
617 Ga0496126_0069617 3300048929 Bacteria 3138
618 Ga0496126_0282821 3300048929 Bacteria 1373
619 Ga0496126_0466698 3300048929 Bacteria 1014
620 Ga0496126_0475067 3300048929 Bacteria 1002
621 Ga0501031_0433610 3300049568 Bacteria 849
622 Ga0501032_0336641 3300049569 Bacteria 973
623 Ga0501038_0082234 3300049574 Bacteria 2712
624 Ga0501040_0054284 3300049576 Bacteria 2747
625 Ga0501041_0241320 3300049577 Unclassified 1136
626 Ga0501041_0612176 3300049577 Bacteria 695
627 Ga0501042_0036839 3300049578 Bacteria 3471
628 Ga0501043_0304440 3300049579 Bacteria 1217
629 Ga0501046_0039552 3300049580 Bacteria 3776
630 Ga0501048_0067007 3300049582 Bacteria 2538
631 Ga0501071_0132168 3300049587 Bacteria 1855
632 Ga0501072_0089143 3300049588 Bacteria 2448
633 Ga0501074_0103590 3300049590 Bacteria 2037
634 Ga0501074_1309443 3300049590 Bacteria 508
635 Ga0501075_0009791 3300049591 Bacteria 6717
636 Ga0501075_0242918 3300049591 Bacteria 1373
637 Ga0501075_0378828 3300049591 Bacteria 1079
638 Ga0501075_0922201 3300049591 Bacteria 664
639 Ga0501076_0058919 3300049592 Bacteria 3054
640 Ga0501076_0797822 3300049592 Bacteria 779
641 Ga0501077_0015193 3300049593 Bacteria 4843
642 Ga0501077_0472641 3300049593 Bacteria 803
643 Ga0501202_009257 3300049652 Unclassified 1808
644 Ga0501209_183744 3300049656 Bacteria 639
645 Ga0501230_029022 3300049667 Bacteria 1020
646 Ga0501246_048480 3300049676 Unclassified 526
647 Ga0501247_034864 3300049677 Bacteria 701
648 Ga0501258_022530 3300049687 Unclassified 750
649 Ga0501079_1475745 3300049741 Unclassified 535
650 Ga0501081_0001556 3300049743 Bacteria 14107
651 Ga0501283_135030 3300049779 Unclassified 503
652 Ga0501035_0180313 3300049822 Bacteria 1820
653 nmdc:mga05p37_102700_c1 3300050507 Bacteria 3520
654 nmdc:mga05p37_12086_c1 3300050507 Bacteria 10305
655 nmdc:mga05p37_1218360_c1 3300050507 Unclassified 776
656 nmdc:mga05p37_248276_c1 3300050507 Bacteria 2136
657 nmdc:mga05p37_253725_c1 3300050507 Bacteria 2108
658 nmdc:mga05p37_406774_c1 3300050507 Bacteria 1588
659 nmdc:mga05p37_49819_c1 3300050507 Bacteria 5151
660 nmdc:mga05p37_65850_c1 3300050507 Bacteria 4457
661 nmdc:mga09592_104658_c1 3300050508 Bacteria 2425
662 nmdc:mga09592_126849_c1 3300050508 Unclassified 2194
663 nmdc:mga09592_269428_c1 3300050508 Bacteria 1477
664 nmdc:mga09592_2939_c1 3300050508 Bacteria 13808
665 nmdc:mga09592_3519_c1 3300050508 Bacteria 12655
666 nmdc:mga09592_435821_c1 3300050508 Unclassified 1131
667 nmdc:mga09592_491204_c1 3300050508 Bacteria 1057
668 nmdc:mga09592_55672_c1 3300050508 Bacteria 3342
669 nmdc:mga09592_67022_c1 3300050508 Bacteria 3044
670 nmdc:mga0qj67_258809_c1 3300050509 Bacteria 1412
671 nmdc:mga0qj67_293166_c1 3300050509 Bacteria 1318
672 nmdc:mga0qj67_33112_c1 3300050509 Bacteria 4032
673 nmdc:mga0qj67_3596_c1 3300050509 Bacteria 11187
674 nmdc:mga0qj67_43434_c1 3300050509 Bacteria 3540
675 nmdc:mga0qj67_67785_c1 3300050509 Unclassified 2843
676 nmdc:mga06r32_1265990_c1 3300050510 Bacteria 682
677 nmdc:mga06r32_180607_c1 3300050510 Bacteria 2096
678 nmdc:mga06r32_23370_c1 3300050510 Bacteria 5718
679 nmdc:mga06r32_596059_c1 3300050510 Bacteria 1076
680 nmdc:mga06r32_88268_c1 3300050510 Archaea 3027
681 nmdc:mga06r32_98953_c2 3300050510 Bacteria 1483
682 nmdc:mga08y16_1091333_c1 3300050511 Bacteria 774
683 nmdc:mga08y16_1706_c1 3300050511 Bacteria 22281
684 nmdc:mga08y16_22565_c1 3300050511 Bacteria 6646
685 nmdc:mga08y16_325461_c1 3300050511 Bacteria 1582
686 nmdc:mga08y16_3381_c1 3300050511 Bacteria 16532
687 nmdc:mga08y16_365845_c1 3300050511 Bacteria 1480
688 nmdc:mga08y16_381231_c1 3300050511 Unclassified 1095
689 nmdc:mga08y16_655_c1 3300050511 Bacteria 32531
690 nmdc:mga08y16_73712_c1 3300050511 Unclassified 3557
691 nmdc:mga0n895_21708_c1 3300050512 Bacteria 6008
692 nmdc:mga0n895_6535_c1 3300050512 Bacteria 9921
693 nmdc:mga0rr50_1036980_c1 3300050513 Bacteria 698
694 nmdc:mga0rr50_28569_c1 3300050513 Bacteria 3922
695 nmdc:mga0a205_1056_c1 3300050515 Bacteria 22922
696 nmdc:mga0a205_3281_c1 3300050515 Bacteria 14393
697 nmdc:mga0a205_577_c1 3300050515 Bacteria 29054
698 nmdc:mga0a205_60114_c1 3300050515 Bacteria 3670
699 Ga0495619_0552465 3300053085 Unclassified 790
700 Ga0501084_0051977 3300054114 Bacteria 3429
701 Ga0501084_1243032 3300054114 Bacteria 625
702 Ga0530510_0668847 3300061734 Bacteria 791

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044706 Ga0466964_0093290 Ga0466964_0093290_386_856 134
2 3300045976 Ga0466967_0484594 Ga0466967_0484594_423_893 134
3 3300031727 Ga0316576_10522118 Ga0316576_105221181 138
4 3300035398 Ga0316574_0154085 Ga0316574_0154085_688_1143 138
5 3300032005 Ga0307411_11240261 Ga0307411_112402611 139
6 3300032004 Ga0307414_10438564 Ga0307414_104385642 140
7 3300005295 Ga0065707_10262348 Ga0065707_102623482 141
8 3300009094 Ga0111539_13426845 Ga0111539_134268451 141
9 3300044694 Ga0466963_0026723 Ga0466963_0026723_599_1063 142
10 3300044842 Ga0466957_0095199 Ga0466957_0095199_1058_1522 142
11 3300009545 Ga0105237_11289279 Ga0105237_112892792 143
12 iso_pu_bacteria 8055092621 8055094725 143
13 3300001977 JGI24746J21847_1004962 JGI24746J21847_10049622 145
14 3300002070 JGI24750J21931_1031514 JGI24750J21931_10315141 145
15 3300002074 JGI24748J21848_1024759 JGI24748J21848_10247591 145
16 3300005288 Ga0065714_10153851 Ga0065714_101538512 145
17 3300005290 Ga0065712_10006027 Ga0065712_100060273 145
18 3300005290 Ga0065712_10083231 Ga0065712_100832312 145
19 3300005290 Ga0065712_10139486 Ga0065712_101394862 145
20 3300005293 Ga0065715_10003216 Ga0065715_100032163 145
21 3300005293 Ga0065715_10091582 Ga0065715_100915824 145
22 3300005293 Ga0065715_10357900 Ga0065715_103579001 145
23 3300005295 Ga0065707_10587687 Ga0065707_105876872 145
24 3300005328 Ga0070676_10001803 Ga0070676_100018034 145
25 3300005328 Ga0070676_10011233 Ga0070676_100112331 145
26 3300005328 Ga0070676_10029452 Ga0070676_100294523 145
27 3300005329 Ga0070683_100153201 Ga0070683_1001532012 145
28 3300005329 Ga0070683_100460795 Ga0070683_1004607952 145
29 3300005330 Ga0070690_100013980 Ga0070690_1000139804 145
30 3300005330 Ga0070690_100015578 Ga0070690_1000155781 145
31 3300005330 Ga0070690_100307723 Ga0070690_1003077232 145
32 3300005331 Ga0070670_100018731 Ga0070670_1000187317 145
33 3300005331 Ga0070670_100021290 Ga0070670_1000212903 145
34 3300005331 Ga0070670_100118295 Ga0070670_1001182952 145
35 3300005331 Ga0070670_100763984 Ga0070670_1007639842 145
36 3300005333 Ga0070677_10016661 Ga0070677_100166613 145
37 3300005333 Ga0070677_10019971 Ga0070677_100199712 145
38 3300005333 Ga0070677_10070904 Ga0070677_100709042 145
39 3300005333 Ga0070677_10447767 Ga0070677_104477671 145
40 3300005333 Ga0070677_10456214 Ga0070677_104562141 145
41 3300005334 Ga0068869_100001451 Ga0068869_10000145115 145
42 3300005334 Ga0068869_100074093 Ga0068869_1000740933 145
43 3300005335 Ga0070666_10038935 Ga0070666_100389352 145
44 3300005335 Ga0070666_10602350 Ga0070666_106023502 145
45 3300005335 Ga0070666_10777080 Ga0070666_107770802 145
46 3300005335 Ga0070666_11074445 Ga0070666_110744452 145
47 3300005338 Ga0068868_100100155 Ga0068868_1001001552 145
48 3300005338 Ga0068868_100139496 Ga0068868_1001394962 145
49 3300005340 Ga0070689_100065087 Ga0070689_1000650873 145
50 3300005340 Ga0070689_100077049 Ga0070689_1000770492 145
51 3300005340 Ga0070689_100107321 Ga0070689_1001073213 145
52 3300005340 Ga0070689_101234337 Ga0070689_1012343372 145
53 3300005341 Ga0070691_10096726 Ga0070691_100967263 145
54 3300005343 Ga0070687_100022049 Ga0070687_1000220492 145
55 3300005343 Ga0070687_100135038 Ga0070687_1001350382 145
56 3300005344 Ga0070661_100028138 Ga0070661_1000281384 145
57 3300005344 Ga0070661_100038268 Ga0070661_1000382684 145
58 3300005344 Ga0070661_100269055 Ga0070661_1002690552 145
59 3300005345 Ga0070692_10047812 Ga0070692_100478123 145
60 3300005347 Ga0070668_100007025 Ga0070668_1000070253 145
61 3300005347 Ga0070668_100149585 Ga0070668_1001495852 145
62 3300005347 Ga0070668_100538501 Ga0070668_1005385011 145
63 3300005353 Ga0070669_100017527 Ga0070669_1000175276 145
64 3300005353 Ga0070669_100019575 Ga0070669_1000195754 145
65 3300005353 Ga0070669_100031277 Ga0070669_1000312773 145
66 3300005353 Ga0070669_100079044 Ga0070669_1000790441 145
67 3300005353 Ga0070669_100162736 Ga0070669_1001627362 145
68 3300005353 Ga0070669_100181322 Ga0070669_1001813222 145
69 3300005353 Ga0070669_100230981 Ga0070669_1002309812 145
70 3300005353 Ga0070669_100612755 Ga0070669_1006127551 145
71 3300005354 Ga0070675_100001179 Ga0070675_10000117915 145
72 3300005354 Ga0070675_100001525 Ga0070675_10000152518 145
73 3300005354 Ga0070675_100001605 Ga0070675_10000160519 145
74 3300005354 Ga0070675_100002993 Ga0070675_1000029934 145
75 3300005354 Ga0070675_100006002 Ga0070675_1000060024 145
76 3300005354 Ga0070675_100041401 Ga0070675_1000414012 145
77 3300005354 Ga0070675_100084418 Ga0070675_1000844184 145
78 3300005354 Ga0070675_100093838 Ga0070675_1000938382 145
79 3300005354 Ga0070675_100537906 Ga0070675_1005379061 145
80 3300005354 Ga0070675_100556280 Ga0070675_1005562801 145
81 3300005354 Ga0070675_101164549 Ga0070675_1011645492 145
82 3300005355 Ga0070671_100014421 Ga0070671_1000144215 145
83 3300005355 Ga0070671_100027688 Ga0070671_1000276883 145
84 3300005355 Ga0070671_100838867 Ga0070671_1008388672 145
85 3300005356 Ga0070674_100023270 Ga0070674_1000232704 145
86 3300005356 Ga0070674_100203049 Ga0070674_1002030492 145
87 3300005356 Ga0070674_100458571 Ga0070674_1004585712 145
88 3300005356 Ga0070674_100671268 Ga0070674_1006712682 145
89 3300005364 Ga0070673_100005331 Ga0070673_1000053317 145
90 3300005364 Ga0070673_100005380 Ga0070673_1000053806 145
91 3300005364 Ga0070673_100041029 Ga0070673_1000410292 145
92 3300005364 Ga0070673_100058601 Ga0070673_1000586012 145
93 3300005364 Ga0070673_100061220 Ga0070673_1000612203 145
94 3300005364 Ga0070673_100107103 Ga0070673_1001071032 145
95 3300005364 Ga0070673_100269605 Ga0070673_1002696052 145
96 3300005364 Ga0070673_100542719 Ga0070673_1005427192 145
97 3300005364 Ga0070673_100770985 Ga0070673_1007709851 145
98 3300005365 Ga0070688_100015922 Ga0070688_1000159224 145
99 3300005365 Ga0070688_100078062 Ga0070688_1000780623 145
100 3300005365 Ga0070688_100143865 Ga0070688_1001438652 145
101 3300005366 Ga0070659_100056589 Ga0070659_1000565892 145
102 3300005366 Ga0070659_100160483 Ga0070659_1001604832 145
103 3300005367 Ga0070667_100008511 Ga0070667_1000085117 145
104 3300005367 Ga0070667_100145274 Ga0070667_1001452742 145
105 3300005406 Ga0070703_10136695 Ga0070703_101366951 145
106 3300005438 Ga0070701_10053071 Ga0070701_100530713 145
107 3300005438 Ga0070701_10213041 Ga0070701_102130412 145
108 3300005438 Ga0070701_10322737 Ga0070701_103227371 145
109 3300005441 Ga0070700_100006546 Ga0070700_1000065465 145
110 3300005441 Ga0070700_100040351 Ga0070700_1000403515 145
111 3300005441 Ga0070700_100192320 Ga0070700_1001923202 145
112 3300005444 Ga0070694_100198467 Ga0070694_1001984672 145
113 3300005444 Ga0070694_101285768 Ga0070694_1012857681 145
114 3300005455 Ga0070663_100067841 Ga0070663_1000678412 145
115 3300005455 Ga0070663_100359417 Ga0070663_1003594171 145
116 3300005456 Ga0070678_100002418 Ga0070678_1000024188 145
117 3300005456 Ga0070678_100116757 Ga0070678_1001167572 145
118 3300005456 Ga0070678_100120593 Ga0070678_1001205932 145
119 3300005456 Ga0070678_100431331 Ga0070678_1004313312 145
120 3300005457 Ga0070662_100171368 Ga0070662_1001713682 145
121 3300005457 Ga0070662_100290512 Ga0070662_1002905122 145
122 3300005459 Ga0068867_100005657 Ga0068867_1000056576 145
123 3300005459 Ga0068867_100049711 Ga0068867_1000497112 145
124 3300005459 Ga0068867_100089462 Ga0068867_1000894622 145
125 3300005466 Ga0070685_10003652 Ga0070685_100036522 145
126 3300005467 Ga0070706_101132316 Ga0070706_1011323161 145
127 3300005468 Ga0070707_101712296 Ga0070707_1017122961 145
128 3300005471 Ga0070698_100493644 Ga0070698_1004936442 145
129 3300005518 Ga0070699_100010424 Ga0070699_1000104246 145
130 3300005518 Ga0070699_100384682 Ga0070699_1003846822 145
131 3300005518 Ga0070699_100405400 Ga0070699_1004054002 145
132 3300005530 Ga0070679_100624897 Ga0070679_1006248971 145
133 3300005536 Ga0070697_100070893 Ga0070697_1000708932 145
134 3300005536 Ga0070697_100789195 Ga0070697_1007891951 145
135 3300005543 Ga0070672_100043126 Ga0070672_1000431264 145
136 3300005543 Ga0070672_100048076 Ga0070672_1000480763 145
137 3300005543 Ga0070672_100083932 Ga0070672_1000839323 145
138 3300005543 Ga0070672_100088957 Ga0070672_1000889574 145
139 3300005543 Ga0070672_100147289 Ga0070672_1001472892 145
140 3300005543 Ga0070672_100432042 Ga0070672_1004320422 145
141 3300005543 Ga0070672_100822524 Ga0070672_1008225242 145
142 3300005544 Ga0070686_100002140 Ga0070686_1000021407 145
143 3300005544 Ga0070686_100102268 Ga0070686_1001022682 145
144 3300005545 Ga0070695_100404924 Ga0070695_1004049241 145
145 3300005546 Ga0070696_100619570 Ga0070696_1006195702 145
146 3300005549 Ga0070704_100102018 Ga0070704_1001020182 145
147 3300005549 Ga0070704_100469227 Ga0070704_1004692272 145
148 3300005564 Ga0070664_100008661 Ga0070664_1000086619 145
149 3300005564 Ga0070664_100011840 Ga0070664_1000118405 145
150 3300005564 Ga0070664_100018755 Ga0070664_1000187552 145
151 3300005564 Ga0070664_100023467 Ga0070664_1000234673 145
152 3300005564 Ga0070664_100646018 Ga0070664_1006460182 145
153 3300005577 Ga0068857_100137571 Ga0068857_1001375712 145
154 3300005578 Ga0068854_100240643 Ga0068854_1002406432 145
155 3300005615 Ga0070702_100091704 Ga0070702_1000917042 145
156 3300005615 Ga0070702_100268119 Ga0070702_1002681192 145
157 3300005616 Ga0068852_100470248 Ga0068852_1004702482 145
158 3300005617 Ga0068859_100032983 Ga0068859_1000329832 145
159 3300005617 Ga0068859_100078453 Ga0068859_1000784531 145
160 3300005617 Ga0068859_100079161 Ga0068859_1000791613 145
161 3300005617 Ga0068859_100149357 Ga0068859_1001493573 145
162 3300005617 Ga0068859_100296970 Ga0068859_1002969702 145
163 3300005617 Ga0068859_100695037 Ga0068859_1006950372 145
164 3300005617 Ga0068859_101946027 Ga0068859_1019460271 145
165 3300005618 Ga0068864_100034893 Ga0068864_1000348933 145
166 3300005618 Ga0068864_100113074 Ga0068864_1001130742 145
167 3300005618 Ga0068864_100149930 Ga0068864_1001499302 145
168 3300005618 Ga0068864_100179373 Ga0068864_1001793732 145
169 3300005618 Ga0068864_100577556 Ga0068864_1005775561 145
170 3300005718 Ga0068866_10016871 Ga0068866_100168713 145
171 3300005718 Ga0068866_10020245 Ga0068866_100202452 145
172 3300005718 Ga0068866_10088854 Ga0068866_100888541 145
173 3300005719 Ga0068861_100001769 Ga0068861_1000017696 145
174 3300005719 Ga0068861_100035452 Ga0068861_1000354522 145
175 3300005719 Ga0068861_100114692 Ga0068861_1001146922 145
176 3300005719 Ga0068861_100167128 Ga0068861_1001671281 145
177 3300005719 Ga0068861_100339224 Ga0068861_1003392241 145
178 3300005719 Ga0068861_100795250 Ga0068861_1007952502 145
179 3300005840 Ga0068870_10000294 Ga0068870_100002944 145
180 3300005840 Ga0068870_10014325 Ga0068870_100143253 145
181 3300005840 Ga0068870_10286436 Ga0068870_102864361 145
182 3300005841 Ga0068863_100012272 Ga0068863_1000122723 145
183 3300005841 Ga0068863_100457180 Ga0068863_1004571802 145
184 3300005842 Ga0068858_100025311 Ga0068858_1000253114 145
185 3300005842 Ga0068858_101183928 Ga0068858_1011839282 145
186 3300005843 Ga0068860_100010293 Ga0068860_1000102937 145
187 3300005843 Ga0068860_102075576 Ga0068860_1020755761 145
188 3300005844 Ga0068862_100004508 Ga0068862_10000450810 145
189 3300005844 Ga0068862_100428228 Ga0068862_1004282282 145
190 3300005844 Ga0068862_100458063 Ga0068862_1004580631 145
191 3300005844 Ga0068862_100504247 Ga0068862_1005042472 145
192 3300005844 Ga0068862_101315279 Ga0068862_1013152792 145
193 3300005844 Ga0068862_101574063 Ga0068862_1015740631 145
194 3300005937 Ga0081455_10018672 Ga0081455_100186727 145
195 3300006058 Ga0075432_10151231 Ga0075432_101512312 145
196 3300006237 Ga0097621_100020236 Ga0097621_1000202362 145
197 3300006237 Ga0097621_102110613 Ga0097621_1021106131 145
198 3300006358 Ga0068871_101066518 Ga0068871_1010665182 145
199 3300006358 Ga0068871_101727700 Ga0068871_1017277001 145
200 3300006844 Ga0075428_100001914 Ga0075428_1000019145 145
201 3300006844 Ga0075428_100003245 Ga0075428_10000324512 145
202 3300006844 Ga0075428_100055045 Ga0075428_1000550454 145
203 3300006844 Ga0075428_100301188 Ga0075428_1003011882 145
204 3300006844 Ga0075428_100375660 Ga0075428_1003756602 145
205 3300006844 Ga0075428_100965784 Ga0075428_1009657842 145
206 3300006846 Ga0075430_100008767 Ga0075430_1000087677 145
207 3300006846 Ga0075430_100017358 Ga0075430_1000173587 145
208 3300006846 Ga0075430_100185512 Ga0075430_1001855123 145
209 3300006847 Ga0075431_100020297 Ga0075431_1000202974 145
210 3300006847 Ga0075431_100050732 Ga0075431_1000507322 145
211 3300006847 Ga0075431_100338840 Ga0075431_1003388402 145
212 3300006852 Ga0075433_10003776 Ga0075433_100037769 145
213 3300006852 Ga0075433_10160450 Ga0075433_101604502 145
214 3300006871 Ga0075434_100004765 Ga0075434_10000476510 145
215 3300006871 Ga0075434_100193277 Ga0075434_1001932772 145
216 3300006871 Ga0075434_100241783 Ga0075434_1002417832 145
217 3300006880 Ga0075429_100014564 Ga0075429_1000145647 145
218 3300006880 Ga0075429_100017259 Ga0075429_1000172598 145
219 3300006880 Ga0075429_100063369 Ga0075429_1000633692 145
220 3300006880 Ga0075429_100082120 Ga0075429_1000821203 145
221 3300006880 Ga0075429_100186601 Ga0075429_1001866012 145
222 3300006881 Ga0068865_100005969 Ga0068865_1000059696 145
223 3300006881 Ga0068865_100013650 Ga0068865_1000136506 145
224 3300006881 Ga0068865_100085681 Ga0068865_1000856812 145
225 3300006931 Ga0097620_100032982 Ga0097620_1000329822 145
226 3300006931 Ga0097620_100078451 Ga0097620_1000784511 145
227 3300006931 Ga0097620_100079160 Ga0097620_1000791603 145
228 3300006931 Ga0097620_100149357 Ga0097620_1001493573 145
229 3300006931 Ga0097620_100296976 Ga0097620_1002969762 145
230 3300006931 Ga0097620_100695033 Ga0097620_1006950332 145
231 3300006931 Ga0097620_101945913 Ga0097620_1019459131 145
232 3300007076 Ga0075435_101224708 Ga0075435_1012247081 145
233 3300009094 Ga0111539_10000065 Ga0111539_1000006576 145
234 3300009094 Ga0111539_10003932 Ga0111539_100039324 145
235 3300009094 Ga0111539_10010451 Ga0111539_100104513 145
236 3300009094 Ga0111539_10029612 Ga0111539_100296122 145
237 3300009094 Ga0111539_10123724 Ga0111539_101237242 145
238 3300009094 Ga0111539_10128168 Ga0111539_101281683 145
239 3300009094 Ga0111539_10132048 Ga0111539_101320482 145
240 3300009094 Ga0111539_10454386 Ga0111539_104543862 145
241 3300009098 Ga0105245_10439202 Ga0105245_104392023 145
242 3300009098 Ga0105245_10530098 Ga0105245_105300982 145
243 3300009101 Ga0105247_10121777 Ga0105247_101217772 145
244 3300009101 Ga0105247_10715924 Ga0105247_107159241 145
245 3300009147 Ga0114129_10007052 Ga0114129_100070525 145
246 3300009147 Ga0114129_10013734 Ga0114129_1001373411 145
247 3300009147 Ga0114129_10069282 Ga0114129_100692826 145
248 3300009147 Ga0114129_10904545 Ga0114129_109045452 145
249 3300009148 Ga0105243_10368431 Ga0105243_103684312 145
250 3300009148 Ga0105243_10528754 Ga0105243_105287542 145
251 3300009176 Ga0105242_10089084 Ga0105242_100890843 145
252 3300009176 Ga0105242_10921389 Ga0105242_109213892 145
253 3300009177 Ga0105248_10132152 Ga0105248_101321523 145
254 3300009177 Ga0105248_10175637 Ga0105248_101756371 145
255 3300009551 Ga0105238_10018652 Ga0105238_100186528 145
256 3300009553 Ga0105249_10001042 Ga0105249_1000104215 145
257 3300009553 Ga0105249_10709088 Ga0105249_107090882 145
258 3300011119 Ga0105246_10066755 Ga0105246_100667553 145
259 3300011119 Ga0105246_10728112 Ga0105246_107281121 145
260 3300012497 Ga0157319_1020816 Ga0157319_10208161 145
261 3300012508 Ga0157315_1007777 Ga0157315_10077772 145
262 3300013296 Ga0157374_10059837 Ga0157374_100598374 145
263 3300013296 Ga0157374_10069372 Ga0157374_100693724 145
264 3300013296 Ga0157374_10888260 Ga0157374_108882602 145
265 3300013297 Ga0157378_10308181 Ga0157378_103081812 145
266 3300013297 Ga0157378_12666120 Ga0157378_126661201 145
267 3300013306 Ga0163162_10003027 Ga0163162_100030278 145
268 3300013306 Ga0163162_10325311 Ga0163162_103253112 145
269 3300013306 Ga0163162_12864463 Ga0163162_128644631 145
270 3300013308 Ga0157375_10025152 Ga0157375_100251527 145
271 3300013308 Ga0157375_10209635 Ga0157375_102096352 145
272 3300013308 Ga0157375_10286120 Ga0157375_102861202 145
273 3300013308 Ga0157375_10924287 Ga0157375_109242872 145
274 3300013308 Ga0157375_10983940 Ga0157375_109839401 145
275 3300013308 Ga0157375_11216360 Ga0157375_112163601 145
276 3300013308 Ga0157375_11736685 Ga0157375_117366852 145
277 3300014325 Ga0163163_10029464 Ga0163163_100294642 145
278 3300014325 Ga0163163_10050630 Ga0163163_100506303 145
279 3300014325 Ga0163163_10377985 Ga0163163_103779852 145
280 3300014326 Ga0157380_10009450 Ga0157380_100094502 145
281 3300014326 Ga0157380_10045860 Ga0157380_100458603 145
282 3300014326 Ga0157380_10069366 Ga0157380_100693663 145
283 3300014326 Ga0157380_10074956 Ga0157380_100749561 145
284 3300014326 Ga0157380_10095697 Ga0157380_100956973 145
285 3300014326 Ga0157380_10110572 Ga0157380_101105723 145
286 3300014326 Ga0157380_10217281 Ga0157380_102172813 145
287 3300014326 Ga0157380_10427951 Ga0157380_104279512 145
288 3300014326 Ga0157380_11038230 Ga0157380_110382302 145
289 3300014326 Ga0157380_11800383 Ga0157380_118003831 145
290 3300014745 Ga0157377_10004519 Ga0157377_100045194 145
291 3300014745 Ga0157377_10044839 Ga0157377_100448394 145
292 3300014745 Ga0157377_10108759 Ga0157377_101087592 145
293 3300014745 Ga0157377_10123198 Ga0157377_101231982 145
294 3300014745 Ga0157377_10223128 Ga0157377_102231282 145
295 3300014968 Ga0157379_10003743 Ga0157379_100037434 145
296 3300014968 Ga0157379_10131137 Ga0157379_101311372 145
297 3300014969 Ga0157376_10705222 Ga0157376_107052222 145
298 3300014969 Ga0157376_11878163 Ga0157376_118781632 145
299 3300017792 Ga0163161_10006354 Ga0163161_100063541 145
300 3300021384 Ga0213876_10383765 Ga0213876_103837651 145
301 3300025290 Ga0207673_1030846 Ga0207673_10308461 145
302 3300025315 Ga0207697_10000085 Ga0207697_1000008517 145
303 3300025315 Ga0207697_10089054 Ga0207697_100890541 145
304 3300025885 Ga0207653_10215231 Ga0207653_102152311 145
305 3300025893 Ga0207682_10005915 Ga0207682_100059154 145
306 3300025893 Ga0207682_10021779 Ga0207682_100217794 145
307 3300025893 Ga0207682_10067630 Ga0207682_100676302 145
308 3300025893 Ga0207682_10174524 Ga0207682_101745242 145
309 3300025899 Ga0207642_10038792 Ga0207642_100387922 145
310 3300025900 Ga0207710_10065406 Ga0207710_100654063 145
311 3300025901 Ga0207688_10000477 Ga0207688_1000047719 145
312 3300025901 Ga0207688_10013379 Ga0207688_100133792 145
313 3300025901 Ga0207688_10129377 Ga0207688_101293771 145
314 3300025901 Ga0207688_10196070 Ga0207688_101960702 145
315 3300025903 Ga0207680_10067608 Ga0207680_100676082 145
316 3300025903 Ga0207680_10294839 Ga0207680_102948392 145
317 3300025903 Ga0207680_10365300 Ga0207680_103653002 145
318 3300025904 Ga0207647_10263199 Ga0207647_102631992 145
319 3300025907 Ga0207645_10003970 Ga0207645_100039709 145
320 3300025907 Ga0207645_10051127 Ga0207645_100511274 145
321 3300025907 Ga0207645_10435744 Ga0207645_104357442 145
322 3300025908 Ga0207643_10000621 Ga0207643_1000062113 145
323 3300025908 Ga0207643_10016413 Ga0207643_100164134 145
324 3300025908 Ga0207643_10062822 Ga0207643_100628224 145
325 3300025908 Ga0207643_10079881 Ga0207643_100798813 145
326 3300025908 Ga0207643_10170537 Ga0207643_101705371 145
327 3300025918 Ga0207662_10026171 Ga0207662_100261713 145
328 3300025918 Ga0207662_10090519 Ga0207662_100905192 145
329 3300025918 Ga0207662_10144691 Ga0207662_101446912 145
330 3300025920 Ga0207649_10013216 Ga0207649_100132164 145
331 3300025922 Ga0207646_11312930 Ga0207646_113129302 145
332 3300025923 Ga0207681_10010515 Ga0207681_100105152 145
333 3300025923 Ga0207681_10015267 Ga0207681_100152672 145
334 3300025923 Ga0207681_10062868 Ga0207681_100628684 145
335 3300025923 Ga0207681_10146646 Ga0207681_101466461 145
336 3300025923 Ga0207681_10294491 Ga0207681_102944912 145
337 3300025923 Ga0207681_10388804 Ga0207681_103888042 145
338 3300025923 Ga0207681_10509707 Ga0207681_105097072 145
339 3300025925 Ga0207650_10013100 Ga0207650_100131003 145
340 3300025925 Ga0207650_10025991 Ga0207650_100259914 145
341 3300025925 Ga0207650_10042734 Ga0207650_100427343 145
342 3300025926 Ga0207659_10000692 Ga0207659_100006926 145
343 3300025926 Ga0207659_10002253 Ga0207659_100022537 145
344 3300025926 Ga0207659_10002334 Ga0207659_1000233411 145
345 3300025926 Ga0207659_10005341 Ga0207659_100053417 145
346 3300025926 Ga0207659_10005376 Ga0207659_100053762 145
347 3300025926 Ga0207659_10009720 Ga0207659_100097204 145
348 3300025926 Ga0207659_10059269 Ga0207659_100592691 145
349 3300025927 Ga0207687_10524784 Ga0207687_105247841 145
350 3300025931 Ga0207644_10023860 Ga0207644_100238603 145
351 3300025931 Ga0207644_10041012 Ga0207644_100410123 145
352 3300025932 Ga0207690_10929727 Ga0207690_109297272 145
353 3300025933 Ga0207706_10020983 Ga0207706_100209836 145
354 3300025933 Ga0207706_10067256 Ga0207706_100672562 145
355 3300025933 Ga0207706_11007238 Ga0207706_110072382 145
356 3300025934 Ga0207686_10008848 Ga0207686_100088482 145
357 3300025935 Ga0207709_10107108 Ga0207709_101071081 145
358 3300025936 Ga0207670_10020894 Ga0207670_100208943 145
359 3300025936 Ga0207670_10102115 Ga0207670_101021152 145
360 3300025936 Ga0207670_10123319 Ga0207670_101233192 145
361 3300025936 Ga0207670_10402231 Ga0207670_104022312 145
362 3300025937 Ga0207669_10006212 Ga0207669_100062123 145
363 3300025937 Ga0207669_10023277 Ga0207669_100232773 145
364 3300025937 Ga0207669_10026241 Ga0207669_100262412 145
365 3300025938 Ga0207704_10033092 Ga0207704_100330925 145
366 3300025940 Ga0207691_10011647 Ga0207691_100116479 145
367 3300025940 Ga0207691_10013433 Ga0207691_100134333 145
368 3300025940 Ga0207691_10014601 Ga0207691_100146016 145
369 3300025940 Ga0207691_10024570 Ga0207691_100245702 145
370 3300025940 Ga0207691_10042244 Ga0207691_100422444 145
371 3300025940 Ga0207691_10128406 Ga0207691_101284062 145
372 3300025940 Ga0207691_10384175 Ga0207691_103841752 145
373 3300025941 Ga0207711_10524783 Ga0207711_105247832 145
374 3300025942 Ga0207689_10000730 Ga0207689_1000073011 145
375 3300025942 Ga0207689_10001141 Ga0207689_100011418 145
376 3300025942 Ga0207689_10429191 Ga0207689_104291911 145
377 3300025945 Ga0207679_10060645 Ga0207679_100606452 145
378 3300025945 Ga0207679_10135080 Ga0207679_101350802 145
379 3300025945 Ga0207679_10201060 Ga0207679_102010602 145
380 3300025945 Ga0207679_10204814 Ga0207679_102048142 145
381 3300025945 Ga0207679_10445404 Ga0207679_104454042 145
382 3300025960 Ga0207651_10010034 Ga0207651_100100343 145
383 3300025960 Ga0207651_10019391 Ga0207651_100193913 145
384 3300025960 Ga0207651_10143677 Ga0207651_101436772 145
385 3300025960 Ga0207651_10155988 Ga0207651_101559882 145
386 3300025960 Ga0207651_10279215 Ga0207651_102792152 145
387 3300025960 Ga0207651_10296033 Ga0207651_102960332 145
388 3300025960 Ga0207651_10500287 Ga0207651_105002872 145
389 3300025960 Ga0207651_10737438 Ga0207651_107374382 145
390 3300025961 Ga0207712_11172752 Ga0207712_111727522 145
391 3300025961 Ga0207712_11298353 Ga0207712_112983531 145
392 3300025972 Ga0207668_10071060 Ga0207668_100710602 145
393 3300025972 Ga0207668_10075524 Ga0207668_100755243 145
394 3300025972 Ga0207668_10273445 Ga0207668_102734452 145
395 3300025972 Ga0207668_11065095 Ga0207668_110650951 145
396 3300025986 Ga0207658_10009526 Ga0207658_100095267 145
397 3300025986 Ga0207658_10137717 Ga0207658_101377172 145
398 3300026023 Ga0207677_10127989 Ga0207677_101279891 145
399 3300026023 Ga0207677_10254377 Ga0207677_102543772 145
400 3300026023 Ga0207677_10430273 Ga0207677_104302732 145
401 3300026035 Ga0207703_10130310 Ga0207703_101303103 145
402 3300026035 Ga0207703_10898755 Ga0207703_108987552 145
403 3300026067 Ga0207678_10062622 Ga0207678_100626223 145
404 3300026075 Ga0207708_10004080 Ga0207708_100040804 145
405 3300026075 Ga0207708_10028056 Ga0207708_100280565 145
406 3300026075 Ga0207708_10102407 Ga0207708_101024074 145
407 3300026075 Ga0207708_10193451 Ga0207708_101934512 145
408 3300026075 Ga0207708_10325607 Ga0207708_103256072 145
409 3300026088 Ga0207641_10007106 Ga0207641_100071062 145
410 3300026088 Ga0207641_10437609 Ga0207641_104376092 145
411 3300026088 Ga0207641_11311625 Ga0207641_113116252 145
412 3300026089 Ga0207648_10004031 Ga0207648_100040316 145
413 3300026089 Ga0207648_10017303 Ga0207648_100173034 145
414 3300026089 Ga0207648_10065561 Ga0207648_100655613 145
415 3300026089 Ga0207648_10239740 Ga0207648_102397402 145
416 3300026095 Ga0207676_10014347 Ga0207676_100143471 145
417 3300026095 Ga0207676_10052910 Ga0207676_100529104 145
418 3300026095 Ga0207676_10074447 Ga0207676_100744472 145
419 3300026095 Ga0207676_10118025 Ga0207676_101180253 145
420 3300026116 Ga0207674_10190798 Ga0207674_101907982 145
421 3300026116 Ga0207674_10260550 Ga0207674_102605502 145
422 3300026116 Ga0207674_10384615 Ga0207674_103846151 145
423 3300026118 Ga0207675_100011628 Ga0207675_1000116286 145
424 3300026118 Ga0207675_100019821 Ga0207675_1000198215 145
425 3300026118 Ga0207675_100063425 Ga0207675_1000634254 145
426 3300026118 Ga0207675_100065951 Ga0207675_1000659512 145
427 3300026118 Ga0207675_100230078 Ga0207675_1002300782 145
428 3300026121 Ga0207683_10001698 Ga0207683_1000169810 145
429 3300026121 Ga0207683_10045500 Ga0207683_100455004 145
430 3300026121 Ga0207683_10065930 Ga0207683_100659303 145
431 3300026121 Ga0207683_10590181 Ga0207683_105901812 145
432 3300026142 Ga0207698_10067048 Ga0207698_100670483 145
433 3300027471 Ga0209995_1043435 Ga0209995_10434352 145
434 3300027665 Ga0209983_1021183 Ga0209983_10211831 145
435 3300027876 Ga0209974_10034958 Ga0209974_100349582 145
436 3300027907 Ga0207428_10000345 Ga0207428_1000034513 145
437 3300027907 Ga0207428_10000936 Ga0207428_1000093623 145
438 3300027907 Ga0207428_10021344 Ga0207428_100213447 145
439 3300027907 Ga0207428_10198661 Ga0207428_101986611 145
440 3300027907 Ga0207428_10208783 Ga0207428_102087832 145
441 3300027907 Ga0207428_10445993 Ga0207428_104459932 145
442 3300028379 Ga0268266_10128409 Ga0268266_101284092 145
443 3300028380 Ga0268265_10020045 Ga0268265_100200452 145
444 3300028380 Ga0268265_10370622 Ga0268265_103706222 145
445 3300028380 Ga0268265_10390580 Ga0268265_103905802 145
446 3300028380 Ga0268265_10636131 Ga0268265_106361312 145
447 3300028380 Ga0268265_11168192 Ga0268265_111681922 145
448 3300028381 Ga0268264_10034170 Ga0268264_100341701 145
449 3300028381 Ga0268264_10086550 Ga0268264_100865502 145
450 3300028381 Ga0268264_11251891 Ga0268264_112518911 145
451 3300028381 Ga0268264_11504774 Ga0268264_115047741 145
452 3300031548 Ga0307408_100043399 Ga0307408_1000433993 145
453 3300031731 Ga0307405_10007377 Ga0307405_100073772 145
454 3300031731 Ga0307405_10062237 Ga0307405_100622372 145
455 3300031824 Ga0307413_10000281 Ga0307413_1000028110 145
456 3300031824 Ga0307413_10003677 Ga0307413_100036772 145
457 3300031852 Ga0307410_10001116 Ga0307410_100011165 145
458 3300031852 Ga0307410_10037158 Ga0307410_100371583 145
459 3300031852 Ga0307410_10602543 Ga0307410_106025432 145
460 3300031901 Ga0307406_10025196 Ga0307406_100251962 145
461 3300031903 Ga0307407_10000476 Ga0307407_100004766 145
462 3300031903 Ga0307407_10003129 Ga0307407_100031292 145
463 3300031911 Ga0307412_11372604 Ga0307412_113726042 145
464 3300031911 Ga0307412_12024752 Ga0307412_120247521 145
465 3300031995 Ga0307409_100034031 Ga0307409_1000340314 145
466 3300031995 Ga0307409_100533910 Ga0307409_1005339102 145
467 3300031995 Ga0307409_102521853 Ga0307409_1025218531 145
468 3300032002 Ga0307416_100005491 Ga0307416_1000054919 145
469 3300032002 Ga0307416_100515664 Ga0307416_1005156641 145
470 3300032004 Ga0307414_10005544 Ga0307414_100055442 145
471 3300032004 Ga0307414_10274610 Ga0307414_102746102 145
472 3300032004 Ga0307414_11478359 Ga0307414_114783591 145
473 3300032005 Ga0307411_10004778 Ga0307411_100047786 145
474 3300032005 Ga0307411_10038452 Ga0307411_100384523 145
475 3300032005 Ga0307411_10058683 Ga0307411_100586832 145
476 3300032005 Ga0307411_10082164 Ga0307411_100821643 145
477 3300032126 Ga0307415_100053252 Ga0307415_1000532522 145
478 3300032126 Ga0307415_100230738 Ga0307415_1002307382 145
479 3300032133 Ga0316583_10016559 Ga0316583_100165593 145
480 3300034819 Ga0373958_0000446 Ga0373958_0000446_2997_3455 145
481 3300034820 Ga0373959_0081535 Ga0373959_0081535_196_654 145
482 3300035088 Ga0373940_0021496 Ga0373940_0021496_906_1364 145
483 3300035115 Ga0373941_0063958 Ga0373941_0063958_228_686 145
484 3300039437 Ga0436365_1565946 Ga0436365_1565946_1797_2246 145
485 3300042008 Ga0439450_047153 Ga0439450_047153_403_861 145
486 3300042125 Ga0450923_100480 Ga0450923_100480_100_552 145
487 3300042127 Ga0450890_011237 Ga0450890_011237_552_1010 145
488 3300042156 Ga0439446_0124927 Ga0439446_0124927_351_809 145
489 3300042436 Ga0439435_0016335 Ga0439435_0016335_973_1452 145
490 3300042437 Ga0439444_0034805 Ga0439444_0034805_453_920 145
491 3300042439 Ga0439464_0035573 Ga0439464_0035573_330_788 145
492 3300042531 Ga0450918_034876 Ga0450918_034876_283_735 145
493 3300042993 Ga0439440_0133066 Ga0439440_0133066_185_643 145
494 3300045051 Ga0451576_0039560 Ga0451576_0039560_900_1358 145
495 3300046472 Ga0495580_0702650 Ga0495580_0702650_46_507 145
496 3300046537 Ga0495598_0010801 Ga0495598_0010801_1074_1535 145
497 3300046539 Ga0495621_0164547 Ga0495621_0164547_222_683 145
498 3300046683 Ga0495658_0872520 Ga0495658_0872520_16_477 145
499 3300048911 Ga0496108_0267844 Ga0496108_0267844_83_541 145
500 3300048912 Ga0496109_0119298 Ga0496109_0119298_701_1159 145
501 3300048913 Ga0496110_0474136 Ga0496110_0474136_420_899 145
502 3300048915 Ga0496112_0725412 Ga0496112_0725412_398_877 145
503 3300048916 Ga0496113_0155747 Ga0496113_0155747_536_994 145
504 3300049568 Ga0501031_0433610 Ga0501031_0433610_325_783 145
505 3300049569 Ga0501032_0336641 Ga0501032_0336641_431_886 145
506 3300049574 Ga0501038_0082234 Ga0501038_0082234_533_988 145
507 3300049576 Ga0501040_0054284 Ga0501040_0054284_1614_2069 145
508 3300049577 Ga0501041_0241320 Ga0501041_0241320_344_802 145
509 3300049577 Ga0501041_0612176 Ga0501041_0612176_75_530 145
510 3300049578 Ga0501042_0036839 Ga0501042_0036839_1410_1865 145
511 3300049579 Ga0501043_0304440 Ga0501043_0304440_468_923 145
512 3300049580 Ga0501046_0039552 Ga0501046_0039552_1632_2087 145
513 3300049582 Ga0501048_0067007 Ga0501048_0067007_792_1247 145
514 3300049587 Ga0501071_0132168 Ga0501071_0132168_611_1066 145
515 3300049588 Ga0501072_0089143 Ga0501072_0089143_829_1284 145
516 3300049590 Ga0501074_0103590 Ga0501074_0103590_1466_1921 145
517 3300049590 Ga0501074_1309443 Ga0501074_1309443_14_469 145
518 3300049591 Ga0501075_0009791 Ga0501075_0009791_2393_2848 145
519 3300049591 Ga0501075_0242918 Ga0501075_0242918_750_1214 145
520 3300049591 Ga0501075_0378828 Ga0501075_0378828_195_662 145
521 3300049591 Ga0501075_0922201 Ga0501075_0922201_66_524 145
522 3300049592 Ga0501076_0058919 Ga0501076_0058919_2259_2714 145
523 3300049592 Ga0501076_0797822 Ga0501076_0797822_241_699 145
524 3300049593 Ga0501077_0015193 Ga0501077_0015193_1935_2390 145
525 3300049593 Ga0501077_0472641 Ga0501077_0472641_35_490 145
526 3300049656 Ga0501209_183744 Ga0501209_183744_157_615 145
527 3300049667 Ga0501230_029022 Ga0501230_029022_68_526 145
528 3300049677 Ga0501247_034864 Ga0501247_034864_86_544 145
529 3300049741 Ga0501079_1475745 Ga0501079_1475745_61_519 145
530 3300049743 Ga0501081_0001556 Ga0501081_0001556_9134_9589 145
531 3300049779 Ga0501283_135030 Ga0501283_135030_16_480 145
532 3300049822 Ga0501035_0180313 Ga0501035_0180313_751_1206 145
533 3300050507 nmdc:mga05p37_102700_c1 nmdc:mga05p37_102700_c1_1009_1488 145
534 3300050507 nmdc:mga05p37_12086_c1 nmdc:mga05p37_12086_c1_120_578 145
535 3300050507 nmdc:mga05p37_1218360_c1 nmdc:mga05p37_1218360_c1_127_582 145
536 3300050507 nmdc:mga05p37_248276_c1 nmdc:mga05p37_248276_c1_316_768 145
537 3300050507 nmdc:mga05p37_253725_c1 nmdc:mga05p37_253725_c1_1380_1859 145
538 3300050507 nmdc:mga05p37_65850_c1 nmdc:mga05p37_65850_c1_2138_2617 145
539 3300050508 nmdc:mga09592_104658_c1 nmdc:mga09592_104658_c1_1748_2227 145
540 3300050508 nmdc:mga09592_126849_c1 nmdc:mga09592_126849_c1_865_1320 145
541 3300050508 nmdc:mga09592_269428_c1 nmdc:mga09592_269428_c1_174_632 145
542 3300050508 nmdc:mga09592_2939_c1 nmdc:mga09592_2939_c1_661_1119 145
543 3300050508 nmdc:mga09592_3519_c1 nmdc:mga09592_3519_c1_5884_6342 145
544 3300050508 nmdc:mga09592_435821_c1 nmdc:mga09592_435821_c1_616_1077 145
545 3300050508 nmdc:mga09592_491204_c1 nmdc:mga09592_491204_c1_380_859 145
546 3300050508 nmdc:mga09592_55672_c1 nmdc:mga09592_55672_c1_111_590 145
547 3300050508 nmdc:mga09592_67022_c1 nmdc:mga09592_67022_c1_258_710 145
548 3300050509 nmdc:mga0qj67_258809_c1 nmdc:mga0qj67_258809_c1_446_925 145
549 3300050509 nmdc:mga0qj67_293166_c1 nmdc:mga0qj67_293166_c1_298_750 145
550 3300050509 nmdc:mga0qj67_33112_c1 nmdc:mga0qj67_33112_c1_1632_2090 145
551 3300050509 nmdc:mga0qj67_3596_c1 nmdc:mga0qj67_3596_c1_6412_6870 145
552 3300050509 nmdc:mga0qj67_43434_c1 nmdc:mga0qj67_43434_c1_3013_3468 145
553 3300050509 nmdc:mga0qj67_67785_c1 nmdc:mga0qj67_67785_c1_1657_2115 145
554 3300050510 nmdc:mga06r32_1265990_c1 nmdc:mga06r32_1265990_c1_62_541 145
555 3300050510 nmdc:mga06r32_180607_c1 nmdc:mga06r32_180607_c1_1517_1996 145
556 3300050510 nmdc:mga06r32_23370_c1 nmdc:mga06r32_23370_c1_3727_4179 145
557 3300050510 nmdc:mga06r32_596059_c1 nmdc:mga06r32_596059_c1_243_722 145
558 3300050510 nmdc:mga06r32_88268_c1 nmdc:mga06r32_88268_c1_243_698 145
559 3300050510 nmdc:mga06r32_98953_c2 nmdc:mga06r32_98953_c2_862_1320 145
560 3300050511 nmdc:mga08y16_1091333_c1 nmdc:mga08y16_1091333_c1_231_710 145
561 3300050511 nmdc:mga08y16_22565_c1 nmdc:mga08y16_22565_c1_1031_1489 145
562 3300050511 nmdc:mga08y16_325461_c1 nmdc:mga08y16_325461_c1_888_1343 145
563 3300050511 nmdc:mga08y16_3381_c1 nmdc:mga08y16_3381_c1_7634_8101 145
564 3300050511 nmdc:mga08y16_365845_c1 nmdc:mga08y16_365845_c1_542_994 145
565 3300050511 nmdc:mga08y16_381231_c1 nmdc:mga08y16_381231_c1_448_912 145
566 3300050511 nmdc:mga08y16_655_c1 nmdc:mga08y16_655_c1_26887_27342 145
567 3300050511 nmdc:mga08y16_73712_c1 nmdc:mga08y16_73712_c1_1181_1660 145
568 3300050512 nmdc:mga0n895_6535_c1 nmdc:mga0n895_6535_c1_1008_1466 145
569 3300050513 nmdc:mga0rr50_1036980_c1 nmdc:mga0rr50_1036980_c1_148_606 145
570 3300050515 nmdc:mga0a205_1056_c1 nmdc:mga0a205_1056_c1_12968_13426 145
571 3300050515 nmdc:mga0a205_60114_c1 nmdc:mga0a205_60114_c1_309_788 145
572 3300054114 Ga0501084_0051977 Ga0501084_0051977_255_710 145
573 3300054114 Ga0501084_1243032 Ga0501084_1243032_82_537 145
574 3300061734 Ga0530510_0668847 Ga0530510_0668847_57_524 145
575 iso_pu_bacteria 2554235234 2555261640 145
576 iso_pu_bacteria 2667528172 2671105671 145
577 iso_pu_bacteria 2671180115 2671586716 145
578 iso_pu_bacteria 2721755693 2723602020 145
579 iso_pu_bacteria 2728369359 2730138092 145
580 iso_pu_bacteria 2751185905 2753812430 145
581 iso_pu_bacteria 2765235842 2765587108 145
582 iso_pu_bacteria 2823373977 2823378335 145
583 iso_pu_bacteria 2889276214 2889278094 145
584 iso_pu_bacteria 2908669403 2908671146 145
585 iso_pu_bacteria 2919108558 2919113192 145
586 iso_pu_bacteria 2971820967 2971826097 145
587 iso_pu_bacteria 2974310843 2974314014 145
588 iso_pu_bacteria 2996706504 2996712652 145
589 iso_pu_bacteria 8018405270 8018405566 145
590 3300005333 Ga0070677_10001704 Ga0070677_100017045 146
591 3300005353 Ga0070669_100102313 Ga0070669_1001023132 146
592 3300005356 Ga0070674_100001218 Ga0070674_10000121810 146
593 3300005441 Ga0070700_100387809 Ga0070700_1003878092 146
594 3300005548 Ga0070665_100499857 Ga0070665_1004998572 146
595 3300005549 Ga0070704_100038367 Ga0070704_1000383672 146
596 3300005577 Ga0068857_100535873 Ga0068857_1005358732 146
597 3300005617 Ga0068859_101519377 Ga0068859_1015193771 146
598 3300005840 Ga0068870_10221415 Ga0068870_102214152 146
599 3300005843 Ga0068860_100560539 Ga0068860_1005605391 146
600 3300006844 Ga0075428_100053787 Ga0075428_1000537873 146
601 3300006846 Ga0075430_100008097 Ga0075430_1000080975 146
602 3300006847 Ga0075431_100254018 Ga0075431_1002540182 146
603 3300006852 Ga0075433_10012257 Ga0075433_100122575 146
604 3300006871 Ga0075434_100002389 Ga0075434_10000238917 146
605 3300006880 Ga0075429_100132770 Ga0075429_1001327702 146
606 3300006881 Ga0068865_101106331 Ga0068865_1011063312 146
607 3300006931 Ga0097620_101519209 Ga0097620_1015192091 146
608 3300007076 Ga0075435_100014136 Ga0075435_1000141362 146
609 3300009094 Ga0111539_10001128 Ga0111539_1000112814 146
610 3300009094 Ga0111539_11593827 Ga0111539_115938272 146
611 3300009147 Ga0114129_10086513 Ga0114129_100865132 146
612 3300009147 Ga0114129_10948927 Ga0114129_109489271 146
613 3300009148 Ga0105243_12261467 Ga0105243_122614671 146
614 3300025885 Ga0207653_10222722 Ga0207653_102227221 146
615 3300025907 Ga0207645_10117354 Ga0207645_101173542 146
616 3300025918 Ga0207662_10158149 Ga0207662_101581492 146
617 3300025923 Ga0207681_10056309 Ga0207681_100563092 146
618 3300025923 Ga0207681_10246435 Ga0207681_102464352 146
619 3300025926 Ga0207659_10614617 Ga0207659_106146171 146
620 3300025935 Ga0207709_11219072 Ga0207709_112190721 146
621 3300025937 Ga0207669_10703087 Ga0207669_107030872 146
622 3300025937 Ga0207669_10941425 Ga0207669_109414251 146
623 3300027907 Ga0207428_10001419 Ga0207428_100014199 146
624 3300027907 Ga0207428_10825286 Ga0207428_108252861 146
625 3300028380 Ga0268265_10405794 Ga0268265_104057942 146
626 3300039437 Ga0436365_0951881 Ga0436365_0951881_1004_1486 146
627 3300049652 Ga0501202_009257 Ga0501202_009257_1265_1750 146
628 3300049676 Ga0501246_048480 Ga0501246_048480_12_497 146
629 3300049687 Ga0501258_022530 Ga0501258_022530_205_690 146
630 3300050507 nmdc:mga05p37_406774_c1 nmdc:mga05p37_406774_c1_222_707 146
631 3300050507 nmdc:mga05p37_49819_c1 nmdc:mga05p37_49819_c1_1443_1925 146
632 3300050511 nmdc:mga08y16_1706_c1 nmdc:mga08y16_1706_c1_2260_2745 146
633 3300050512 nmdc:mga0n895_21708_c1 nmdc:mga0n895_21708_c1_1381_1866 146
634 3300050513 nmdc:mga0rr50_28569_c1 nmdc:mga0rr50_28569_c1_1216_1698 146
635 3300050515 nmdc:mga0a205_3281_c1 nmdc:mga0a205_3281_c1_8291_8773 146
636 3300050515 nmdc:mga0a205_577_c1 nmdc:mga0a205_577_c1_5433_5918 146
637 3300053085 Ga0495619_0552465 Ga0495619_0552465_206_709 146
638 iso_pu_bacteria 3006969106 3006973354 146
639 3300010159 Ga0099796_10018538 Ga0099796_100185381 147
640 3300031344 Ga0265316_10005214 Ga0265316_100052143 148
641 3300005548 Ga0070665_100000936 Ga0070665_10000093616 149
642 3300006051 Ga0075364_10013924 Ga0075364_100139245 149
643 3300006946 Ga0079104_1000107 Ga0079104_100010732 149
644 3300006946 Ga0079104_1000113 Ga0079104_100011387 149
645 3300009011 Ga0105251_10000273 Ga0105251_1000027335 149
646 3300009011 Ga0105251_10001705 Ga0105251_100017057 149
647 3300009011 Ga0105251_10006895 Ga0105251_100068957 149
648 3300009011 Ga0105251_10077069 Ga0105251_100770693 149
649 3300009011 Ga0105251_10157986 Ga0105251_101579861 149
650 3300009036 Ga0105244_10002761 Ga0105244_100027617 149
651 3300009092 Ga0105250_10000057 Ga0105250_1000005713 149
652 3300013100 Ga0157373_10281616 Ga0157373_102816161 149
653 3300013102 Ga0157371_10069695 Ga0157371_100696951 149
654 3300013104 Ga0157370_10004416 Ga0157370_1000441614 149
655 3300025711 Ga0207696_1000049 Ga0207696_1000049265 149
656 3300025728 Ga0207655_1001063 Ga0207655_10010631 149
657 3300025735 Ga0207713_1000105 Ga0207713_100010587 149
658 3300025735 Ga0207713_1000111 Ga0207713_100011186 149
659 3300025735 Ga0207713_1020893 Ga0207713_10208931 149
660 3300025735 Ga0207713_1098683 Ga0207713_10986832 149
661 3300025735 Ga0207713_1223296 Ga0207713_12232961 149
662 3300025935 Ga0207709_10000279 Ga0207709_1000027940 149
663 3300027111 Ga0209281_1000121 Ga0209281_100012192 149
664 3300027111 Ga0209281_1000220 Ga0209281_100022031 149
665 3300028379 Ga0268266_10000179 Ga0268266_1000017983 149
666 3300042010 Ga0439452_000127 Ga0439452_000127_20736_21185 149
667 3300042439 Ga0439464_0000268 Ga0439464_0000268_4205_4654 149
668 3300046471 Ga0495650_0012587 Ga0495650_0012587_677_1126 149
669 3300046692 Ga0495671_0035129 Ga0495671_0035129_1401_1850 149
670 3300047446 Ga0495679_031093 Ga0495679_031093_530_979 149
671 3300048907 Ga0496104_0056842 Ga0496104_0056842_2199_2648 149
672 3300048908 Ga0496105_0183214 Ga0496105_0183214_582_1031 149
673 3300048919 Ga0496116_0000854 Ga0496116_0000854_20385_20834 149
674 3300048919 Ga0496116_0421600 Ga0496116_0421600_84_533 149
675 3300048920 Ga0496117_0014636 Ga0496117_0014636_4844_5293 149
676 3300048920 Ga0496117_0019737 Ga0496117_0019737_4316_4765 149
677 3300048920 Ga0496117_0091762 Ga0496117_0091762_125_574 149
678 3300048920 Ga0496117_0092891 Ga0496117_0092891_398_847 149
679 3300048921 Ga0496118_0014184 Ga0496118_0014184_5920_6369 149
680 3300048921 Ga0496118_0027919 Ga0496118_0027919_3840_4289 149
681 3300048922 Ga0496119_0001986 Ga0496119_0001986_19030_19479 149
682 3300048922 Ga0496119_0003423 Ga0496119_0003423_9477_9926 149
683 3300048922 Ga0496119_0004874 Ga0496119_0004874_287_736 149
684 3300048922 Ga0496119_0039265 Ga0496119_0039265_1660_2109 149
685 3300048923 Ga0496120_0001616 Ga0496120_0001616_19961_20410 149
686 3300048923 Ga0496120_0001967 Ga0496120_0001967_5451_5900 149
687 3300048923 Ga0496120_0010047 Ga0496120_0010047_3721_4170 149
688 3300048923 Ga0496120_0030080 Ga0496120_0030080_939_1388 149
689 3300048924 Ga0496121_0055686 Ga0496121_0055686_2720_3169 149
690 3300048924 Ga0496121_0333953 Ga0496121_0333953_381_830 149
691 3300048925 Ga0496122_0000726 Ga0496122_0000726_55064_55513 149
692 3300048925 Ga0496122_0064596 Ga0496122_0064596_1324_1773 149
693 3300048925 Ga0496122_0380652 Ga0496122_0380652_170_619 149
694 3300048926 Ga0496123_0000371 Ga0496123_0000371_74902_75351 149
695 3300048926 Ga0496123_0018262 Ga0496123_0018262_767_1216 149
696 3300048926 Ga0496123_0078233 Ga0496123_0078233_1184_1633 149
697 3300048927 Ga0496124_0132695 Ga0496124_0132695_660_1109 149
698 3300048927 Ga0496124_0173426 Ga0496124_0173426_649_1098 149
699 3300048927 Ga0496124_0335135 Ga0496124_0335135_61_510 149
700 3300048928 Ga0496125_0002592 Ga0496125_0002592_19341_19790 149
701 3300048928 Ga0496125_0035821 Ga0496125_0035821_955_1404 149
702 3300048929 Ga0496126_0002346 Ga0496126_0002346_8988_9437 149
703 3300048929 Ga0496126_0023911 Ga0496126_0023911_2167_2616 149
704 3300048929 Ga0496126_0069617 Ga0496126_0069617_2404_2853 149
705 3300048929 Ga0496126_0282821 Ga0496126_0282821_424_873 149
706 3300048929 Ga0496126_0466698 Ga0496126_0466698_466_915 149
707 3300048929 Ga0496126_0475067 Ga0496126_0475067_360_809 149
708 iso_pu_bacteria 2600255256 2601535543 149
709 iso_pu_bacteria 2600255257 2601541580 149
710 iso_pu_bacteria 2600255310 2601759870 149
711 iso_pu_bacteria 2600255311 2601762338 149
712 iso_pu_bacteria 2602042046 2603640911 149
713 iso_pu_bacteria 2811995292 2813731015 149
714 iso_pu_bacteria 2814123068 2814698638 149
715 3300005290 Ga0065712_10230042 Ga0065712_102300422 151
716 3300005456 Ga0070678_100227524 Ga0070678_1002275242 151
717 3300009036 Ga0105244_10002809 Ga0105244_100028096 151
718 3300025728 Ga0207655_1006353 Ga0207655_10063534 151
719 3300025937 Ga0207669_10937624 Ga0207669_109376241 151
720 3300026121 Ga0207683_10344897 Ga0207683_103448972 151
721 3300048919 Ga0496116_0286995 Ga0496116_0286995_70_549 151
722 3300048925 Ga0496122_0014742 Ga0496122_0014742_6792_7271 151
723 2010549000 RicEn_C7209 RicEn_127370 153
724 3300003856 Ga0058692_1010703 Ga0058692_10107031 153
725 3300027312 Ga0209371_1000046 Ga0209371_1000046106 153
726 3300030500 Ga0268256_1000012 Ga0268256_1000012126 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

28

166

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.993 3 146
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9922 1 147
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9917 1 146
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9856 1 147
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9785 2 143
ID Description Score Start End Superfamily
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9918 1 147 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9753 2 143 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9695 2 130 3.40.1400.10
6fxsA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9644 1 144 3.40.1400.10
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9599 3 149 3.40.1400.10
ID Description Score Start End GO Terms
AF-A0A2W4MLN9-F1-model_v4 Ribose 5-phosphate isomerase B 0.9976 3 145 GO:0004725
GO:0005975
GO:0016861
AF-A0A835KZ10-F1-model_v4 Ribose-5-phosphate isomerase 0.9975 3 145 GO:0005975
GO:0016857
AF-A0A3M2AKR7-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9963 3 145 GO:0004751
GO:0005975
AF-A0A1G0SL72-F1-model_v4 Ribose 5-phosphate isomerase B 0.996 3 145 GO:0004751
GO:0009052
GO:0019316
AF-D1AKE7-F1-model_v4 Sugar-phosphate isomerase, RpiB/LacA/LacB family (EC 5.3.1.26) 0.9959 3 143 GO:0004751
GO:0009052
GO:0019316
GO:0050044

Feature Viewer

pLDDT pTM Quality
95.89 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map