F477697

General Info

Members Datasets Scaffolds Average Seq Length
726 362 1452 263

Family's Representative Sequence

Representative Sequence 3300046517|Ga0495630_0014986|Ga0495630_0014986_1002_1940
Length 299
Sequence MRHCPLFSGRVAQVWFSGETAAGEARVRIGVAGNIEMPSEINQGHVKDKLRRGEVVASMTVRLVRGVEIARIAKTAGFDSLYVDMEHSSFSLDTTGQICIAALEAGITPLVRVPGVAEVSRVLDAGALGVIAPHVQSADEARCYVEAAKFPPLGQRSAAGLLPHLQYRSFPSAQADAALNDATILIVQFESEQALGNAEEIAGVDGVDLVMIGSNDLLADWGLAGQYEHPRLRDAYAKTIAACRKHGKHVGVGGLASRPQLAAEFVRLGARYVSTGTDLGFLLAACTAKAKEVQSFDRE

Samples

Sample ID Description Type Environment
1 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
68 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
174 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
187 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
188 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
203 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
204 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
205 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
206 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
207 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
208 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
209 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
218 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
221 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
222 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
240 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
241 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
242 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
245 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
246 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
247 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
250 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
253 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
254 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
255 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
256 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
257 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
258 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
259 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
284 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
285 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
312 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
316 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
317 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
318 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
338 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
339 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
340 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
341 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
342 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
345 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
348 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
352 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
353 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
354 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
357 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 2508501050 Microvirga lupini Lut6 Isolate Nodule
360 2773857925 Microvirga vignae BR3299 Isolate Unclassified
361 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
362 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.14
Isolates 0.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.44
Nodule 0.28
Rhizoplane 5.65
Rhizosphere 85.4
Stem 0
Stem Tuber 0
Unclassified 5.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495630_0014986 3300046517 Bacteria 5655
2 JGI24750J21931_1001594 3300002070 Bacteria 2783
3 JGI24748J21848_1004316 3300002074 Bacteria 1631
4 JGI25406J46586_10009001 3300003203 Bacteria 4489
5 JGI25153J46596_10001089 3300003215 Bacteria 16511
6 JGI25153J46596_10062871 3300003215 Bacteria 998
7 rootL2_10223444 3300003322 Unclassified 1118
8 Ga0065712_10124670 3300005290 Bacteria 1623
9 Ga0070658_10404807 3300005327 Bacteria 1172
10 Ga0070690_100137363 3300005330 Bacteria 1656
11 Ga0070670_100194404 3300005331 Bacteria 1762
12 Ga0070677_10064979 3300005333 Bacteria 1517
13 Ga0068869_100065192 3300005334 Bacteria 2680
14 Ga0068869_100074080 3300005334 Bacteria 2526
15 Ga0068869_100110587 3300005334 Bacteria 2090
16 Ga0070666_10207685 3300005335 Bacteria 1378
17 Ga0070680_100163050 3300005336 Bacteria 1874
18 Ga0070680_100218907 3300005336 Bacteria 1607
19 Ga0068868_100050930 3300005338 Bacteria 3254
20 Ga0068868_100081385 3300005338 Bacteria 2596
21 Ga0068868_100255565 3300005338 Bacteria 1476
22 Ga0070660_100118475 3300005339 Bacteria 2111
23 Ga0070689_100024821 3300005340 Bacteria 4500
24 Ga0070689_100103959 3300005340 Bacteria 2252
25 Ga0070689_100356227 3300005340 Bacteria 1228
26 Ga0070691_10193306 3300005341 Bacteria 1066
27 Ga0070687_100043768 3300005343 Bacteria 2277
28 Ga0070661_100213897 3300005344 Bacteria 1476
29 Ga0070692_10014979 3300005345 Bacteria 3656
30 Ga0070668_100007486 3300005347 Bacteria 8103
31 Ga0070668_100031290 3300005347 Bacteria 4048
32 Ga0070669_100578816 3300005353 Bacteria 939
33 Ga0070675_100023649 3300005354 Bacteria 4915
34 Ga0070675_100068075 3300005354 Bacteria 2948
35 Ga0070675_100205957 3300005354 Bacteria 1709
36 Ga0070671_100014076 3300005355 Bacteria 6458
37 Ga0070671_100482852 3300005355 Bacteria 1065
38 Ga0070674_100007137 3300005356 Bacteria 6571
39 Ga0070674_100134351 3300005356 Bacteria 1849
40 Ga0070674_100222316 3300005356 Bacteria 1469
41 Ga0070674_100243422 3300005356 Unclassified 1409
42 Ga0070674_100422091 3300005356 Unclassified 1094
43 Ga0070673_100189532 3300005364 Bacteria 1765
44 Ga0070659_100731924 3300005366 Unclassified 857
45 Ga0070667_100286333 3300005367 Bacteria 1481
46 Ga0070667_100497214 3300005367 Unclassified 1118
47 Ga0070709_10003339 3300005434 Bacteria 8631
48 Ga0070714_100690059 3300005435 Unclassified 985
49 Ga0070713_100024335 3300005436 Bacteria 4715
50 Ga0070713_100102247 3300005436 Bacteria 2485
51 Ga0070710_10328803 3300005437 Unclassified 1006
52 Ga0070700_100003031 3300005441 Bacteria 8610
53 Ga0070700_100185041 3300005441 Bacteria 1452
54 Ga0070700_100239475 3300005441 Bacteria 1296
55 Ga0070700_100299661 3300005441 Bacteria 1173
56 Ga0070663_100137691 3300005455 Bacteria 1860
57 Ga0070663_100266571 3300005455 Bacteria 1360
58 Ga0070678_100461828 3300005456 Bacteria 1114
59 Ga0070662_100150775 3300005457 Bacteria 1810
60 Ga0070681_10128263 3300005458 Bacteria 2469
61 Ga0070681_10150589 3300005458 Bacteria 2253
62 Ga0068867_100000729 3300005459 Bacteria 22020
63 Ga0068867_100082922 3300005459 Bacteria 2420
64 Ga0068867_100090960 3300005459 Bacteria 2316
65 Ga0068867_100225585 3300005459 Bacteria 1512
66 Ga0070685_10176092 3300005466 Unclassified 1373
67 Ga0070698_100164712 3300005471 Bacteria 2160
68 Ga0070699_100000391 3300005518 Bacteria 42600
69 Ga0070679_100017610 3300005530 Bacteria 6916
70 Ga0070684_100186662 3300005535 Bacteria 1886
71 Ga0070684_100344257 3300005535 Bacteria 1371
72 Ga0070697_100004723 3300005536 Bacteria 10441
73 Ga0068853_100096262 3300005539 Bacteria 2611
74 Ga0068853_100169982 3300005539 Bacteria 1972
75 Ga0070672_100050797 3300005543 Bacteria 3231
76 Ga0070672_100578253 3300005543 Bacteria 977
77 Ga0070672_100631200 3300005543 Bacteria 935
78 Ga0070686_100015684 3300005544 Bacteria 4395
79 Ga0070686_100148013 3300005544 Bacteria 1641
80 Ga0070695_100080235 3300005545 Bacteria 2156
81 Ga0070695_100137387 3300005545 Bacteria 1691
82 Ga0070696_100122755 3300005546 Bacteria 1882
83 Ga0070696_100493664 3300005546 Bacteria 973
84 Ga0070693_100252237 3300005547 Bacteria 1170
85 Ga0070665_100566440 3300005548 Bacteria 1148
86 Ga0070704_100007741 3300005549 Bacteria 6405
87 Ga0070704_100029132 3300005549 Bacteria 3682
88 Ga0068855_100235263 3300005563 Bacteria 2049
89 Ga0068854_100331707 3300005578 Unclassified 1239
90 Ga0068856_100109714 3300005614 Bacteria 2756
91 Ga0068856_100565390 3300005614 Bacteria 1158
92 Ga0068859_100054576 3300005617 Bacteria 4019
93 Ga0068864_100124602 3300005618 Bacteria 2307
94 Ga0068864_100482985 3300005618 Bacteria 1189
95 Ga0068864_100716224 3300005618 Unclassified 978
96 Ga0068866_10034773 3300005718 Bacteria 2457
97 Ga0068866_10289964 3300005718 Unclassified 1017
98 Ga0068861_100016366 3300005719 Bacteria 5247
99 Ga0068861_100292760 3300005719 Bacteria 1406
100 Ga0068861_100360051 3300005719 Bacteria 1279
101 Ga0068861_100387865 3300005719 Bacteria 1236
102 Ga0068870_10016189 3300005840 Bacteria 3556
103 Ga0068870_10132957 3300005840 Bacteria 1447
104 Ga0068863_100030459 3300005841 Bacteria 5152
105 Ga0068863_100260979 3300005841 Bacteria 1675
106 Ga0068863_100477135 3300005841 Bacteria 1226
107 Ga0068858_100025413 3300005842 Bacteria 5511
108 Ga0068858_100353561 3300005842 Bacteria 1408
109 Ga0068860_100445024 3300005843 Bacteria 1288
110 Ga0068862_100006103 3300005844 Bacteria 10030
111 Ga0081455_10000079 3300005937 Bacteria 104277
112 Ga0081455_10000669 3300005937 Bacteria 44336
113 Ga0081455_10010322 3300005937 Bacteria 9494
114 Ga0081455_10026170 3300005937 Bacteria 5374
115 Ga0081455_10117417 3300005937 Bacteria 2102
116 Ga0081538_10001564 3300005981 Bacteria 23475
117 Ga0081538_10034499 3300005981 Bacteria 3344
118 Ga0081540_1001200 3300005983 Bacteria 22696
119 Ga0081540_1037669 3300005983 Bacteria 2559
120 Ga0081540_1038195 3300005983 Bacteria 2534
121 Ga0081539_10003519 3300005985 Bacteria 19093
122 Ga0075365_10134551 3300006038 Bacteria 1712
123 Ga0075365_10263522 3300006038 Bacteria 1212
124 Ga0075368_10004273 3300006042 Bacteria 4825
125 Ga0075368_10011394 3300006042 Bacteria 3234
126 Ga0075363_100036753 3300006048 Bacteria 2570
127 Ga0075363_100065234 3300006048 Bacteria 1968
128 Ga0075363_100089386 3300006048 Bacteria 1694
129 Ga0075363_100227758 3300006048 Bacteria 1069
130 Ga0075364_10085290 3300006051 Bacteria 2091
131 Ga0070712_100114780 3300006175 Bacteria 2017
132 Ga0070712_100167800 3300006175 Bacteria 1700
133 Ga0075362_10039546 3300006177 Unclassified 2074
134 Ga0075362_10058426 3300006177 Bacteria 1739
135 Ga0075362_10121980 3300006177 Bacteria 1234
136 Ga0075362_10124249 3300006177 Unclassified 1223
137 Ga0075362_10184359 3300006177 Bacteria 1012
138 Ga0075367_10047344 3300006178 Bacteria 2529
139 Ga0075369_10015366 3300006186 Bacteria 3071
140 Ga0075369_10052120 3300006186 Bacteria 1773
141 Ga0075369_10147286 3300006186 Unclassified 1075
142 Ga0075366_10045141 3300006195 Bacteria 2612
143 Ga0075366_10061626 3300006195 Bacteria 2229
144 Ga0075366_10069832 3300006195 Bacteria 2091
145 Ga0075366_10357586 3300006195 Unclassified 897
146 Ga0075370_10112957 3300006353 Bacteria 1578
147 Ga0075428_100013458 3300006844 Bacteria 9104
148 Ga0075428_100017385 3300006844 Bacteria 7949
149 Ga0075428_100034190 3300006844 Bacteria 5608
150 Ga0075428_100057483 3300006844 Bacteria 4258
151 Ga0075428_100085674 3300006844 Bacteria 3436
152 Ga0075428_100121271 3300006844 Bacteria 2847
153 Ga0075428_100143791 3300006844 Bacteria 2593
154 Ga0075428_100143852 3300006844 Bacteria 2592
155 Ga0075428_100297017 3300006844 Bacteria 1737
156 Ga0075430_100029308 3300006846 Bacteria 4670
157 Ga0075430_100030975 3300006846 Bacteria 4542
158 Ga0075430_100088091 3300006846 Bacteria 2598
159 Ga0075430_100173382 3300006846 Bacteria 1795
160 Ga0075430_100181709 3300006846 Unclassified 1749
161 Ga0075431_100041648 3300006847 Bacteria 4735
162 Ga0075431_100082276 3300006847 Bacteria 3323
163 Ga0075431_100215583 3300006847 Bacteria 1959
164 Ga0075433_10000500 3300006852 Bacteria 25544
165 Ga0075433_10002047 3300006852 Bacteria 15229
166 Ga0075434_100004724 3300006871 Bacteria 12317
167 Ga0075434_100041809 3300006871 Bacteria 4542
168 Ga0075434_100067032 3300006871 Bacteria 3577
169 Ga0075434_100323081 3300006871 Unclassified 1564
170 Ga0075434_100476954 3300006871 Bacteria 1269
171 Ga0075429_100006156 3300006880 Bacteria 10373
172 Ga0075429_100036588 3300006880 Bacteria 4270
173 Ga0075429_100087133 3300006880 Bacteria 2721
174 Ga0075429_100233892 3300006880 Unclassified 1610
175 Ga0068865_100049493 3300006881 Bacteria 2897
176 Ga0075436_100004157 3300006914 Bacteria 9928
177 Ga0075436_100009718 3300006914 Bacteria 6581
178 Ga0075436_100215139 3300006914 Bacteria 1363
179 Ga0075436_100472871 3300006914 Unclassified 915
180 Ga0097620_100054576 3300006931 Bacteria 4019
181 Ga0075435_100000047 3300007076 Bacteria 60782
182 Ga0075435_100360666 3300007076 Bacteria 1247
183 Ga0075435_100365217 3300007076 Bacteria 1239
184 Ga0111539_10050852 3300009094 Bacteria 4937
185 Ga0111539_10073118 3300009094 Bacteria 4042
186 Ga0111539_10130461 3300009094 Bacteria 2943
187 Ga0111539_10159185 3300009094 Bacteria 2641
188 Ga0111539_10511322 3300009094 Bacteria 1399
189 Ga0111539_10850732 3300009094 Bacteria 1061
190 Ga0111539_10948578 3300009094 Bacteria 1000
191 Ga0105245_10124502 3300009098 Bacteria 2411
192 Ga0105245_10261087 3300009098 Bacteria 1686
193 Ga0105247_10013222 3300009101 Bacteria 4951
194 Ga0105247_10176742 3300009101 Bacteria 1422
195 Ga0114129_10005299 3300009147 Bacteria 18196
196 Ga0114129_10025557 3300009147 Bacteria 8366
197 Ga0114129_10227284 3300009147 Bacteria 2514
198 Ga0114129_10470677 3300009147 Unclassified 1645
199 Ga0114129_10547593 3300009147 Bacteria 1505
200 Ga0114129_10703835 3300009147 Bacteria 1298
201 Ga0114129_10850636 3300009147 Bacteria 1160
202 Ga0114129_10991838 3300009147 Bacteria 1058
203 Ga0105243_10018378 3300009148 Bacteria 5295
204 Ga0105243_10032485 3300009148 Bacteria 4034
205 Ga0105243_10118121 3300009148 Bacteria 2231
206 Ga0105241_10209766 3300009174 Bacteria 1631
207 Ga0105242_10049576 3300009176 Bacteria 3417
208 Ga0105242_10338863 3300009176 Bacteria 1385
209 Ga0105248_10030282 3300009177 Bacteria 6043
210 Ga0105248_10328007 3300009177 Bacteria 1724
211 Ga0105248_10805982 3300009177 Bacteria 1060
212 Ga0105237_10221279 3300009545 Bacteria 1893
213 Ga0105237_10283674 3300009545 Bacteria 1659
214 Ga0105238_10248196 3300009551 Bacteria 1758
215 Ga0105249_10012850 3300009553 Bacteria 7389
216 Ga0105249_10487889 3300009553 Bacteria 1276
217 Ga0105239_10338053 3300010375 Bacteria 1699
218 Ga0105239_10525543 3300010375 Bacteria 1346
219 Ga0157374_10050289 3300013296 Bacteria 3873
220 Ga0157378_10006229 3300013297 Bacteria 10445
221 Ga0157378_10387964 3300013297 Bacteria 1373
222 Ga0157378_10454820 3300013297 Bacteria 1271
223 Ga0157378_10525039 3300013297 Bacteria 1186
224 Ga0163162_10057447 3300013306 Bacteria 3919
225 Ga0157375_10255626 3300013308 Bacteria 1913
226 Ga0157375_10731269 3300013308 Bacteria 1142
227 Ga0163163_10004477 3300014325 Bacteria 11918
228 Ga0163163_10236282 3300014325 Bacteria 1877
229 Ga0157380_10071822 3300014326 Bacteria 2801
230 Ga0157380_10507903 3300014326 Bacteria 1172
231 Ga0157379_10414145 3300014968 Bacteria 1240
232 Ga0163161_10089311 3300017792 Bacteria 2279
233 Ga0213876_10097463 3300021384 Bacteria 1558
234 Ga0228598_1030771 3300024227 Bacteria 1056
235 Ga0209758_1007351 3300025297 Bacteria 7536
236 Ga0207682_10005221 3300025893 Bacteria 5315
237 Ga0207682_10041628 3300025893 Bacteria 1875
238 Ga0207710_10116630 3300025900 Bacteria 1272
239 Ga0207688_10007736 3300025901 Bacteria 5855
240 Ga0207688_10016430 3300025901 Bacteria 4013
241 Ga0207680_10173016 3300025903 Bacteria 1455
242 Ga0207680_10465656 3300025903 Unclassified 898
243 Ga0207645_10047944 3300025907 Bacteria 2728
244 Ga0207643_10002578 3300025908 Bacteria 9815
245 Ga0207684_10040163 3300025910 Bacteria 3967
246 Ga0207707_10255729 3300025912 Bacteria 1521
247 Ga0207707_10321412 3300025912 Bacteria 1336
248 Ga0207695_10162346 3300025913 Bacteria 2165
249 Ga0207671_10260081 3300025914 Bacteria 1366
250 Ga0207693_10020533 3300025915 Bacteria 5252
251 Ga0207693_10020627 3300025915 Bacteria 5240
252 Ga0207663_10076430 3300025916 Bacteria 2176
253 Ga0207660_10077605 3300025917 Bacteria 2432
254 Ga0207662_10021624 3300025918 Bacteria 3681
255 Ga0207662_10032133 3300025918 Bacteria 3053
256 Ga0207662_10034207 3300025918 Bacteria 2966
257 Ga0207657_10033671 3300025919 Bacteria 4615
258 Ga0207649_10335565 3300025920 Bacteria 1115
259 Ga0207646_10061943 3300025922 Bacteria 3339
260 Ga0207681_10001225 3300025923 Bacteria 16531
261 Ga0207681_10381899 3300025923 Bacteria 1134
262 Ga0207687_10398900 3300025927 Bacteria 1131
263 Ga0207700_10091527 3300025928 Bacteria 2402
264 Ga0207700_10132622 3300025928 Unclassified 2036
265 Ga0207700_10206450 3300025928 Bacteria 1658
266 Ga0207664_10217863 3300025929 Bacteria 1654
267 Ga0207664_10312179 3300025929 Bacteria 1385
268 Ga0207644_10136158 3300025931 Bacteria 1886
269 Ga0207644_10195721 3300025931 Bacteria 1592
270 Ga0207706_10391995 3300025933 Unclassified 1205
271 Ga0207686_10053597 3300025934 Bacteria 2522
272 Ga0207709_10006297 3300025935 Bacteria 6664
273 Ga0207709_10069480 3300025935 Bacteria 2230
274 Ga0207670_10037951 3300025936 Bacteria 3143
275 Ga0207670_10085558 3300025936 Bacteria 2216
276 Ga0207670_10149284 3300025936 Bacteria 1733
277 Ga0207669_10023689 3300025937 Bacteria 3284
278 Ga0207669_10025020 3300025937 Bacteria 3218
279 Ga0207669_10439231 3300025937 Bacteria 1031
280 Ga0207704_10003866 3300025938 Bacteria 6806
281 Ga0207704_10138117 3300025938 Bacteria 1700
282 Ga0207691_10026641 3300025940 Bacteria 5424
283 Ga0207691_10077916 3300025940 Bacteria 2984
284 Ga0207691_10126386 3300025940 Bacteria 2262
285 Ga0207691_10565177 3300025940 Unclassified 964
286 Ga0207711_10049506 3300025941 Bacteria 3597
287 Ga0207711_10120550 3300025941 Bacteria 2341
288 Ga0207689_10124654 3300025942 Bacteria 2119
289 Ga0207689_10145616 3300025942 Bacteria 1952
290 Ga0207689_10355100 3300025942 Bacteria 1219
291 Ga0207679_10096868 3300025945 Bacteria 2296
292 Ga0207679_10206821 3300025945 Bacteria 1643
293 Ga0207651_10610284 3300025960 Bacteria 954
294 Ga0207712_10161109 3300025961 Bacteria 1744
295 Ga0207712_10491247 3300025961 Bacteria 1048
296 Ga0207668_10358101 3300025972 Bacteria 1222
297 Ga0207640_10018223 3300025981 Bacteria 4122
298 Ga0207658_10291404 3300025986 Bacteria 1403
299 Ga0207658_10356028 3300025986 Bacteria 1276
300 Ga0207703_10487900 3300026035 Bacteria 1155
301 Ga0207639_10022893 3300026041 Bacteria 4506
302 Ga0207678_10017701 3300026067 Bacteria 6257
303 Ga0207678_10370292 3300026067 Bacteria 1237
304 Ga0207708_10001677 3300026075 Bacteria 16413
305 Ga0207708_10011303 3300026075 Bacteria 6646
306 Ga0207708_10102139 3300026075 Bacteria 2220
307 Ga0207708_10366252 3300026075 Bacteria 1185
308 Ga0207702_10334501 3300026078 Bacteria 1445
309 Ga0207702_10614104 3300026078 Bacteria 1067
310 Ga0207641_10227213 3300026088 Bacteria 1733
311 Ga0207641_10252977 3300026088 Bacteria 1646
312 Ga0207641_10364848 3300026088 Bacteria 1380
313 Ga0207641_10656547 3300026088 Bacteria 1030
314 Ga0207648_10001462 3300026089 Bacteria 25984
315 Ga0207648_10006412 3300026089 Bacteria 11694
316 Ga0207648_10049976 3300026089 Bacteria 3657
317 Ga0207648_10169093 3300026089 Bacteria 1932
318 Ga0207676_10447928 3300026095 Bacteria 1216
319 Ga0207676_10607068 3300026095 Bacteria 1051
320 Ga0207674_10060428 3300026116 Bacteria 3832
321 Ga0207674_10127787 3300026116 Bacteria 2506
322 Ga0207675_100014551 3300026118 Bacteria 7334
323 Ga0207675_100033231 3300026118 Bacteria 4807
324 Ga0207675_100082824 3300026118 Bacteria 3009
325 Ga0207683_10041083 3300026121 Bacteria 4037
326 Ga0207683_10220328 3300026121 Bacteria 1729
327 Ga0207698_10537209 3300026142 Unclassified 1144
328 Ga0209971_1005793 3300027682 Bacteria 2928
329 Ga0209813_10046573 3300027866 Bacteria 1340
330 Ga0207428_10177875 3300027907 Bacteria 1608
331 Ga0207428_10275532 3300027907 Bacteria 1250
332 Ga0268266_10073587 3300028379 Bacteria 2965
333 Ga0268266_10588284 3300028379 Bacteria 1068
334 Ga0268265_10002607 3300028380 Bacteria 13414
335 Ga0268265_10312770 3300028380 Bacteria 1419
336 Ga0268264_10176753 3300028381 Bacteria 1935
337 Ga0268264_11025560 3300028381 Bacteria 832
338 Ga0307511_10000003 3300030521 Bacteria 193269
339 Ga0265760_10021775 3300031090 Bacteria 1856
340 Ga0265332_10077548 3300031238 Bacteria 1411
341 Ga0265325_10001522 3300031241 Bacteria 16252
342 Ga0265325_10106415 3300031241 Bacteria 1367
343 Ga0265340_10025076 3300031247 Bacteria 3024
344 Ga0265340_10029194 3300031247 Bacteria 2770
345 Ga0265339_10000034 3300031249 Bacteria 125636
346 Ga0265339_10062246 3300031249 Bacteria 2006
347 Ga0265331_10020733 3300031250 Bacteria 3369
348 Ga0265316_10246469 3300031344 Bacteria 1313
349 Ga0307513_10278337 3300031456 Bacteria 1452
350 Ga0265313_10000185 3300031595 Bacteria 66161
351 Ga0265314_10126975 3300031711 Bacteria 1596
352 Ga0265342_10078213 3300031712 Bacteria 1914
353 Ga0265342_10215222 3300031712 Bacteria 1037
354 Ga0307410_10467996 3300031852 Unclassified 1031
355 Ga0307407_10053353 3300031903 Bacteria 2326
356 Ga0307409_100180079 3300031995 Bacteria 1870
357 Ga0307409_100263801 3300031995 Bacteria 1582
358 Ga0307409_100419881 3300031995 Bacteria 1283
359 Ga0307416_100050434 3300032002 Bacteria 3317
360 Ga0307416_100313316 3300032002 Bacteria 1567
361 Ga0307414_10168789 3300032004 Unclassified 1747
362 Ga0307414_10295301 3300032004 Bacteria 1368
363 Ga0307411_10212638 3300032005 Bacteria 1494
364 Ga0373930_0003308 3300034816 Bacteria 2547
365 Ga0373959_0037738 3300034820 Bacteria 1002
366 Ga0373926_0000320 3300035083 Bacteria 11963
367 Ga0373934_0008489 3300035086 Bacteria 3828
368 Ga0373934_0021385 3300035086 Bacteria 2490
369 Ga0373944_0005339 3300035089 Bacteria 3380
370 Ga0373944_0035841 3300035089 Bacteria 1513
371 Ga0373932_0005872 3300035112 Bacteria 2891
372 Ga0373936_0016094 3300035113 Bacteria 2873
373 Ga0373936_0093480 3300035113 Bacteria 1263
374 Ga0373939_0007068 3300035114 Bacteria 2717
375 Ga0373941_0004148 3300035115 Bacteria 3328
376 Ga0373945_0001387 3300035116 Bacteria 7358
377 Ga0373945_0010334 3300035116 Bacteria 3072
378 Ga0373945_0031951 3300035116 Unclassified 1863
379 Ga0373954_0076171 3300035118 Bacteria 1598
380 Ga0373956_0000703 3300035119 Bacteria 13801
381 Ga0373960_0043364 3300035121 Bacteria 1310
382 Ga0373943_0011764 3300035170 Bacteria 3938
383 Ga0373943_0047211 3300035170 Bacteria 2104
384 Ga0373943_0125057 3300035170 Bacteria 1370
385 Ga0373943_0225668 3300035170 Bacteria 1045
386 Ga0373946_0003712 3300035171 Bacteria 5411
387 Ga0373946_0011096 3300035171 Bacteria 3351
388 Ga0373946_0022596 3300035171 Bacteria 2450
389 Ga0373955_0021741 3300035172 Bacteria 3243
390 Ga0373961_0034648 3300035241 Bacteria 1428
391 Ga0373961_0088169 3300035241 Unclassified 987
392 Ga0373924_0140406 3300035410 Bacteria 1054
393 Ga0373924_0168755 3300035410 Bacteria 961
394 Ga0373931_0003181 3300035691 Bacteria 7326
395 Ga0373931_0029840 3300035691 Bacteria 2803
396 Ga0373935_0002678 3300035692 Bacteria 10245
397 Ga0373935_0008932 3300035692 Bacteria 5998
398 Ga0373935_0023689 3300035692 Bacteria 3773
399 Ga0373935_0108049 3300035692 Bacteria 1843
400 Ga0373935_0148903 3300035692 Bacteria 1587
401 Ga0373935_0268800 3300035692 Bacteria 1198
402 Ga0373935_0340102 3300035692 Bacteria 1068
403 Ga0373927_0005846 3300035695 Bacteria 8434
404 Ga0373927_0006828 3300035695 Bacteria 7767
405 Ga0373927_0108373 3300035695 Bacteria 1809
406 Ga0373933_0000538 3300035724 Bacteria 23511
407 Ga0373933_0124167 3300035724 Bacteria 1618
408 Ga0373933_0519005 3300035724 Bacteria 781
409 Ga0373947_0009169 3300035725 Bacteria 5688
410 Ga0373947_0031657 3300035725 Bacteria 3114
411 Ga0373947_0032720 3300035725 Bacteria 3066
412 Ga0373947_0053172 3300035725 Bacteria 2441
413 Ga0373947_0250483 3300035725 Bacteria 1171
414 Ga0373937_0061855 3300036401 Bacteria 3441
415 Ga0373925_0020513 3300037068 Bacteria 4811
416 Ga0373925_0032392 3300037068 Bacteria 3847
417 Ga0373925_0245661 3300037068 Bacteria 1434
418 Ga0373925_0370615 3300037068 Bacteria 1165
419 Ga0395899_0144836 3300037312 Bacteria 1688
420 Ga0395899_0152530 3300037312 Bacteria 1637
421 Ga0395900_0029817 3300037418 Bacteria 5600
422 Ga0395900_0154376 3300037418 Bacteria 2345
423 Ga0395900_0158746 3300037418 Bacteria 2308
424 Ga0395898_0133314 3300037466 Bacteria 2379
425 Ga0395898_0163314 3300037466 Bacteria 2130
426 Ga0395905_0164090 3300037471 Bacteria 2087
427 Ga0436364_0952959 3300037853 Bacteria 1340
428 Ga0395901_0232723 3300038443 Bacteria 1923
429 Ga0436365_1645076 3300039437 Bacteria 6470
430 Ga0436361_0019210 3300039447 Bacteria 7012
431 Ga0451853_0973126 3300041512 Bacteria 1461
432 Ga0439435_0015231 3300042436 Bacteria 1911
433 Ga0450916_007539 3300042530 Bacteria 1309
434 Ga0466965_0093220 3300044683 Bacteria 1534
435 Ga0466964_0163644 3300044706 Bacteria 1042
436 Ga0466957_0144861 3300044842 Bacteria 1533
437 Ga0466957_0273485 3300044842 Bacteria 1129
438 Ga0466959_0291671 3300045049 Bacteria 1118
439 Ga0451576_0102670 3300045051 Bacteria 2974
440 Ga0495592_0019945 3300046454 Bacteria 5097
441 Ga0495592_0020812 3300046454 Bacteria 4989
442 Ga0495592_0050654 3300046454 Bacteria 3085
443 Ga0495592_0095509 3300046454 Bacteria 2126
444 Ga0495603_0006114 3300046455 Bacteria 7202
445 Ga0495629_0026963 3300046459 Bacteria 4081
446 Ga0495629_0056015 3300046459 Unclassified 2757
447 Ga0495629_0364721 3300046459 Bacteria 984
448 Ga0495638_0052281 3300046460 Bacteria 2545
449 Ga0495638_0053530 3300046460 Bacteria 2511
450 Ga0495651_0002284 3300046462 Bacteria 14794
451 Ga0495653_0032496 3300046463 Bacteria 4141
452 Ga0495653_0042057 3300046463 Bacteria 3562
453 Ga0495580_0001270 3300046472 Bacteria 22269
454 Ga0495580_0032962 3300046472 Bacteria 3733
455 Ga0495582_0389835 3300046473 Bacteria 803
456 Ga0495605_0030440 3300046474 Bacteria 2768
457 Ga0495605_0185421 3300046474 Bacteria 913
458 Ga0495639_0005284 3300046475 Bacteria 5556
459 Ga0495639_0064851 3300046475 Bacteria 1679
460 Ga0495639_0228987 3300046475 Bacteria 915
461 Ga0495662_0062753 3300046476 Bacteria 1795
462 Ga0495664_0010522 3300046477 Bacteria 5192
463 Ga0495584_0033810 3300046491 Bacteria 2587
464 Ga0495584_0047356 3300046491 Bacteria 2168
465 Ga0495584_0079908 3300046491 Bacteria 1645
466 Ga0495584_0138776 3300046491 Bacteria 1234
467 Ga0495585_0086941 3300046492 Bacteria 1688
468 Ga0495594_0011329 3300046499 Bacteria 4632
469 Ga0495594_0029809 3300046499 Bacteria 2950
470 Ga0495607_0119695 3300046501 Bacteria 1384
471 Ga0495608_0020532 3300046511 Bacteria 4541
472 Ga0495608_0070161 3300046511 Bacteria 2287
473 Ga0495608_0264755 3300046511 Bacteria 1069
474 Ga0495618_0005264 3300046514 Bacteria 7907
475 Ga0495618_0016181 3300046514 Bacteria 4558
476 Ga0495618_0055307 3300046514 Bacteria 2512
477 Ga0495618_0227314 3300046514 Unclassified 1175
478 Ga0495628_0002688 3300046516 Bacteria 15901
479 Ga0495628_0076461 3300046516 Bacteria 2605
480 Ga0495628_0171215 3300046516 Bacteria 1646
481 Ga0495628_0200317 3300046516 Bacteria 1504
482 Ga0495630_0002130 3300046517 Bacteria 13770
483 Ga0495630_0023086 3300046517 Bacteria 4597
484 Ga0495630_0255288 3300046517 Unclassified 1339
485 Ga0495630_0374094 3300046517 Bacteria 1091
486 Ga0495630_0376816 3300046517 Bacteria 1087
487 Ga0495637_0056041 3300046520 Bacteria 1633
488 Ga0495666_0084811 3300046526 Bacteria 1496
489 Ga0495642_0153839 3300046528 Bacteria 996
490 Ga0495652_0003451 3300046529 Bacteria 15598
491 Ga0495652_0021923 3300046529 Bacteria 5679
492 Ga0495665_0026563 3300046531 Bacteria 3109
493 Ga0495665_0033757 3300046531 Bacteria 2736
494 Ga0495665_0038131 3300046531 Bacteria 2563
495 Ga0495665_0123740 3300046531 Bacteria 1354
496 Ga0495640_0061675 3300046533 Bacteria 2546
497 Ga0495640_0095770 3300046533 Bacteria 1953
498 Ga0495586_0003130 3300046535 Bacteria 8902
499 Ga0495587_0162459 3300046536 Bacteria 1270
500 Ga0495598_0044010 3300046537 Bacteria 1317
501 Ga0495645_0000432 3300046543 Bacteria 28796
502 Ga0495645_0024689 3300046543 Bacteria 4362
503 Ga0495633_0039898 3300046558 Bacteria 2239
504 Ga0495667_0101295 3300046559 Bacteria 1864
505 Ga0495667_0159993 3300046559 Bacteria 1448
506 Ga0495656_0124705 3300046615 Bacteria 1220
507 Ga0495634_0005514 3300046642 Bacteria 9722
508 Ga0495634_0147848 3300046642 Bacteria 1488
509 Ga0495634_0162649 3300046642 Bacteria 1406
510 Ga0495635_0004265 3300046663 Bacteria 9900
511 Ga0495635_0013269 3300046663 Bacteria 5765
512 Ga0495635_0215638 3300046663 Bacteria 1299
513 Ga0495588_0029878 3300046674 Bacteria 2736
514 Ga0495588_0088583 3300046674 Bacteria 1620
515 Ga0495599_0001640 3300046678 Bacteria 12910
516 Ga0495599_0238223 3300046678 Bacteria 1110
517 Ga0495599_0266345 3300046678 Unclassified 1040
518 Ga0495646_0013702 3300046680 Bacteria 5154
519 Ga0495647_0001973 3300046681 Bacteria 6405
520 Ga0495658_0006925 3300046683 Bacteria 5589
521 Ga0495658_0026587 3300046683 Bacteria 3103
522 Ga0495658_0084164 3300046683 Bacteria 1872
523 Ga0495669_0143444 3300046684 Bacteria 1128
524 Ga0495613_0051377 3300046689 Bacteria 3038
525 Ga0495613_0072122 3300046689 Bacteria 2517
526 Ga0495613_0168084 3300046689 Bacteria 1557
527 Ga0495624_0000746 3300046690 Bacteria 25580
528 Ga0495624_0199949 3300046690 Bacteria 1214
529 Ga0495624_0254841 3300046690 Bacteria 1061
530 Ga0495671_0138347 3300046692 Bacteria 1187
531 Ga0495589_0045459 3300046794 Bacteria 2181
532 Ga0495600_0039183 3300046809 Bacteria 3085
533 Ga0495600_0135009 3300046809 Bacteria 1603
534 Ga0495581_0022190 3300047315 Bacteria 3678
535 Ga0495581_0046524 3300047315 Bacteria 2508
536 Ga0495581_0263582 3300047315 Unclassified 1008
537 Ga0495604_0108589 3300047317 Bacteria 2027
538 Ga0495604_0157328 3300047317 Unclassified 1608
539 Ga0495636_0136929 3300047318 Bacteria 1092
540 Ga0495674_0011073 3300047319 Bacteria 8514
541 Ga0495674_0061722 3300047319 Bacteria 3265
542 Ga0495674_0105392 3300047319 Bacteria 2396
543 Ga0495672_0118114 3300047320 Bacteria 1414
544 Ga0495676_0054485 3300047321 Bacteria 3179
545 Ga0495676_0054618 3300047321 Bacteria 3174
546 Ga0495676_0086728 3300047321 Bacteria 2354
547 Ga0495676_0211220 3300047321 Bacteria 1342
548 Ga0495680_0058766 3300047322 Bacteria 2970
549 Ga0495675_0086292 3300047444 Bacteria 1973
550 Ga0495675_0255968 3300047444 Bacteria 1050
551 Ga0495684_0012041 3300047471 Bacteria 6671
552 Ga0495684_0022050 3300047471 Bacteria 4903
553 Ga0495684_0079921 3300047471 Bacteria 2482
554 Ga0495684_0188582 3300047471 Bacteria 1525
555 Ga0495593_0008765 3300047673 Bacteria 5872
556 Ga0495593_0133348 3300047673 Unclassified 1260
557 Ga0495593_0142990 3300047673 Bacteria 1212
558 Ga0495602_0265162 3300048088 Bacteria 1272
559 Ga0495614_0070056 3300048089 Bacteria 1511
560 Ga0495614_0140242 3300048089 Bacteria 1074
561 Ga0495626_0154136 3300048091 Unclassified 967
562 Ga0496100_0089017 3300048903 Bacteria 2102
563 Ga0496103_0022327 3300048906 Bacteria 3810
564 Ga0496104_0000253 3300048907 Bacteria 47525
565 Ga0496104_0000778 3300048907 Bacteria 27299
566 Ga0496104_0020957 3300048907 Bacteria 5996
567 Ga0496104_0027509 3300048907 Bacteria 5263
568 Ga0496105_0016531 3300048908 Bacteria 5892
569 Ga0496105_0039740 3300048908 Bacteria 3878
570 Ga0496105_0043953 3300048908 Bacteria 3684
571 Ga0496106_0009665 3300048909 Bacteria 7123
572 Ga0496106_0505874 3300048909 Bacteria 970
573 Ga0496107_0081277 3300048910 Bacteria 2363
574 Ga0496107_0102218 3300048910 Bacteria 2101
575 Ga0496108_0003559 3300048911 Bacteria 12495
576 Ga0496108_0124743 3300048911 Bacteria 2210
577 Ga0496108_0170139 3300048911 Bacteria 1885
578 Ga0496109_0001664 3300048912 Bacteria 18514
579 Ga0496109_0025511 3300048912 Bacteria 5267
580 Ga0496109_0623413 3300048912 Bacteria 1015
581 Ga0496110_0008663 3300048913 Bacteria 8191
582 Ga0496110_0055616 3300048913 Bacteria 3482
583 Ga0496110_0118986 3300048913 Bacteria 2379
584 Ga0496110_0179216 3300048913 Bacteria 1924
585 Ga0496111_0038752 3300048914 Bacteria 3415
586 Ga0496111_0104451 3300048914 Bacteria 2084
587 Ga0496111_0252739 3300048914 Bacteria 1308
588 Ga0496112_0124243 3300048915 Bacteria 2551
589 Ga0496112_0285213 3300048915 Bacteria 1598
590 Ga0496112_0292090 3300048915 Bacteria 1576
591 Ga0496112_0510319 3300048915 Bacteria 1137
592 Ga0496112_0542443 3300048915 Bacteria 1097
593 Ga0496113_0001475 3300048916 Bacteria 13126
594 Ga0496113_0016293 3300048916 Bacteria 5131
595 Ga0496114_0007386 3300048917 Bacteria 8684
596 Ga0496114_0148706 3300048917 Bacteria 2031
597 Ga0496114_0207286 3300048917 Bacteria 1719
598 Ga0496114_0351057 3300048917 Bacteria 1304
599 Ga0496114_0474194 3300048917 Bacteria 1107
600 Ga0496115_0015056 3300048918 Bacteria 5862
601 Ga0496115_0094875 3300048918 Bacteria 2441
602 Ga0496115_0358001 3300048918 Bacteria 1189
603 Ga0501032_0017659 3300049569 Bacteria 5007
604 Ga0501033_0037267 3300049570 Bacteria 3640
605 Ga0501034_0111087 3300049571 Bacteria 2731
606 Ga0501034_0341513 3300049571 Bacteria 1427
607 Ga0501036_0004299 3300049572 Bacteria 11505
608 Ga0501037_0026706 3300049573 Bacteria 4266
609 Ga0501037_0438458 3300049573 Bacteria 892
610 Ga0501038_0038044 3300049574 Bacteria 4214
611 Ga0501039_0077071 3300049575 Bacteria 2592
612 Ga0501042_0005025 3300049578 Bacteria 8479
613 Ga0501043_0039655 3300049579 Bacteria 3701
614 Ga0501046_0005257 3300049580 Bacteria 11575
615 Ga0501047_0105967 3300049581 Bacteria 2691
616 Ga0501047_0631859 3300049581 Bacteria 891
617 Ga0501048_0030146 3300049582 Bacteria 3927
618 Ga0501067_0116454 3300049583 Bacteria 1486
619 Ga0501068_0009855 3300049584 Bacteria 5352
620 Ga0501068_0152402 3300049584 Bacteria 1453
621 Ga0501069_0001350 3300049585 Bacteria 12034
622 Ga0501069_0461563 3300049585 Bacteria 755
623 Ga0501070_0037621 3300049586 Bacteria 4039
624 Ga0501072_0010382 3300049588 Bacteria 7095
625 Ga0501073_0020140 3300049589 Bacteria 4810
626 Ga0501074_0051869 3300049590 Bacteria 2960
627 Ga0501075_0269238 3300049591 Bacteria 1298
628 Ga0501076_0133438 3300049592 Bacteria 2015
629 Ga0501076_0218747 3300049592 Bacteria 1557
630 Ga0501077_0229407 3300049593 Bacteria 1180
631 Ga0501077_0316253 3300049593 Bacteria 995
632 Ga0501079_0079976 3300049741 Bacteria 2527
633 Ga0501080_0054849 3300049742 Bacteria 3711
634 Ga0501080_0125267 3300049742 Bacteria 2380
635 Ga0501081_0168768 3300049743 Bacteria 1579
636 Ga0501081_0517845 3300049743 Bacteria 890
637 Ga0501083_0006890 3300049744 Bacteria 8069
638 Ga0501083_0241744 3300049744 Bacteria 1175
639 Ga0501035_0042536 3300049822 Bacteria 4097
640 Ga0501035_0192418 3300049822 Bacteria 1753
641 Ga0501044_0000351 3300049823 Bacteria 57748
642 Ga0501044_0044010 3300049823 Bacteria 4636
643 Ga0501044_0060933 3300049823 Bacteria 3861
644 Ga0501044_0095247 3300049823 Bacteria 3000
645 Ga0501045_0015157 3300049824 Bacteria 5472
646 nmdc:mga03683_115091_c1 3300050489 Bacteria 1192
647 nmdc:mga03683_82428_c1 3300050489 Bacteria 1391
648 nmdc:mga03n38_153133_c1 3300050490 Bacteria 1162
649 nmdc:mga03n38_35879_c1 3300050490 Unclassified 2128
650 nmdc:mga00v17_7422_c1 3300050491 Bacteria 5850
651 nmdc:mga0yw44_128194_c1 3300050492 Bacteria 1640
652 nmdc:mga0yw44_178830_c1 3300050492 Bacteria 1395
653 nmdc:mga0yw44_29367_c1 3300050492 Bacteria 3174
654 nmdc:mga0k408_16723_c1 3300050493 Bacteria 4076
655 nmdc:mga0k408_219466_c1 3300050493 Bacteria 1135
656 nmdc:mga0k408_52791_c1 3300050493 Bacteria 2356
657 nmdc:mga0k408_55915_c1 3300050493 Bacteria 2289
658 nmdc:mga06z11_17129_c1 3300050494 Bacteria 3282
659 nmdc:mga06z11_266530_c1 3300050494 Bacteria 1012
660 nmdc:mga04h51_41525_c1 3300050495 Bacteria 1504
661 nmdc:mga07m45_131525_c1 3300050496 Bacteria 1448
662 nmdc:mga07m45_15014_c1 3300050496 Bacteria 4136
663 nmdc:mga07m45_50257_c1 3300050496 Bacteria 2349
664 nmdc:mga05p37_167193_c1 3300050507 Bacteria 2683
665 nmdc:mga05p37_204996_c1 3300050507 Bacteria 2386
666 nmdc:mga05p37_235615_c1 3300050507 Bacteria 2203
667 nmdc:mga05p37_46700_c1 3300050507 Bacteria 5324
668 nmdc:mga05p37_56359_c1 3300050507 Bacteria 4838
669 nmdc:mga09592_14238_c1 3300050508 Bacteria 6493
670 nmdc:mga09592_149455_c1 3300050508 Unclassified 2015
671 nmdc:mga09592_15016_c1 3300050508 Bacteria 6326
672 nmdc:mga09592_401227_c1 3300050508 Bacteria 1185
673 nmdc:mga09592_41986_c1 3300050508 Bacteria 3848
674 nmdc:mga09592_71956_c1 3300050508 Bacteria 2935
675 nmdc:mga09592_84627_c1 3300050508 Bacteria 2704
676 nmdc:mga0qj67_38641_c1 3300050509 Bacteria 3745
677 nmdc:mga0qj67_603259_c1 3300050509 Bacteria 878
678 nmdc:mga0qj67_97102_c1 3300050509 Bacteria 2372
679 nmdc:mga06r32_31974_c1 3300050510 Bacteria 4946
680 nmdc:mga06r32_466903_c1 3300050510 Bacteria 1241
681 nmdc:mga08y16_179244_c1 3300050511 Bacteria 2200
682 nmdc:mga08y16_220390_c1 3300050511 Bacteria 1964
683 nmdc:mga08y16_43672_c1 3300050511 Bacteria 4698
684 nmdc:mga08y16_439765_c1 3300050511 Bacteria 1331
685 nmdc:mga08y16_606785_c1 3300050511 Bacteria 1103
686 nmdc:mga0n895_15775_c1 3300050512 Bacteria 6906
687 nmdc:mga0n895_1662_c1 3300050512 Bacteria 16791
688 nmdc:mga0n895_16828_c1 3300050512 Bacteria 6720
689 nmdc:mga0n895_223905_c1 3300050512 Bacteria 1909
690 nmdc:mga0n895_249290_c1 3300050512 Bacteria 1802
691 nmdc:mga0n895_354076_c1 3300050512 Bacteria 1487
692 nmdc:mga0rr50_359_c1 3300050513 Bacteria 24852
693 nmdc:mga08x19_1000_c1 3300050514 Bacteria 17670
694 nmdc:mga08x19_121994_c1 3300050514 Unclassified 1748
695 nmdc:mga08x19_1955_c1 3300050514 Bacteria 11416
696 nmdc:mga0a205_18786_c1 3300050515 Bacteria 6507
697 nmdc:mga0a205_2122_c1 3300050515 Bacteria 17397
698 nmdc:mga0sz30_139711_c1 3300050516 Bacteria 1069
699 nmdc:mga0sz30_43351_c1 3300050516 Bacteria 1894
700 nmdc:mga0sz30_8042_c1 3300050516 Bacteria 3973
701 Ga0495601_0057902 3300053077 Bacteria 2455
702 Ga0495601_0271524 3300053077 Bacteria 1106
703 Ga0495601_0302776 3300053077 Bacteria 1041
704 Ga0495601_0317532 3300053077 Bacteria 1014
705 Ga0495612_0001197 3300053078 Bacteria 10690
706 Ga0495655_0006305 3300053083 Bacteria 2148
707 Ga0495655_0023621 3300053083 Bacteria 1420
708 Ga0495595_0021786 3300053084 Bacteria 2804
709 Ga0495619_0001908 3300053085 Bacteria 13887
710 Ga0495619_0034206 3300053085 Bacteria 3303
711 Ga0495619_0042256 3300053085 Bacteria 2984
712 Ga0500643_059613 3300053087 Bacteria 1074
713 Ga0500583_0130495 3300053092 Bacteria 1246
714 Ga0500641_0020006 3300053096 Bacteria 2537
715 Ga0500642_0190851 3300053130 Bacteria 956
716 Ga0500568_0060277 3300053139 Bacteria 1470
717 Ga0500604_0022483 3300053151 Unclassified 1790
718 Ga0501084_0033744 3300054114 Bacteria 4281
719 Ga0501082_0000172 3300060353 Bacteria 55980
720 Ga0501082_0046577 3300060353 Bacteria 3737
721 Ga0501082_0446368 3300060353 Bacteria 1130
722 Ga0501082_0579499 3300060353 Bacteria 982
723 2508726307 2508501050 Bacteria 9633614
724 2774868801 2773857925 Bacteria 6472445
725 2842309089 2842304105 Bacteria 7023636
726 2882462311 2882456835 Bacteria 6863978
727 Ga0495630_0014986
728 JGI24750J21931_1001594
729 JGI24748J21848_1004316
730 JGI25406J46586_10009001
731 JGI25153J46596_10001089
732 JGI25153J46596_10062871
733 rootL2_10223444
734 Ga0065712_10124670
735 Ga0070658_10404807
736 Ga0070690_100137363
737 Ga0070670_100194404
738 Ga0070677_10064979
739 Ga0068869_100065192
740 Ga0068869_100074080
741 Ga0068869_100110587
742 Ga0070666_10207685
743 Ga0070680_100163050
744 Ga0070680_100218907
745 Ga0068868_100050930
746 Ga0068868_100081385
747 Ga0068868_100255565
748 Ga0070660_100118475
749 Ga0070689_100024821
750 Ga0070689_100103959
751 Ga0070689_100356227
752 Ga0070691_10193306
753 Ga0070687_100043768
754 Ga0070661_100213897
755 Ga0070692_10014979
756 Ga0070668_100007486
757 Ga0070668_100031290
758 Ga0070669_100578816
759 Ga0070675_100023649
760 Ga0070675_100068075
761 Ga0070675_100205957
762 Ga0070671_100014076
763 Ga0070671_100482852
764 Ga0070674_100007137
765 Ga0070674_100134351
766 Ga0070674_100222316
767 Ga0070674_100243422
768 Ga0070674_100422091
769 Ga0070673_100189532
770 Ga0070659_100731924
771 Ga0070667_100286333
772 Ga0070667_100497214
773 Ga0070709_10003339
774 Ga0070714_100690059
775 Ga0070713_100024335
776 Ga0070713_100102247
777 Ga0070710_10328803
778 Ga0070700_100003031
779 Ga0070700_100185041
780 Ga0070700_100239475
781 Ga0070700_100299661
782 Ga0070663_100137691
783 Ga0070663_100266571
784 Ga0070678_100461828
785 Ga0070662_100150775
786 Ga0070681_10128263
787 Ga0070681_10150589
788 Ga0068867_100000729
789 Ga0068867_100082922
790 Ga0068867_100090960
791 Ga0068867_100225585
792 Ga0070685_10176092
793 Ga0070698_100164712
794 Ga0070699_100000391
795 Ga0070679_100017610
796 Ga0070684_100186662
797 Ga0070684_100344257
798 Ga0070697_100004723
799 Ga0068853_100096262
800 Ga0068853_100169982
801 Ga0070672_100050797
802 Ga0070672_100578253
803 Ga0070672_100631200
804 Ga0070686_100015684
805 Ga0070686_100148013
806 Ga0070695_100080235
807 Ga0070695_100137387
808 Ga0070696_100122755
809 Ga0070696_100493664
810 Ga0070693_100252237
811 Ga0070665_100566440
812 Ga0070704_100007741
813 Ga0070704_100029132
814 Ga0068855_100235263
815 Ga0068854_100331707
816 Ga0068856_100109714
817 Ga0068856_100565390
818 Ga0068859_100054576
819 Ga0068864_100124602
820 Ga0068864_100482985
821 Ga0068864_100716224
822 Ga0068866_10034773
823 Ga0068866_10289964
824 Ga0068861_100016366
825 Ga0068861_100292760
826 Ga0068861_100360051
827 Ga0068861_100387865
828 Ga0068870_10016189
829 Ga0068870_10132957
830 Ga0068863_100030459
831 Ga0068863_100260979
832 Ga0068863_100477135
833 Ga0068858_100025413
834 Ga0068858_100353561
835 Ga0068860_100445024
836 Ga0068862_100006103
837 Ga0081455_10000079
838 Ga0081455_10000669
839 Ga0081455_10010322
840 Ga0081455_10026170
841 Ga0081455_10117417
842 Ga0081538_10001564
843 Ga0081538_10034499
844 Ga0081540_1001200
845 Ga0081540_1037669
846 Ga0081540_1038195
847 Ga0081539_10003519
848 Ga0075365_10134551
849 Ga0075365_10263522
850 Ga0075368_10004273
851 Ga0075368_10011394
852 Ga0075363_100036753
853 Ga0075363_100065234
854 Ga0075363_100089386
855 Ga0075363_100227758
856 Ga0075364_10085290
857 Ga0070712_100114780
858 Ga0070712_100167800
859 Ga0075362_10039546
860 Ga0075362_10058426
861 Ga0075362_10121980
862 Ga0075362_10124249
863 Ga0075362_10184359
864 Ga0075367_10047344
865 Ga0075369_10015366
866 Ga0075369_10052120
867 Ga0075369_10147286
868 Ga0075366_10045141
869 Ga0075366_10061626
870 Ga0075366_10069832
871 Ga0075366_10357586
872 Ga0075370_10112957
873 Ga0075428_100013458
874 Ga0075428_100017385
875 Ga0075428_100034190
876 Ga0075428_100057483
877 Ga0075428_100085674
878 Ga0075428_100121271
879 Ga0075428_100143791
880 Ga0075428_100143852
881 Ga0075428_100297017
882 Ga0075430_100029308
883 Ga0075430_100030975
884 Ga0075430_100088091
885 Ga0075430_100173382
886 Ga0075430_100181709
887 Ga0075431_100041648
888 Ga0075431_100082276
889 Ga0075431_100215583
890 Ga0075433_10000500
891 Ga0075433_10002047
892 Ga0075434_100004724
893 Ga0075434_100041809
894 Ga0075434_100067032
895 Ga0075434_100323081
896 Ga0075434_100476954
897 Ga0075429_100006156
898 Ga0075429_100036588
899 Ga0075429_100087133
900 Ga0075429_100233892
901 Ga0068865_100049493
902 Ga0075436_100004157
903 Ga0075436_100009718
904 Ga0075436_100215139
905 Ga0075436_100472871
906 Ga0097620_100054576
907 Ga0075435_100000047
908 Ga0075435_100360666
909 Ga0075435_100365217
910 Ga0111539_10050852
911 Ga0111539_10073118
912 Ga0111539_10130461
913 Ga0111539_10159185
914 Ga0111539_10511322
915 Ga0111539_10850732
916 Ga0111539_10948578
917 Ga0105245_10124502
918 Ga0105245_10261087
919 Ga0105247_10013222
920 Ga0105247_10176742
921 Ga0114129_10005299
922 Ga0114129_10025557
923 Ga0114129_10227284
924 Ga0114129_10470677
925 Ga0114129_10547593
926 Ga0114129_10703835
927 Ga0114129_10850636
928 Ga0114129_10991838
929 Ga0105243_10018378
930 Ga0105243_10032485
931 Ga0105243_10118121
932 Ga0105241_10209766
933 Ga0105242_10049576
934 Ga0105242_10338863
935 Ga0105248_10030282
936 Ga0105248_10328007
937 Ga0105248_10805982
938 Ga0105237_10221279
939 Ga0105237_10283674
940 Ga0105238_10248196
941 Ga0105249_10012850
942 Ga0105249_10487889
943 Ga0105239_10338053
944 Ga0105239_10525543
945 Ga0157374_10050289
946 Ga0157378_10006229
947 Ga0157378_10387964
948 Ga0157378_10454820
949 Ga0157378_10525039
950 Ga0163162_10057447
951 Ga0157375_10255626
952 Ga0157375_10731269
953 Ga0163163_10004477
954 Ga0163163_10236282
955 Ga0157380_10071822
956 Ga0157380_10507903
957 Ga0157379_10414145
958 Ga0163161_10089311
959 Ga0213876_10097463
960 Ga0228598_1030771
961 Ga0209758_1007351
962 Ga0207682_10005221
963 Ga0207682_10041628
964 Ga0207710_10116630
965 Ga0207688_10007736
966 Ga0207688_10016430
967 Ga0207680_10173016
968 Ga0207680_10465656
969 Ga0207645_10047944
970 Ga0207643_10002578
971 Ga0207684_10040163
972 Ga0207707_10255729
973 Ga0207707_10321412
974 Ga0207695_10162346
975 Ga0207671_10260081
976 Ga0207693_10020533
977 Ga0207693_10020627
978 Ga0207663_10076430
979 Ga0207660_10077605
980 Ga0207662_10021624
981 Ga0207662_10032133
982 Ga0207662_10034207
983 Ga0207657_10033671
984 Ga0207649_10335565
985 Ga0207646_10061943
986 Ga0207681_10001225
987 Ga0207681_10381899
988 Ga0207687_10398900
989 Ga0207700_10091527
990 Ga0207700_10132622
991 Ga0207700_10206450
992 Ga0207664_10217863
993 Ga0207664_10312179
994 Ga0207644_10136158
995 Ga0207644_10195721
996 Ga0207706_10391995
997 Ga0207686_10053597
998 Ga0207709_10006297
999 Ga0207709_10069480
1000 Ga0207670_10037951
1001 Ga0207670_10085558
1002 Ga0207670_10149284
1003 Ga0207669_10023689
1004 Ga0207669_10025020
1005 Ga0207669_10439231
1006 Ga0207704_10003866
1007 Ga0207704_10138117
1008 Ga0207691_10026641
1009 Ga0207691_10077916
1010 Ga0207691_10126386
1011 Ga0207691_10565177
1012 Ga0207711_10049506
1013 Ga0207711_10120550
1014 Ga0207689_10124654
1015 Ga0207689_10145616
1016 Ga0207689_10355100
1017 Ga0207679_10096868
1018 Ga0207679_10206821
1019 Ga0207651_10610284
1020 Ga0207712_10161109
1021 Ga0207712_10491247
1022 Ga0207668_10358101
1023 Ga0207640_10018223
1024 Ga0207658_10291404
1025 Ga0207658_10356028
1026 Ga0207703_10487900
1027 Ga0207639_10022893
1028 Ga0207678_10017701
1029 Ga0207678_10370292
1030 Ga0207708_10001677
1031 Ga0207708_10011303
1032 Ga0207708_10102139
1033 Ga0207708_10366252
1034 Ga0207702_10334501
1035 Ga0207702_10614104
1036 Ga0207641_10227213
1037 Ga0207641_10252977
1038 Ga0207641_10364848
1039 Ga0207641_10656547
1040 Ga0207648_10001462
1041 Ga0207648_10006412
1042 Ga0207648_10049976
1043 Ga0207648_10169093
1044 Ga0207676_10447928
1045 Ga0207676_10607068
1046 Ga0207674_10060428
1047 Ga0207674_10127787
1048 Ga0207675_100014551
1049 Ga0207675_100033231
1050 Ga0207675_100082824
1051 Ga0207683_10041083
1052 Ga0207683_10220328
1053 Ga0207698_10537209
1054 Ga0209971_1005793
1055 Ga0209813_10046573
1056 Ga0207428_10177875
1057 Ga0207428_10275532
1058 Ga0268266_10073587
1059 Ga0268266_10588284
1060 Ga0268265_10002607
1061 Ga0268265_10312770
1062 Ga0268264_10176753
1063 Ga0268264_11025560
1064 Ga0307511_10000003
1065 Ga0265760_10021775
1066 Ga0265332_10077548
1067 Ga0265325_10001522
1068 Ga0265325_10106415
1069 Ga0265340_10025076
1070 Ga0265340_10029194
1071 Ga0265339_10000034
1072 Ga0265339_10062246
1073 Ga0265331_10020733
1074 Ga0265316_10246469
1075 Ga0307513_10278337
1076 Ga0265313_10000185
1077 Ga0265314_10126975
1078 Ga0265342_10078213
1079 Ga0265342_10215222
1080 Ga0307410_10467996
1081 Ga0307407_10053353
1082 Ga0307409_100180079
1083 Ga0307409_100263801
1084 Ga0307409_100419881
1085 Ga0307416_100050434
1086 Ga0307416_100313316
1087 Ga0307414_10168789
1088 Ga0307414_10295301
1089 Ga0307411_10212638
1090 Ga0373930_0003308
1091 Ga0373959_0037738
1092 Ga0373926_0000320
1093 Ga0373934_0008489
1094 Ga0373934_0021385
1095 Ga0373944_0005339
1096 Ga0373944_0035841
1097 Ga0373932_0005872
1098 Ga0373936_0016094
1099 Ga0373936_0093480
1100 Ga0373939_0007068
1101 Ga0373941_0004148
1102 Ga0373945_0001387
1103 Ga0373945_0010334
1104 Ga0373945_0031951
1105 Ga0373954_0076171
1106 Ga0373956_0000703
1107 Ga0373960_0043364
1108 Ga0373943_0011764
1109 Ga0373943_0047211
1110 Ga0373943_0125057
1111 Ga0373943_0225668
1112 Ga0373946_0003712
1113 Ga0373946_0011096
1114 Ga0373946_0022596
1115 Ga0373955_0021741
1116 Ga0373961_0034648
1117 Ga0373961_0088169
1118 Ga0373924_0140406
1119 Ga0373924_0168755
1120 Ga0373931_0003181
1121 Ga0373931_0029840
1122 Ga0373935_0002678
1123 Ga0373935_0008932
1124 Ga0373935_0023689
1125 Ga0373935_0108049
1126 Ga0373935_0148903
1127 Ga0373935_0268800
1128 Ga0373935_0340102
1129 Ga0373927_0005846
1130 Ga0373927_0006828
1131 Ga0373927_0108373
1132 Ga0373933_0000538
1133 Ga0373933_0124167
1134 Ga0373933_0519005
1135 Ga0373947_0009169
1136 Ga0373947_0031657
1137 Ga0373947_0032720
1138 Ga0373947_0053172
1139 Ga0373947_0250483
1140 Ga0373937_0061855
1141 Ga0373925_0020513
1142 Ga0373925_0032392
1143 Ga0373925_0245661
1144 Ga0373925_0370615
1145 Ga0395899_0144836
1146 Ga0395899_0152530
1147 Ga0395900_0029817
1148 Ga0395900_0154376
1149 Ga0395900_0158746
1150 Ga0395898_0133314
1151 Ga0395898_0163314
1152 Ga0395905_0164090
1153 Ga0436364_0952959
1154 Ga0395901_0232723
1155 Ga0436365_1645076
1156 Ga0436361_0019210
1157 Ga0451853_0973126
1158 Ga0439435_0015231
1159 Ga0450916_007539
1160 Ga0466965_0093220
1161 Ga0466964_0163644
1162 Ga0466957_0144861
1163 Ga0466957_0273485
1164 Ga0466959_0291671
1165 Ga0451576_0102670
1166 Ga0495592_0019945
1167 Ga0495592_0020812
1168 Ga0495592_0050654
1169 Ga0495592_0095509
1170 Ga0495603_0006114
1171 Ga0495629_0026963
1172 Ga0495629_0056015
1173 Ga0495629_0364721
1174 Ga0495638_0052281
1175 Ga0495638_0053530
1176 Ga0495651_0002284
1177 Ga0495653_0032496
1178 Ga0495653_0042057
1179 Ga0495580_0001270
1180 Ga0495580_0032962
1181 Ga0495582_0389835
1182 Ga0495605_0030440
1183 Ga0495605_0185421
1184 Ga0495639_0005284
1185 Ga0495639_0064851
1186 Ga0495639_0228987
1187 Ga0495662_0062753
1188 Ga0495664_0010522
1189 Ga0495584_0033810
1190 Ga0495584_0047356
1191 Ga0495584_0079908
1192 Ga0495584_0138776
1193 Ga0495585_0086941
1194 Ga0495594_0011329
1195 Ga0495594_0029809
1196 Ga0495607_0119695
1197 Ga0495608_0020532
1198 Ga0495608_0070161
1199 Ga0495608_0264755
1200 Ga0495618_0005264
1201 Ga0495618_0016181
1202 Ga0495618_0055307
1203 Ga0495618_0227314
1204 Ga0495628_0002688
1205 Ga0495628_0076461
1206 Ga0495628_0171215
1207 Ga0495628_0200317
1208 Ga0495630_0002130
1209 Ga0495630_0023086
1210 Ga0495630_0255288
1211 Ga0495630_0374094
1212 Ga0495630_0376816
1213 Ga0495637_0056041
1214 Ga0495666_0084811
1215 Ga0495642_0153839
1216 Ga0495652_0003451
1217 Ga0495652_0021923
1218 Ga0495665_0026563
1219 Ga0495665_0033757
1220 Ga0495665_0038131
1221 Ga0495665_0123740
1222 Ga0495640_0061675
1223 Ga0495640_0095770
1224 Ga0495586_0003130
1225 Ga0495587_0162459
1226 Ga0495598_0044010
1227 Ga0495645_0000432
1228 Ga0495645_0024689
1229 Ga0495633_0039898
1230 Ga0495667_0101295
1231 Ga0495667_0159993
1232 Ga0495656_0124705
1233 Ga0495634_0005514
1234 Ga0495634_0147848
1235 Ga0495634_0162649
1236 Ga0495635_0004265
1237 Ga0495635_0013269
1238 Ga0495635_0215638
1239 Ga0495588_0029878
1240 Ga0495588_0088583
1241 Ga0495599_0001640
1242 Ga0495599_0238223
1243 Ga0495599_0266345
1244 Ga0495646_0013702
1245 Ga0495647_0001973
1246 Ga0495658_0006925
1247 Ga0495658_0026587
1248 Ga0495658_0084164
1249 Ga0495669_0143444
1250 Ga0495613_0051377
1251 Ga0495613_0072122
1252 Ga0495613_0168084
1253 Ga0495624_0000746
1254 Ga0495624_0199949
1255 Ga0495624_0254841
1256 Ga0495671_0138347
1257 Ga0495589_0045459
1258 Ga0495600_0039183
1259 Ga0495600_0135009
1260 Ga0495581_0022190
1261 Ga0495581_0046524
1262 Ga0495581_0263582
1263 Ga0495604_0108589
1264 Ga0495604_0157328
1265 Ga0495636_0136929
1266 Ga0495674_0011073
1267 Ga0495674_0061722
1268 Ga0495674_0105392
1269 Ga0495672_0118114
1270 Ga0495676_0054485
1271 Ga0495676_0054618
1272 Ga0495676_0086728
1273 Ga0495676_0211220
1274 Ga0495680_0058766
1275 Ga0495675_0086292
1276 Ga0495675_0255968
1277 Ga0495684_0012041
1278 Ga0495684_0022050
1279 Ga0495684_0079921
1280 Ga0495684_0188582
1281 Ga0495593_0008765
1282 Ga0495593_0133348
1283 Ga0495593_0142990
1284 Ga0495602_0265162
1285 Ga0495614_0070056
1286 Ga0495614_0140242
1287 Ga0495626_0154136
1288 Ga0496100_0089017
1289 Ga0496103_0022327
1290 Ga0496104_0000253
1291 Ga0496104_0000778
1292 Ga0496104_0020957
1293 Ga0496104_0027509
1294 Ga0496105_0016531
1295 Ga0496105_0039740
1296 Ga0496105_0043953
1297 Ga0496106_0009665
1298 Ga0496106_0505874
1299 Ga0496107_0081277
1300 Ga0496107_0102218
1301 Ga0496108_0003559
1302 Ga0496108_0124743
1303 Ga0496108_0170139
1304 Ga0496109_0001664
1305 Ga0496109_0025511
1306 Ga0496109_0623413
1307 Ga0496110_0008663
1308 Ga0496110_0055616
1309 Ga0496110_0118986
1310 Ga0496110_0179216
1311 Ga0496111_0038752
1312 Ga0496111_0104451
1313 Ga0496111_0252739
1314 Ga0496112_0124243
1315 Ga0496112_0285213
1316 Ga0496112_0292090
1317 Ga0496112_0510319
1318 Ga0496112_0542443
1319 Ga0496113_0001475
1320 Ga0496113_0016293
1321 Ga0496114_0007386
1322 Ga0496114_0148706
1323 Ga0496114_0207286
1324 Ga0496114_0351057
1325 Ga0496114_0474194
1326 Ga0496115_0015056
1327 Ga0496115_0094875
1328 Ga0496115_0358001
1329 Ga0501032_0017659
1330 Ga0501033_0037267
1331 Ga0501034_0111087
1332 Ga0501034_0341513
1333 Ga0501036_0004299
1334 Ga0501037_0026706
1335 Ga0501037_0438458
1336 Ga0501038_0038044
1337 Ga0501039_0077071
1338 Ga0501042_0005025
1339 Ga0501043_0039655
1340 Ga0501046_0005257
1341 Ga0501047_0105967
1342 Ga0501047_0631859
1343 Ga0501048_0030146
1344 Ga0501067_0116454
1345 Ga0501068_0009855
1346 Ga0501068_0152402
1347 Ga0501069_0001350
1348 Ga0501069_0461563
1349 Ga0501070_0037621
1350 Ga0501072_0010382
1351 Ga0501073_0020140
1352 Ga0501074_0051869
1353 Ga0501075_0269238
1354 Ga0501076_0133438
1355 Ga0501076_0218747
1356 Ga0501077_0229407
1357 Ga0501077_0316253
1358 Ga0501079_0079976
1359 Ga0501080_0054849
1360 Ga0501080_0125267
1361 Ga0501081_0168768
1362 Ga0501081_0517845
1363 Ga0501083_0006890
1364 Ga0501083_0241744
1365 Ga0501035_0042536
1366 Ga0501035_0192418
1367 Ga0501044_0000351
1368 Ga0501044_0044010
1369 Ga0501044_0060933
1370 Ga0501044_0095247
1371 Ga0501045_0015157
1372 nmdc:mga03683_115091_c1
1373 nmdc:mga03683_82428_c1
1374 nmdc:mga03n38_153133_c1
1375 nmdc:mga03n38_35879_c1
1376 nmdc:mga00v17_7422_c1
1377 nmdc:mga0yw44_128194_c1
1378 nmdc:mga0yw44_178830_c1
1379 nmdc:mga0yw44_29367_c1
1380 nmdc:mga0k408_16723_c1
1381 nmdc:mga0k408_219466_c1
1382 nmdc:mga0k408_52791_c1
1383 nmdc:mga0k408_55915_c1
1384 nmdc:mga06z11_17129_c1
1385 nmdc:mga06z11_266530_c1
1386 nmdc:mga04h51_41525_c1
1387 nmdc:mga07m45_131525_c1
1388 nmdc:mga07m45_15014_c1
1389 nmdc:mga07m45_50257_c1
1390 nmdc:mga05p37_167193_c1
1391 nmdc:mga05p37_204996_c1
1392 nmdc:mga05p37_235615_c1
1393 nmdc:mga05p37_46700_c1
1394 nmdc:mga05p37_56359_c1
1395 nmdc:mga09592_14238_c1
1396 nmdc:mga09592_149455_c1
1397 nmdc:mga09592_15016_c1
1398 nmdc:mga09592_401227_c1
1399 nmdc:mga09592_41986_c1
1400 nmdc:mga09592_71956_c1
1401 nmdc:mga09592_84627_c1
1402 nmdc:mga0qj67_38641_c1
1403 nmdc:mga0qj67_603259_c1
1404 nmdc:mga0qj67_97102_c1
1405 nmdc:mga06r32_31974_c1
1406 nmdc:mga06r32_466903_c1
1407 nmdc:mga08y16_179244_c1
1408 nmdc:mga08y16_220390_c1
1409 nmdc:mga08y16_43672_c1
1410 nmdc:mga08y16_439765_c1
1411 nmdc:mga08y16_606785_c1
1412 nmdc:mga0n895_15775_c1
1413 nmdc:mga0n895_1662_c1
1414 nmdc:mga0n895_16828_c1
1415 nmdc:mga0n895_223905_c1
1416 nmdc:mga0n895_249290_c1
1417 nmdc:mga0n895_354076_c1
1418 nmdc:mga0rr50_359_c1
1419 nmdc:mga08x19_1000_c1
1420 nmdc:mga08x19_121994_c1
1421 nmdc:mga08x19_1955_c1
1422 nmdc:mga0a205_18786_c1
1423 nmdc:mga0a205_2122_c1
1424 nmdc:mga0sz30_139711_c1
1425 nmdc:mga0sz30_43351_c1
1426 nmdc:mga0sz30_8042_c1
1427 Ga0495601_0057902
1428 Ga0495601_0271524
1429 Ga0495601_0302776
1430 Ga0495601_0317532
1431 Ga0495612_0001197
1432 Ga0495655_0006305
1433 Ga0495655_0023621
1434 Ga0495595_0021786
1435 Ga0495619_0001908
1436 Ga0495619_0034206
1437 Ga0495619_0042256
1438 Ga0500643_059613
1439 Ga0500583_0130495
1440 Ga0500641_0020006
1441 Ga0500642_0190851
1442 Ga0500568_0060277
1443 Ga0500604_0022483
1444 Ga0501084_0033744
1445 Ga0501082_0000172
1446 Ga0501082_0046577
1447 Ga0501082_0446368
1448 Ga0501082_0579499
1449 2508726307
1450 2774868801
1451 2842309089
1452 2882462311

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

65

285

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qz6-assembly1.cif.gz_A the crystal structure of hpch/hpai aldolase from desulfitobacterium hafniense dcb-2 0.9359 12 261
2v5j-assembly1.cif.gz_B apo class ii aldolase hpch 0.9097 3 257
1dxe-assembly1.cif.gz_A 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli 0.9069 5 262
4b5w-assembly1.cif.gz_C crystal structures of divalent metal dependent pyruvate aldolase r70a mutant, hpai, in complex with pyruvate 0.9039 7 257
1dxe-assembly1.cif.gz_A 2-dehydro-3-deoxy-galactarate aldolase from escherichia coli 0.9035 5 262
ID Description Score Start End Superfamily
3qz6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9326 12 261 3.20.20.60
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9081 5 259 3.20.20.60
1dxfA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9047 5 259 3.20.20.60
3qz6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9043 12 261 3.20.20.60
af_P76469_1_267_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9001 6 262 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A1Q7BSF0-F1-model_v4 Aldolase 0.9987 1 262 GO:0005737
GO:0016832
AF-A0A537V0N0-F1-model_v4 Aldolase 0.9982 24 262 GO:0005737
GO:0016832
AF-A0A1Q7BSF0-F1-model_v4 Aldolase 0.9949 1 262 GO:0005737
GO:0016832
AF-A0A158KP45-F1-model_v4 2-dehydro-3-deoxyglucarate aldolase 0.9926 1 260 GO:0005737
GO:0016832
AF-A0A536SMX8-F1-model_v4 Aldolase 0.9921 3 215 GO:0005737
GO:0016832

Map