F477699
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 726 | 398 | 1452 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300046660|Ga0495625_0147625|Ga0495625_0147625_208_669 |
| Length | 153 |
| Sequence | VYPELIENQRTATMSCTGSAVRPLNIGEAAKASGVTAKMIRHYESIGLVEAARRTDAGYRLYSQQDVQVLQFIHRARALGFSLDRIGSLLALWQDKQRASSDVRALARSHIDELNQKIAELESMRRTLERLADSCHGDGRSDCPILDDLAHCE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 18 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 23 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 34 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 35 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 36 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 37 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 38 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 39 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 40 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 41 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 64 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 66 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 70 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 71 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 109 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 114 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 115 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 116 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 117 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 118 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 119 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 120 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 121 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 122 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 123 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 124 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 126 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 127 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 128 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 129 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 130 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 131 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 132 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 133 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 134 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 135 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 136 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 137 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 138 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 139 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 140 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 141 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 142 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 143 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 144 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 145 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 146 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 147 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 148 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 149 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 150 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 151 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 152 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 153 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 154 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 155 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 156 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 157 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 158 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 159 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 160 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 161 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 162 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 163 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 164 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 165 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 166 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 167 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 241 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 242 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 243 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 244 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 245 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 246 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 247 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 248 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 249 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 250 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 251 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 252 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 253 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 258 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 259 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 260 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 261 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 262 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 263 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 264 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 265 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 266 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 267 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 268 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 269 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 270 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 271 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 272 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 273 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 274 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 275 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 276 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 277 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 278 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 279 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 280 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 281 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 282 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 283 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 284 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 285 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 286 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 287 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 288 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 289 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 290 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 291 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 292 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 293 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 294 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 295 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 296 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 297 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 298 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 299 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 300 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 301 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 302 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 303 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 304 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 305 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 306 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 307 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 308 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 309 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 310 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 311 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 312 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 313 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 314 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 315 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 316 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 317 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 318 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 319 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 320 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 321 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 322 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 323 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 324 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 325 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 326 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 327 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 328 | 2728369097 | Stutzerimonas balearica st101 | Isolate | Unclassified |
| 329 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 330 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 331 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 332 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 333 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 334 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 335 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 336 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 337 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 338 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 339 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 340 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 341 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 342 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 343 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 344 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 345 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 346 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 347 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 348 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 349 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 350 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 351 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 352 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 353 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 354 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 355 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 356 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 357 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 358 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 359 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 360 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 361 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 362 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 363 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 364 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 365 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 366 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 367 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 368 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 369 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 370 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 371 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 372 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 373 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 374 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 375 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 376 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 377 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 378 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 379 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 380 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 381 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 382 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 383 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 384 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 385 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 386 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 387 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 388 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 389 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 390 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 391 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 392 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 393 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 394 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 395 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 396 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 397 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 398 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.99 |
| Metatranscriptomes | 0 |
| Isolates | 19.01 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.28 |
| Bulb | 0 |
| Endosphere | 5.51 |
| Nodule | 1.52 |
| Rhizoplane | 8.26 |
| Rhizosphere | 72.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.41 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495625_0147625 | 3300046660 | Bacteria | 1582 |
| 2 | MRS2a_Contig_727 | 2124908027 | Bacteria | 23550 |
| 3 | SwRhRL2b_contig_1615826 | 2162886007 | Bacteria | 1639 |
| 4 | JGI25162J39368_1000195 | 3300002737 | Bacteria | 63625 |
| 5 | JGI25154J39366_1012163 | 3300002738 | Bacteria | 959 |
| 6 | JGI25163J39215_1000579 | 3300002771 | Bacteria | 10320 |
| 7 | JGI25164J39214_1000225 | 3300002772 | Bacteria | 44028 |
| 8 | JGI25165J46597_1000291 | 3300003214 | Bacteria | 63625 |
| 9 | rootL2_10071690 | 3300003322 | Bacteria | 2275 |
| 10 | rootL2_10105701 | 3300003322 | Bacteria | 1612 |
| 11 | Ga0055538_1000267 | 3300003751 | Bacteria | 27438 |
| 12 | Ga0055539_1000295 | 3300003752 | Bacteria | 27433 |
| 13 | Ga0055533_1000065 | 3300003756 | Bacteria | 166911 |
| 14 | Ga0055532_1000322 | 3300003758 | Bacteria | 27406 |
| 15 | Ga0055525_1000083 | 3300003759 | Bacteria | 157373 |
| 16 | Ga0055535_1004161 | 3300003761 | Bacteria | 3667 |
| 17 | Ga0055529_1000462 | 3300003763 | Bacteria | 39388 |
| 18 | Ga0055530_10000689 | 3300003791 | Bacteria | 28611 |
| 19 | Ga0055540_1000535 | 3300003792 | Bacteria | 28611 |
| 20 | Ga0055541_1000040 | 3300003841 | Bacteria | 166911 |
| 21 | Ga0065714_10000168 | 3300005288 | Bacteria | 8218 |
| 22 | Ga0065714_10002357 | 3300005288 | Bacteria | 27822 |
| 23 | Ga0065714_10175277 | 3300005288 | Bacteria | 983 |
| 24 | Ga0065714_10503449 | 3300005288 | Bacteria | 522 |
| 25 | Ga0065704_10070617 | 3300005289 | Bacteria | 19040 |
| 26 | Ga0065704_10117922 | 3300005289 | Bacteria | 1826 |
| 27 | Ga0065704_10258281 | 3300005289 | Bacteria | 972 |
| 28 | Ga0065712_10008795 | 3300005290 | Bacteria | 2179 |
| 29 | Ga0065715_10024237 | 3300005293 | Bacteria | 1282 |
| 30 | Ga0065715_10689073 | 3300005293 | Bacteria | 659 |
| 31 | Ga0070670_100001525 | 3300005331 | Bacteria | 18646 |
| 32 | Ga0070668_100143273 | 3300005347 | Bacteria | 1927 |
| 33 | Ga0070669_100293682 | 3300005353 | Bacteria | 1305 |
| 34 | Ga0070674_100151358 | 3300005356 | Bacteria | 1751 |
| 35 | Ga0070673_100533701 | 3300005364 | Bacteria | 1064 |
| 36 | Ga0070667_100076790 | 3300005367 | Bacteria | 2852 |
| 37 | Ga0070663_100136478 | 3300005455 | Bacteria | 1868 |
| 38 | Ga0070706_100215203 | 3300005467 | Bacteria | 1794 |
| 39 | Ga0070706_101719335 | 3300005467 | Bacteria | 571 |
| 40 | Ga0070697_101989901 | 3300005536 | Bacteria | 520 |
| 41 | Ga0075368_10304288 | 3300006042 | Bacteria | 688 |
| 42 | Ga0075364_10043351 | 3300006051 | Bacteria | 2925 |
| 43 | Ga0075364_10267456 | 3300006051 | Bacteria | 1162 |
| 44 | Ga0075364_10725105 | 3300006051 | Bacteria | 678 |
| 45 | Ga0075432_10037846 | 3300006058 | Bacteria | 1680 |
| 46 | Ga0075362_10054820 | 3300006177 | Bacteria | 1793 |
| 47 | Ga0075436_100302451 | 3300006914 | Bacteria | 1147 |
| 48 | Ga0099823_1035910 | 3300006944 | Bacteria | 3838 |
| 49 | Ga0079104_1000580 | 3300006946 | Bacteria | 36883 |
| 50 | Ga0079104_1010442 | 3300006946 | Bacteria | 3061 |
| 51 | Ga0099826_10003389 | 3300006948 | Bacteria | 10787 |
| 52 | Ga0105251_10000400 | 3300009011 | Bacteria | 42392 |
| 53 | Ga0105251_10007164 | 3300009011 | Bacteria | 6933 |
| 54 | Ga0105251_10011432 | 3300009011 | Bacteria | 5074 |
| 55 | Ga0105251_10085373 | 3300009011 | Bacteria | 1455 |
| 56 | Ga0105251_10105636 | 3300009011 | Bacteria | 1286 |
| 57 | Ga0105251_10164698 | 3300009011 | Bacteria | 999 |
| 58 | Ga0105244_10000571 | 3300009036 | Bacteria | 33026 |
| 59 | Ga0105244_10003191 | 3300009036 | Bacteria | 11894 |
| 60 | Ga0105244_10008931 | 3300009036 | Bacteria | 6206 |
| 61 | Ga0105244_10011441 | 3300009036 | Bacteria | 5321 |
| 62 | Ga0105244_10014876 | 3300009036 | Bacteria | 4480 |
| 63 | Ga0105244_10017095 | 3300009036 | Bacteria | 4110 |
| 64 | Ga0105244_10025821 | 3300009036 | Bacteria | 3186 |
| 65 | Ga0105244_10029972 | 3300009036 | Bacteria | 2900 |
| 66 | Ga0105244_10037831 | 3300009036 | Bacteria | 2519 |
| 67 | Ga0105244_10104872 | 3300009036 | Bacteria | 1380 |
| 68 | Ga0105244_10203916 | 3300009036 | Bacteria | 932 |
| 69 | Ga0105244_10220533 | 3300009036 | Bacteria | 889 |
| 70 | Ga0105244_10447917 | 3300009036 | Bacteria | 594 |
| 71 | Ga0105250_10077131 | 3300009092 | Bacteria | 1349 |
| 72 | Ga0105250_10082724 | 3300009092 | Bacteria | 1302 |
| 73 | Ga0105250_10099084 | 3300009092 | Bacteria | 1189 |
| 74 | Ga0105245_10276311 | 3300009098 | Bacteria | 1640 |
| 75 | Ga0105243_10000225 | 3300009148 | Bacteria | 65179 |
| 76 | Ga0105243_10007889 | 3300009148 | Bacteria | 8176 |
| 77 | Ga0105243_10113506 | 3300009148 | Bacteria | 2272 |
| 78 | Ga0105243_10228153 | 3300009148 | Bacteria | 1650 |
| 79 | Ga0105241_11308807 | 3300009174 | Bacteria | 690 |
| 80 | Ga0105242_10159756 | 3300009176 | Bacteria | 1971 |
| 81 | Ga0105242_11218609 | 3300009176 | Bacteria | 773 |
| 82 | Ga0105248_10003881 | 3300009177 | Bacteria | 16523 |
| 83 | Ga0105238_10969377 | 3300009551 | Bacteria | 871 |
| 84 | Ga0105249_10009810 | 3300009553 | Bacteria | 8392 |
| 85 | Ga0105246_11053400 | 3300011119 | Bacteria | 740 |
| 86 | Ga0157345_1027256 | 3300012498 | Bacteria | 620 |
| 87 | Ga0157373_10000305 | 3300013100 | Bacteria | 39678 |
| 88 | Ga0157373_10012441 | 3300013100 | Bacteria | 6256 |
| 89 | Ga0157373_10033274 | 3300013100 | Bacteria | 3710 |
| 90 | Ga0157373_10237438 | 3300013100 | Bacteria | 1288 |
| 91 | Ga0157371_10000648 | 3300013102 | Bacteria | 41246 |
| 92 | Ga0157371_10003311 | 3300013102 | Bacteria | 14734 |
| 93 | Ga0157371_10003379 | 3300013102 | Bacteria | 14517 |
| 94 | Ga0157371_10028415 | 3300013102 | Bacteria | 4050 |
| 95 | Ga0157370_10005104 | 3300013104 | Bacteria | 14808 |
| 96 | Ga0157370_10055914 | 3300013104 | Bacteria | 3757 |
| 97 | Ga0157370_10061179 | 3300013104 | Bacteria | 3574 |
| 98 | Ga0157370_10480057 | 3300013104 | Bacteria | 1142 |
| 99 | Ga0157369_10001225 | 3300013105 | Bacteria | 31970 |
| 100 | Ga0157369_10004980 | 3300013105 | Bacteria | 15564 |
| 101 | Ga0157369_10006448 | 3300013105 | Bacteria | 13603 |
| 102 | Ga0157369_10033106 | 3300013105 | Bacteria | 5682 |
| 103 | Ga0157369_10091235 | 3300013105 | Bacteria | 3252 |
| 104 | Ga0157374_10754818 | 3300013296 | Bacteria | 988 |
| 105 | Ga0157378_10773875 | 3300013297 | Bacteria | 984 |
| 106 | Ga0163162_10007954 | 3300013306 | Bacteria | 10339 |
| 107 | Ga0163162_10067177 | 3300013306 | Bacteria | 3635 |
| 108 | Ga0157372_10003237 | 3300013307 | Bacteria | 17594 |
| 109 | Ga0157372_10584345 | 3300013307 | Bacteria | 1302 |
| 110 | Ga0157375_10001163 | 3300013308 | Bacteria | 22743 |
| 111 | Ga0157375_10004898 | 3300013308 | Bacteria | 11636 |
| 112 | Ga0157375_10234817 | 3300013308 | Bacteria | 1993 |
| 113 | Ga0157375_11769486 | 3300013308 | Bacteria | 732 |
| 114 | Ga0163163_11878591 | 3300014325 | Bacteria | 659 |
| 115 | Ga0182008_10019749 | 3300014497 | Bacteria | 3474 |
| 116 | Ga0157379_11548530 | 3300014968 | Bacteria | 646 |
| 117 | Ga0182006_1001648 | 3300015261 | Bacteria | 13162 |
| 118 | Ga0182006_1001723 | 3300015261 | Bacteria | 12725 |
| 119 | Ga0182006_1021586 | 3300015261 | Bacteria | 2683 |
| 120 | Ga0182006_1060333 | 3300015261 | Bacteria | 1433 |
| 121 | Ga0182006_1082202 | 3300015261 | Bacteria | 1173 |
| 122 | Ga0182007_10000375 | 3300015262 | Bacteria | 28103 |
| 123 | Ga0182005_1001375 | 3300015265 | Bacteria | 9907 |
| 124 | Ga0182005_1265821 | 3300015265 | Bacteria | 535 |
| 125 | Ga0163161_10025875 | 3300017792 | Bacteria | 4155 |
| 126 | Ga0163161_10052410 | 3300017792 | Bacteria | 2957 |
| 127 | Ga0163161_10239656 | 3300017792 | Bacteria | 1410 |
| 128 | Ga0163161_10491405 | 3300017792 | Bacteria | 998 |
| 129 | Ga0163161_10492032 | 3300017792 | Bacteria | 997 |
| 130 | Ga0163161_11455665 | 3300017792 | Bacteria | 600 |
| 131 | Ga0213876_10426534 | 3300021384 | Bacteria | 705 |
| 132 | Ga0213875_10275436 | 3300021388 | Unclassified | 794 |
| 133 | Ga0209435_101590 | 3300025206 | Bacteria | 2803 |
| 134 | Ga0209760_100031 | 3300025207 | Bacteria | 141487 |
| 135 | Ga0209784_100028 | 3300025224 | Bacteria | 357464 |
| 136 | Ga0209566_100028 | 3300025225 | Bacteria | 357464 |
| 137 | Ga0209674_100047 | 3300025226 | Bacteria | 357464 |
| 138 | Ga0209147_100031 | 3300025229 | Bacteria | 357464 |
| 139 | Ga0209563_100050 | 3300025230 | Bacteria | 357464 |
| 140 | Ga0207427_100067 | 3300025231 | Bacteria | 164839 |
| 141 | Ga0209437_100016 | 3300025233 | Bacteria | 710118 |
| 142 | Ga0209258_100170 | 3300025242 | Bacteria | 145191 |
| 143 | Ga0209646_1000444 | 3300025246 | Bacteria | 22148 |
| 144 | Ga0209677_100029 | 3300025253 | Bacteria | 357464 |
| 145 | Ga0209759_1020143 | 3300025256 | Bacteria | 1559 |
| 146 | Ga0209233_1000156 | 3300025261 | Bacteria | 164839 |
| 147 | Ga0209455_1000121 | 3300025272 | Bacteria | 173350 |
| 148 | Ga0209676_1000426 | 3300025292 | Bacteria | 73938 |
| 149 | Ga0209676_1000534 | 3300025292 | Bacteria | 59125 |
| 150 | Ga0209050_1001272 | 3300025298 | Bacteria | 28964 |
| 151 | Ga0209051_1000206 | 3300025303 | Bacteria | 104064 |
| 152 | Ga0209257_1013385 | 3300025304 | Bacteria | 3657 |
| 153 | Ga0207696_1034388 | 3300025711 | Bacteria | 1514 |
| 154 | Ga0207696_1047951 | 3300025711 | Bacteria | 1230 |
| 155 | Ga0207696_1049995 | 3300025711 | Bacteria | 1198 |
| 156 | Ga0207696_1075538 | 3300025711 | Bacteria | 934 |
| 157 | Ga0207655_1000014 | 3300025728 | Bacteria | 607124 |
| 158 | Ga0207655_1000532 | 3300025728 | Bacteria | 48217 |
| 159 | Ga0207655_1000715 | 3300025728 | Bacteria | 37724 |
| 160 | Ga0207655_1002812 | 3300025728 | Bacteria | 13497 |
| 161 | Ga0207655_1003033 | 3300025728 | Bacteria | 12823 |
| 162 | Ga0207655_1005774 | 3300025728 | Bacteria | 8339 |
| 163 | Ga0207655_1009120 | 3300025728 | Bacteria | 6205 |
| 164 | Ga0207655_1017777 | 3300025728 | Bacteria | 3818 |
| 165 | Ga0207655_1027401 | 3300025728 | Bacteria | 2715 |
| 166 | Ga0207655_1057534 | 3300025728 | Bacteria | 1526 |
| 167 | Ga0207655_1093252 | 3300025728 | Bacteria | 1055 |
| 168 | Ga0207713_1000540 | 3300025735 | Bacteria | 37977 |
| 169 | Ga0207713_1001991 | 3300025735 | Bacteria | 15370 |
| 170 | Ga0207713_1004877 | 3300025735 | Bacteria | 8590 |
| 171 | Ga0207713_1018289 | 3300025735 | Bacteria | 3475 |
| 172 | Ga0207713_1029199 | 3300025735 | Bacteria | 2475 |
| 173 | Ga0207713_1076410 | 3300025735 | Bacteria | 1219 |
| 174 | Ga0207713_1076906 | 3300025735 | Bacteria | 1213 |
| 175 | Ga0207713_1076924 | 3300025735 | Bacteria | 1213 |
| 176 | Ga0207680_10142542 | 3300025903 | Bacteria | 1590 |
| 177 | Ga0207681_10301372 | 3300025923 | Bacteria | 1268 |
| 178 | Ga0207681_10998270 | 3300025923 | Bacteria | 702 |
| 179 | Ga0207694_10664415 | 3300025924 | Bacteria | 878 |
| 180 | Ga0207650_10000073 | 3300025925 | Bacteria | 137141 |
| 181 | Ga0207687_10451196 | 3300025927 | Bacteria | 1066 |
| 182 | Ga0207706_10736066 | 3300025933 | Bacteria | 841 |
| 183 | Ga0207686_10073608 | 3300025934 | Bacteria | 2205 |
| 184 | Ga0207709_10000366 | 3300025935 | Bacteria | 45478 |
| 185 | Ga0207709_10003976 | 3300025935 | Bacteria | 8624 |
| 186 | Ga0207709_10096013 | 3300025935 | Bacteria | 1949 |
| 187 | Ga0207709_10142204 | 3300025935 | Bacteria | 1650 |
| 188 | Ga0207669_10261762 | 3300025937 | Bacteria | 1294 |
| 189 | Ga0207711_10025731 | 3300025941 | Bacteria | 4934 |
| 190 | Ga0207651_10471496 | 3300025960 | Bacteria | 1080 |
| 191 | Ga0207712_10023432 | 3300025961 | Bacteria | 4073 |
| 192 | Ga0207668_10579152 | 3300025972 | Bacteria | 975 |
| 193 | Ga0207658_10226620 | 3300025986 | Bacteria | 1575 |
| 194 | Ga0207678_10463169 | 3300026067 | Bacteria | 1103 |
| 195 | Ga0209281_1000033 | 3300027111 | Bacteria | 383539 |
| 196 | Ga0209281_1005381 | 3300027111 | Bacteria | 3566 |
| 197 | Ga0209371_1000132 | 3300027312 | Bacteria | 122524 |
| 198 | Ga0209371_1040546 | 3300027312 | Bacteria | 947 |
| 199 | Ga0209983_1018121 | 3300027665 | Bacteria | 1461 |
| 200 | Ga0209813_10220940 | 3300027866 | Bacteria | 709 |
| 201 | Ga0207428_10024625 | 3300027907 | Bacteria | 5054 |
| 202 | Ga0207428_10388827 | 3300027907 | Bacteria | 1022 |
| 203 | Ga0307517_10088988 | 3300028786 | Bacteria | 2547 |
| 204 | Ga0268256_1000106 | 3300030500 | Bacteria | 122524 |
| 205 | Ga0268256_1040738 | 3300030500 | Bacteria | 1042 |
| 206 | Ga0307511_10344644 | 3300030521 | Bacteria | 644 |
| 207 | Ga0316179_1050601 | 3300030734 | Bacteria | 4028 |
| 208 | Ga0316178_1092012 | 3300030735 | Bacteria | 40323 |
| 209 | Ga0316181_1054663 | 3300030744 | Bacteria | 2238 |
| 210 | Ga0307513_10808783 | 3300031456 | Bacteria | 643 |
| 211 | Ga0307408_100000441 | 3300031548 | Bacteria | 36650 |
| 212 | Ga0307408_100008474 | 3300031548 | Bacteria | 6790 |
| 213 | Ga0307408_100497761 | 3300031548 | Bacteria | 1066 |
| 214 | Ga0307408_100575022 | 3300031548 | Bacteria | 997 |
| 215 | Ga0307405_10001479 | 3300031731 | Bacteria | 9922 |
| 216 | Ga0307405_10001499 | 3300031731 | Bacteria | 9882 |
| 217 | Ga0307413_10003987 | 3300031824 | Bacteria | 6340 |
| 218 | Ga0307407_10025104 | 3300031903 | Bacteria | 3136 |
| 219 | Ga0307407_10125928 | 3300031903 | Bacteria | 1632 |
| 220 | Ga0307407_10826770 | 3300031903 | Bacteria | 706 |
| 221 | Ga0307412_10069557 | 3300031911 | Bacteria | 2396 |
| 222 | Ga0307412_10194867 | 3300031911 | Bacteria | 1534 |
| 223 | Ga0307412_10437167 | 3300031911 | Bacteria | 1074 |
| 224 | Ga0307412_11674299 | 3300031911 | Bacteria | 582 |
| 225 | Ga0307409_100016056 | 3300031995 | Bacteria | 4940 |
| 226 | Ga0307409_100441029 | 3300031995 | Bacteria | 1254 |
| 227 | Ga0307414_10020180 | 3300032004 | Bacteria | 4148 |
| 228 | Ga0307414_10063624 | 3300032004 | Bacteria | 2623 |
| 229 | Ga0307414_10240318 | 3300032004 | Bacteria | 1499 |
| 230 | Ga0307414_10670352 | 3300032004 | Bacteria | 936 |
| 231 | Ga0307411_10035304 | 3300032005 | Bacteria | 3120 |
| 232 | Ga0307411_10050653 | 3300032005 | Bacteria | 2705 |
| 233 | Ga0307411_10069651 | 3300032005 | Bacteria | 2376 |
| 234 | Ga0307411_11602616 | 3300032005 | Bacteria | 601 |
| 235 | Ga0395899_0977378 | 3300037312 | Bacteria | 512 |
| 236 | Ga0395901_0000104 | 3300038443 | Bacteria | 114939 |
| 237 | Ga0436365_0722690 | 3300039437 | Bacteria | 5697 |
| 238 | Ga0436365_0849926 | 3300039437 | Bacteria | 98452 |
| 239 | Ga0436365_1762761 | 3300039437 | Bacteria | 637 |
| 240 | Ga0436363_0386876 | 3300039450 | Bacteria | 4088 |
| 241 | Ga0439438_001139 | 3300041405 | Bacteria | 11848 |
| 242 | Ga0439438_002917 | 3300041405 | Bacteria | 7099 |
| 243 | Ga0439438_003496 | 3300041405 | Bacteria | 6342 |
| 244 | Ga0439438_004112 | 3300041405 | Bacteria | 5680 |
| 245 | Ga0439447_001552 | 3300041407 | Bacteria | 8394 |
| 246 | Ga0439447_040188 | 3300041407 | Bacteria | 1142 |
| 247 | Ga0439466_0000583 | 3300041411 | Bacteria | 13697 |
| 248 | Ga0439466_0026609 | 3300041411 | Bacteria | 2009 |
| 249 | Ga0439466_0027776 | 3300041411 | Bacteria | 1957 |
| 250 | Ga0439466_0071565 | 3300041411 | Bacteria | 1103 |
| 251 | Ga0439465_0027238 | 3300041413 | Bacteria | 1809 |
| 252 | Ga0451853_2768710 | 3300041512 | Bacteria | 891 |
| 253 | Ga0439431_0010901 | 3300041997 | Bacteria | 2070 |
| 254 | Ga0439437_033836 | 3300042000 | Bacteria | 648 |
| 255 | Ga0439445_0014600 | 3300042004 | Bacteria | 1914 |
| 256 | Ga0439432_000348 | 3300042006 | Bacteria | 16898 |
| 257 | Ga0439432_001422 | 3300042006 | Bacteria | 9005 |
| 258 | Ga0439432_009369 | 3300042006 | Bacteria | 3416 |
| 259 | Ga0439432_010453 | 3300042006 | Bacteria | 3211 |
| 260 | Ga0439432_013098 | 3300042006 | Bacteria | 2824 |
| 261 | Ga0439451_000192 | 3300042009 | Bacteria | 11690 |
| 262 | Ga0439451_006417 | 3300042009 | Bacteria | 2406 |
| 263 | Ga0439451_043929 | 3300042009 | Bacteria | 895 |
| 264 | Ga0439452_000305 | 3300042010 | Bacteria | 31596 |
| 265 | Ga0439452_005591 | 3300042010 | Bacteria | 4029 |
| 266 | Ga0439452_005880 | 3300042010 | Bacteria | 3900 |
| 267 | Ga0439452_016975 | 3300042010 | Bacteria | 1967 |
| 268 | Ga0439452_036581 | 3300042010 | Bacteria | 1175 |
| 269 | Ga0439456_000241 | 3300042013 | Bacteria | 14327 |
| 270 | Ga0439456_000432 | 3300042013 | Bacteria | 9338 |
| 271 | Ga0439456_005222 | 3300042013 | Bacteria | 2636 |
| 272 | Ga0439463_001213 | 3300042016 | Bacteria | 6883 |
| 273 | Ga0439463_090512 | 3300042016 | Bacteria | 787 |
| 274 | Ga0450911_000337 | 3300042115 | Bacteria | 16605 |
| 275 | Ga0450911_003294 | 3300042115 | Bacteria | 2883 |
| 276 | Ga0450911_016176 | 3300042115 | Bacteria | 985 |
| 277 | Ga0450913_015191 | 3300042117 | Bacteria | 663 |
| 278 | Ga0450919_000223 | 3300042121 | Bacteria | 6307 |
| 279 | Ga0450922_005326 | 3300042124 | Bacteria | 1189 |
| 280 | Ga0450890_000369 | 3300042127 | Bacteria | 6580 |
| 281 | Ga0450891_008222 | 3300042129 | Bacteria | 957 |
| 282 | Ga0450902_004446 | 3300042137 | Bacteria | 2087 |
| 283 | Ga0450903_000573 | 3300042138 | Bacteria | 7553 |
| 284 | Ga0450903_025703 | 3300042138 | Bacteria | 899 |
| 285 | Ga0450903_030546 | 3300042138 | Bacteria | 814 |
| 286 | Ga0450904_010332 | 3300042139 | Bacteria | 921 |
| 287 | Ga0450905_000436 | 3300042142 | Bacteria | 5117 |
| 288 | Ga0450906_000124 | 3300042145 | Bacteria | 13539 |
| 289 | Ga0450906_000338 | 3300042145 | Bacteria | 9533 |
| 290 | Ga0450907_000023 | 3300042146 | Bacteria | 73314 |
| 291 | Ga0450907_000787 | 3300042146 | Bacteria | 7917 |
| 292 | Ga0439446_0004604 | 3300042156 | Bacteria | 3499 |
| 293 | Ga0439446_0008441 | 3300042156 | Bacteria | 2735 |
| 294 | Ga0450908_001020 | 3300042184 | Bacteria | 5422 |
| 295 | Ga0450909_001505 | 3300042185 | Bacteria | 3248 |
| 296 | Ga0439434_0000273 | 3300042435 | Bacteria | 14740 |
| 297 | Ga0439464_0146472 | 3300042439 | Bacteria | 737 |
| 298 | Ga0439460_0000614 | 3300042461 | Bacteria | 7861 |
| 299 | Ga0439460_0001105 | 3300042461 | Bacteria | 6296 |
| 300 | Ga0450916_008376 | 3300042530 | Bacteria | 1257 |
| 301 | Ga0450918_003244 | 3300042531 | Bacteria | 3033 |
| 302 | Ga0450893_0003300 | 3300042532 | Bacteria | 2540 |
| 303 | Ga0439440_0000050 | 3300042993 | Bacteria | 14850 |
| 304 | Ga0439440_0005371 | 3300042993 | Bacteria | 2545 |
| 305 | Ga0495617_000363 | 3300046452 | Bacteria | 25020 |
| 306 | Ga0495617_000371 | 3300046452 | Bacteria | 24874 |
| 307 | Ga0495617_026399 | 3300046452 | Bacteria | 1955 |
| 308 | Ga0495617_067533 | 3300046452 | Bacteria | 1177 |
| 309 | Ga0495603_0009093 | 3300046455 | Bacteria | 6005 |
| 310 | Ga0495603_0044482 | 3300046455 | Bacteria | 2649 |
| 311 | Ga0495603_0045469 | 3300046455 | Bacteria | 2618 |
| 312 | Ga0495603_0128046 | 3300046455 | Bacteria | 1479 |
| 313 | Ga0495603_0197221 | 3300046455 | Bacteria | 1164 |
| 314 | Ga0495603_0229056 | 3300046455 | Bacteria | 1071 |
| 315 | Ga0495590_0001079 | 3300046457 | Bacteria | 12015 |
| 316 | Ga0495629_0034430 | 3300046459 | Bacteria | 3580 |
| 317 | Ga0495638_0002915 | 3300046460 | Bacteria | 13661 |
| 318 | Ga0495638_0052289 | 3300046460 | Bacteria | 2544 |
| 319 | Ga0495638_0084307 | 3300046460 | Bacteria | 1923 |
| 320 | Ga0495638_0092042 | 3300046460 | Bacteria | 1825 |
| 321 | Ga0495653_0117764 | 3300046463 | Bacteria | 1897 |
| 322 | Ga0495650_0002941 | 3300046471 | Bacteria | 12910 |
| 323 | Ga0495650_0015898 | 3300046471 | Bacteria | 3840 |
| 324 | Ga0495650_0018217 | 3300046471 | Bacteria | 3495 |
| 325 | Ga0495582_0035562 | 3300046473 | Bacteria | 2740 |
| 326 | Ga0495605_0003506 | 3300046474 | Bacteria | 9331 |
| 327 | Ga0495605_0005872 | 3300046474 | Bacteria | 7093 |
| 328 | Ga0495605_0026626 | 3300046474 | Bacteria | 3004 |
| 329 | Ga0495605_0033403 | 3300046474 | Bacteria | 2610 |
| 330 | Ga0495605_0202088 | 3300046474 | Bacteria | 865 |
| 331 | Ga0495639_0000045 | 3300046475 | Bacteria | 54350 |
| 332 | Ga0495639_0105608 | 3300046475 | Bacteria | 1333 |
| 333 | Ga0495662_0653983 | 3300046476 | Bacteria | 513 |
| 334 | Ga0495584_0001998 | 3300046491 | Bacteria | 11727 |
| 335 | Ga0495584_0003975 | 3300046491 | Bacteria | 7975 |
| 336 | Ga0495584_0006645 | 3300046491 | Bacteria | 6046 |
| 337 | Ga0495584_0007777 | 3300046491 | Bacteria | 5578 |
| 338 | Ga0495584_0012231 | 3300046491 | Bacteria | 4384 |
| 339 | Ga0495584_0021527 | 3300046491 | Bacteria | 3274 |
| 340 | Ga0495584_0026174 | 3300046491 | Bacteria | 2955 |
| 341 | Ga0495584_0144166 | 3300046491 | Bacteria | 1210 |
| 342 | Ga0495585_0032252 | 3300046492 | Bacteria | 2968 |
| 343 | Ga0495585_0055389 | 3300046492 | Bacteria | 2191 |
| 344 | Ga0495585_0119189 | 3300046492 | Bacteria | 1397 |
| 345 | Ga0495594_0002459 | 3300046499 | Bacteria | 9638 |
| 346 | Ga0495594_0025858 | 3300046499 | Bacteria | 3156 |
| 347 | Ga0495594_0033128 | 3300046499 | Bacteria | 2807 |
| 348 | Ga0495594_0055182 | 3300046499 | Bacteria | 2190 |
| 349 | Ga0495594_0160638 | 3300046499 | Bacteria | 1277 |
| 350 | Ga0495594_0334405 | 3300046499 | Bacteria | 862 |
| 351 | Ga0495594_0553012 | 3300046499 | Bacteria | 653 |
| 352 | Ga0495607_0000273 | 3300046501 | Bacteria | 55633 |
| 353 | Ga0495607_0001088 | 3300046501 | Bacteria | 24822 |
| 354 | Ga0495607_0005119 | 3300046501 | Bacteria | 9478 |
| 355 | Ga0495607_0068632 | 3300046501 | Bacteria | 1987 |
| 356 | Ga0495607_0089148 | 3300046501 | Bacteria | 1675 |
| 357 | Ga0495607_0100942 | 3300046501 | Bacteria | 1545 |
| 358 | Ga0495607_0121022 | 3300046501 | Bacteria | 1374 |
| 359 | Ga0495607_0140437 | 3300046501 | Bacteria | 1246 |
| 360 | Ga0495607_0411387 | 3300046501 | Bacteria | 613 |
| 361 | Ga0495583_0000235 | 3300046506 | Bacteria | 91939 |
| 362 | Ga0495583_0000683 | 3300046506 | Bacteria | 43938 |
| 363 | Ga0495583_0023624 | 3300046506 | Bacteria | 3106 |
| 364 | Ga0495583_0266333 | 3300046506 | Bacteria | 685 |
| 365 | Ga0495606_0000524 | 3300046507 | Bacteria | 62049 |
| 366 | Ga0495606_0001283 | 3300046507 | Bacteria | 34807 |
| 367 | Ga0495606_0274833 | 3300046507 | Bacteria | 924 |
| 368 | Ga0495606_0328021 | 3300046507 | Bacteria | 820 |
| 369 | Ga0495610_0005206 | 3300046512 | Bacteria | 9313 |
| 370 | Ga0495610_0093603 | 3300046512 | Bacteria | 1357 |
| 371 | Ga0495610_0190175 | 3300046512 | Bacteria | 848 |
| 372 | Ga0495616_0001582 | 3300046513 | Bacteria | 15619 |
| 373 | Ga0495616_0002190 | 3300046513 | Bacteria | 13066 |
| 374 | Ga0495616_0011118 | 3300046513 | Bacteria | 5169 |
| 375 | Ga0495630_0213130 | 3300046517 | Bacteria | 1474 |
| 376 | Ga0495631_0040010 | 3300046518 | Bacteria | 2078 |
| 377 | Ga0495631_0088451 | 3300046518 | Bacteria | 1334 |
| 378 | Ga0495631_0213587 | 3300046518 | Bacteria | 824 |
| 379 | Ga0495632_0000408 | 3300046519 | Bacteria | 40601 |
| 380 | Ga0495632_0001886 | 3300046519 | Bacteria | 16810 |
| 381 | Ga0495632_0002087 | 3300046519 | Bacteria | 15629 |
| 382 | Ga0495637_0000087 | 3300046520 | Bacteria | 72113 |
| 383 | Ga0495637_0001534 | 3300046520 | Bacteria | 13504 |
| 384 | Ga0495637_0001573 | 3300046520 | Bacteria | 13275 |
| 385 | Ga0495637_0008137 | 3300046520 | Bacteria | 5162 |
| 386 | Ga0495643_0000159 | 3300046522 | Bacteria | 108642 |
| 387 | Ga0495643_0001221 | 3300046522 | Bacteria | 24843 |
| 388 | Ga0495643_0002132 | 3300046522 | Bacteria | 16309 |
| 389 | Ga0495643_0012769 | 3300046522 | Bacteria | 5053 |
| 390 | Ga0495643_0020971 | 3300046522 | Bacteria | 3757 |
| 391 | Ga0495643_0026151 | 3300046522 | Bacteria | 3296 |
| 392 | Ga0495643_0163039 | 3300046522 | Bacteria | 1095 |
| 393 | Ga0495643_0371837 | 3300046522 | Bacteria | 636 |
| 394 | Ga0495644_0147657 | 3300046523 | Bacteria | 899 |
| 395 | Ga0495648_0000614 | 3300046524 | Bacteria | 38113 |
| 396 | Ga0495648_0028290 | 3300046524 | Bacteria | 3736 |
| 397 | Ga0495648_0084935 | 3300046524 | Bacteria | 1790 |
| 398 | Ga0495648_0168199 | 3300046524 | Bacteria | 1126 |
| 399 | Ga0495666_0011607 | 3300046526 | Bacteria | 4391 |
| 400 | Ga0495666_0035748 | 3300046526 | Bacteria | 2420 |
| 401 | Ga0495666_0038203 | 3300046526 | Bacteria | 2335 |
| 402 | Ga0495666_0057758 | 3300046526 | Bacteria | 1857 |
| 403 | Ga0495642_0000051 | 3300046528 | Bacteria | 71226 |
| 404 | Ga0495642_0064991 | 3300046528 | Bacteria | 1518 |
| 405 | Ga0495642_0284342 | 3300046528 | Bacteria | 724 |
| 406 | Ga0495654_0000074 | 3300046530 | Bacteria | 114325 |
| 407 | Ga0495654_0002203 | 3300046530 | Bacteria | 12636 |
| 408 | Ga0495654_0023690 | 3300046530 | Bacteria | 3177 |
| 409 | Ga0495654_0025879 | 3300046530 | Bacteria | 3021 |
| 410 | Ga0495654_0027841 | 3300046530 | Bacteria | 2892 |
| 411 | Ga0495665_0074862 | 3300046531 | Bacteria | 1782 |
| 412 | Ga0495665_0077400 | 3300046531 | Bacteria | 1750 |
| 413 | Ga0495640_0146020 | 3300046533 | Bacteria | 1522 |
| 414 | Ga0495586_0061144 | 3300046535 | Bacteria | 2049 |
| 415 | Ga0495587_0010667 | 3300046536 | Bacteria | 5836 |
| 416 | Ga0495609_0000469 | 3300046538 | Bacteria | 32618 |
| 417 | Ga0495609_0002380 | 3300046538 | Bacteria | 11583 |
| 418 | Ga0495597_0000254 | 3300046542 | Bacteria | 48567 |
| 419 | Ga0495597_0005584 | 3300046542 | Bacteria | 6636 |
| 420 | Ga0495597_0015136 | 3300046542 | Bacteria | 3656 |
| 421 | Ga0495597_0021670 | 3300046542 | Bacteria | 2986 |
| 422 | Ga0495597_0031403 | 3300046542 | Bacteria | 2417 |
| 423 | Ga0495597_0141116 | 3300046542 | Bacteria | 993 |
| 424 | Ga0495622_0000501 | 3300046557 | Bacteria | 24481 |
| 425 | Ga0495622_0002067 | 3300046557 | Bacteria | 9809 |
| 426 | Ga0495622_0004949 | 3300046557 | Bacteria | 6171 |
| 427 | Ga0495622_0010144 | 3300046557 | Bacteria | 4356 |
| 428 | Ga0495622_0035044 | 3300046557 | Bacteria | 2340 |
| 429 | Ga0495622_0035169 | 3300046557 | Bacteria | 2337 |
| 430 | Ga0495622_0050145 | 3300046557 | Bacteria | 1937 |
| 431 | Ga0495622_0383772 | 3300046557 | Bacteria | 606 |
| 432 | Ga0495622_0493528 | 3300046557 | Bacteria | 524 |
| 433 | Ga0495633_0025551 | 3300046558 | Bacteria | 2906 |
| 434 | Ga0495633_0306715 | 3300046558 | Bacteria | 721 |
| 435 | Ga0495656_0206660 | 3300046615 | Bacteria | 976 |
| 436 | Ga0495668_0099915 | 3300046616 | Bacteria | 1587 |
| 437 | Ga0495634_0105447 | 3300046642 | Bacteria | 1817 |
| 438 | Ga0495611_0130712 | 3300046648 | Bacteria | 1171 |
| 439 | Ga0495611_0155004 | 3300046648 | Bacteria | 1069 |
| 440 | Ga0495611_0185232 | 3300046648 | Bacteria | 972 |
| 441 | Ga0495625_0034662 | 3300046660 | Bacteria | 3724 |
| 442 | Ga0495625_0057705 | 3300046660 | Bacteria | 2759 |
| 443 | Ga0495625_0132388 | 3300046660 | Bacteria | 1688 |
| 444 | Ga0495625_0418118 | 3300046660 | Bacteria | 834 |
| 445 | Ga0495625_0419737 | 3300046660 | Bacteria | 832 |
| 446 | Ga0495659_0000509 | 3300046664 | Bacteria | 14330 |
| 447 | Ga0495659_0006077 | 3300046664 | Bacteria | 3817 |
| 448 | Ga0495659_0047930 | 3300046664 | Bacteria | 1546 |
| 449 | Ga0495661_0040249 | 3300046665 | Bacteria | 2900 |
| 450 | Ga0495661_0297219 | 3300046665 | Bacteria | 809 |
| 451 | Ga0495661_0398636 | 3300046665 | Bacteria | 669 |
| 452 | Ga0495588_0097152 | 3300046674 | Bacteria | 1545 |
| 453 | Ga0495588_0109494 | 3300046674 | Bacteria | 1454 |
| 454 | Ga0495588_0117281 | 3300046674 | Unclassified | 1403 |
| 455 | Ga0495588_0136978 | 3300046674 | Bacteria | 1292 |
| 456 | Ga0495588_0359982 | 3300046674 | Bacteria | 764 |
| 457 | Ga0495588_0392847 | 3300046674 | Bacteria | 728 |
| 458 | Ga0495623_0060019 | 3300046679 | Bacteria | 2387 |
| 459 | Ga0495623_0072382 | 3300046679 | Bacteria | 2143 |
| 460 | Ga0495624_0005841 | 3300046690 | Bacteria | 8806 |
| 461 | Ga0495670_0000711 | 3300046691 | Bacteria | 15847 |
| 462 | Ga0495670_0028001 | 3300046691 | Bacteria | 2793 |
| 463 | Ga0495670_0057440 | 3300046691 | Bacteria | 1954 |
| 464 | Ga0495670_0090287 | 3300046691 | Bacteria | 1567 |
| 465 | Ga0495670_0155327 | 3300046691 | Bacteria | 1200 |
| 466 | Ga0495671_0001196 | 3300046692 | Bacteria | 17772 |
| 467 | Ga0495671_0001566 | 3300046692 | Bacteria | 15187 |
| 468 | Ga0495671_0004836 | 3300046692 | Bacteria | 7962 |
| 469 | Ga0495671_0030582 | 3300046692 | Bacteria | 2756 |
| 470 | Ga0495649_0000222 | 3300046694 | Bacteria | 50180 |
| 471 | Ga0495649_0000280 | 3300046694 | Bacteria | 44939 |
| 472 | Ga0495649_0005636 | 3300046694 | Bacteria | 7912 |
| 473 | Ga0495649_0343995 | 3300046694 | Bacteria | 754 |
| 474 | Ga0495589_0000348 | 3300046794 | Bacteria | 36271 |
| 475 | Ga0495589_0066218 | 3300046794 | Bacteria | 1769 |
| 476 | Ga0495589_0552448 | 3300046794 | Bacteria | 525 |
| 477 | Ga0495600_0074589 | 3300046809 | Bacteria | 2215 |
| 478 | Ga0495600_0601768 | 3300046809 | Bacteria | 668 |
| 479 | Ga0495660_0030729 | 3300046810 | Bacteria | 3025 |
| 480 | Ga0495660_0048036 | 3300046810 | Bacteria | 2335 |
| 481 | Ga0495660_0080791 | 3300046810 | Bacteria | 1705 |
| 482 | Ga0495660_0082272 | 3300046810 | Bacteria | 1686 |
| 483 | Ga0495660_0160510 | 3300046810 | Bacteria | 1103 |
| 484 | Ga0495581_0068503 | 3300047315 | Bacteria | 2052 |
| 485 | Ga0495581_0073787 | 3300047315 | Bacteria | 1974 |
| 486 | Ga0495581_0085768 | 3300047315 | Bacteria | 1825 |
| 487 | Ga0495581_0099111 | 3300047315 | Bacteria | 1693 |
| 488 | Ga0495604_0309277 | 3300047317 | Bacteria | 1059 |
| 489 | Ga0495604_1052332 | 3300047317 | Bacteria | 501 |
| 490 | Ga0495636_0000564 | 3300047318 | Bacteria | 13616 |
| 491 | Ga0495636_0002822 | 3300047318 | Bacteria | 6703 |
| 492 | Ga0495636_0044635 | 3300047318 | Bacteria | 1846 |
| 493 | Ga0495674_0016113 | 3300047319 | Bacteria | 6976 |
| 494 | Ga0495674_0200025 | 3300047319 | Bacteria | 1658 |
| 495 | Ga0495672_0003116 | 3300047320 | Bacteria | 14469 |
| 496 | Ga0495672_0004114 | 3300047320 | Bacteria | 12113 |
| 497 | Ga0495672_0004346 | 3300047320 | Bacteria | 11663 |
| 498 | Ga0495672_0067356 | 3300047320 | Bacteria | 2039 |
| 499 | Ga0495676_0135387 | 3300047321 | Unclassified | 1772 |
| 500 | Ga0495676_0954859 | 3300047321 | Bacteria | 548 |
| 501 | Ga0495680_0122709 | 3300047322 | Bacteria | 1917 |
| 502 | Ga0495683_0000542 | 3300047323 | Bacteria | 28674 |
| 503 | Ga0495683_0041062 | 3300047323 | Bacteria | 2335 |
| 504 | Ga0495683_0094916 | 3300047323 | Bacteria | 1441 |
| 505 | Ga0495687_000721 | 3300047443 | Bacteria | 36612 |
| 506 | Ga0495687_009090 | 3300047443 | Bacteria | 5596 |
| 507 | Ga0495687_145260 | 3300047443 | Bacteria | 819 |
| 508 | Ga0495677_0001398 | 3300047445 | Bacteria | 9672 |
| 509 | Ga0495677_0013090 | 3300047445 | Bacteria | 3019 |
| 510 | Ga0495677_0067007 | 3300047445 | Bacteria | 1336 |
| 511 | Ga0495679_030984 | 3300047446 | Bacteria | 1730 |
| 512 | Ga0495679_038725 | 3300047446 | Bacteria | 1491 |
| 513 | Ga0495685_070349 | 3300047447 | Bacteria | 1172 |
| 514 | Ga0495685_168788 | 3300047447 | Bacteria | 707 |
| 515 | Ga0495673_0000236 | 3300047469 | Bacteria | 79618 |
| 516 | Ga0495673_0001540 | 3300047469 | Bacteria | 18124 |
| 517 | Ga0495673_0001969 | 3300047469 | Bacteria | 15199 |
| 518 | Ga0495673_0013858 | 3300047469 | Bacteria | 4213 |
| 519 | Ga0495673_0029929 | 3300047469 | Bacteria | 2564 |
| 520 | Ga0495681_0000171 | 3300047470 | Bacteria | 54448 |
| 521 | Ga0495681_0004947 | 3300047470 | Bacteria | 8994 |
| 522 | Ga0495681_0016962 | 3300047470 | Bacteria | 4061 |
| 523 | Ga0495681_0083492 | 3300047470 | Bacteria | 1422 |
| 524 | Ga0495681_0248804 | 3300047470 | Bacteria | 702 |
| 525 | Ga0495686_0137430 | 3300047472 | Bacteria | 1444 |
| 526 | Ga0495593_0024700 | 3300047673 | Bacteria | 3328 |
| 527 | Ga0495593_0079587 | 3300047673 | Bacteria | 1696 |
| 528 | Ga0495593_0317806 | 3300047673 | Bacteria | 778 |
| 529 | Ga0495626_0002512 | 3300048091 | Bacteria | 12647 |
| 530 | Ga0495626_0018502 | 3300048091 | Bacteria | 3497 |
| 531 | Ga0495626_0040051 | 3300048091 | Bacteria | 2214 |
| 532 | Ga0495626_0057883 | 3300048091 | Bacteria | 1772 |
| 533 | Ga0496102_0015332 | 3300048905 | Bacteria | 6674 |
| 534 | Ga0496104_0265523 | 3300048907 | Bacteria | 1629 |
| 535 | Ga0496105_0175587 | 3300048908 | Bacteria | 1755 |
| 536 | Ga0496106_0162397 | 3300048909 | Bacteria | 1767 |
| 537 | Ga0496107_0521854 | 3300048910 | Bacteria | 881 |
| 538 | Ga0496111_0821883 | 3300048914 | Bacteria | 672 |
| 539 | Ga0496114_0024698 | 3300048917 | Bacteria | 4906 |
| 540 | Ga0496114_0037718 | 3300048917 | Bacteria | 3998 |
| 541 | Ga0496115_0014669 | 3300048918 | Bacteria | 5934 |
| 542 | Ga0496115_0363825 | 3300048918 | Bacteria | 1178 |
| 543 | Ga0496115_0385167 | 3300048918 | Bacteria | 1140 |
| 544 | Ga0496115_0528345 | 3300048918 | Bacteria | 945 |
| 545 | Ga0496115_0877530 | 3300048918 | Bacteria | 693 |
| 546 | Ga0496116_0000338 | 3300048919 | Bacteria | 75100 |
| 547 | Ga0496116_0001034 | 3300048919 | Bacteria | 33983 |
| 548 | Ga0496116_0078254 | 3300048919 | Bacteria | 2063 |
| 549 | Ga0496117_0004165 | 3300048920 | Bacteria | 16165 |
| 550 | Ga0496117_0004412 | 3300048920 | Bacteria | 15544 |
| 551 | Ga0496117_0005165 | 3300048920 | Bacteria | 13929 |
| 552 | Ga0496117_0079192 | 3300048920 | Bacteria | 2166 |
| 553 | Ga0496118_0002192 | 3300048921 | Bacteria | 27140 |
| 554 | Ga0496118_0414863 | 3300048921 | Bacteria | 694 |
| 555 | Ga0496119_0000652 | 3300048922 | Bacteria | 46693 |
| 556 | Ga0496119_0057393 | 3300048922 | Bacteria | 2352 |
| 557 | Ga0496120_0010240 | 3300048923 | Bacteria | 6563 |
| 558 | Ga0496120_0050162 | 3300048923 | Bacteria | 2390 |
| 559 | Ga0496121_0000713 | 3300048924 | Bacteria | 61654 |
| 560 | Ga0496121_0075092 | 3300048924 | Bacteria | 2702 |
| 561 | Ga0496121_0191894 | 3300048924 | Bacteria | 1464 |
| 562 | Ga0496122_0001163 | 3300048925 | Bacteria | 45014 |
| 563 | Ga0496122_0006952 | 3300048925 | Bacteria | 12751 |
| 564 | Ga0496122_0163841 | 3300048925 | Bacteria | 1351 |
| 565 | Ga0496122_0182475 | 3300048925 | Bacteria | 1250 |
| 566 | Ga0496123_0002157 | 3300048926 | Bacteria | 25145 |
| 567 | Ga0496123_0003594 | 3300048926 | Bacteria | 17170 |
| 568 | Ga0496124_0001078 | 3300048927 | Bacteria | 43125 |
| 569 | Ga0496124_0018596 | 3300048927 | Bacteria | 6503 |
| 570 | Ga0496124_0050780 | 3300048927 | Bacteria | 3531 |
| 571 | Ga0496124_0112819 | 3300048927 | Bacteria | 2185 |
| 572 | Ga0496124_0149566 | 3300048927 | Bacteria | 1834 |
| 573 | Ga0496124_0294546 | 3300048927 | Bacteria | 1175 |
| 574 | Ga0496125_0035487 | 3300048928 | Bacteria | 4372 |
| 575 | Ga0496125_0041465 | 3300048928 | Bacteria | 3934 |
| 576 | Ga0496125_0043972 | 3300048928 | Bacteria | 3784 |
| 577 | Ga0496125_0060020 | 3300048928 | Bacteria | 3060 |
| 578 | Ga0496126_0009230 | 3300048929 | Bacteria | 10516 |
| 579 | Ga0496126_1267943 | 3300048929 | Bacteria | 538 |
| 580 | Ga0495678_000979 | 3300049459 | Bacteria | 24551 |
| 581 | Ga0495678_015533 | 3300049459 | Bacteria | 3499 |
| 582 | Ga0495678_068239 | 3300049459 | Bacteria | 1311 |
| 583 | Ga0495682_0029161 | 3300049460 | Bacteria | 2043 |
| 584 | Ga0495682_0186156 | 3300049460 | Bacteria | 737 |
| 585 | Ga0501241_005235 | 3300049758 | Bacteria | 2421 |
| 586 | nmdc:mga03683_21571_c1 | 3300050489 | Bacteria | 2485 |
| 587 | Ga0500594_0022133 | 3300053118 | Bacteria | 1600 |
| 588 | Ga0500618_000474 | 3300053125 | Bacteria | 26046 |
| 589 | 2510285304 | 2510065053 | Bacteria | 5005518 |
| 590 | 2510295886 | 2510065055 | Bacteria | 5037935 |
| 591 | 2510313515 | 2510065058 | Bacteria | 5005894 |
| 592 | 2511258098 | 2511231004 | Bacteria | 6669789 |
| 593 | 2511273180 | 2511231007 | Bacteria | 6306603 |
| 594 | 2511324326 | 2511231016 | Bacteria | 6704427 |
| 595 | 2511361902 | 2511231022 | Bacteria | 6719296 |
| 596 | 2511822666 | 2511231156 | Bacteria | 6845832 |
| 597 | 2555667659 | 2554235341 | Bacteria | 6867980 |
| 598 | 2597861886 | 2597489888 | Bacteria | 6179543 |
| 599 | 2597867619 | 2597489889 | Bacteria | 6297495 |
| 600 | 2599356879 | 2599185160 | Bacteria | 6844013 |
| 601 | 2599363091 | 2599185161 | Bacteria | 6960462 |
| 602 | 2599369957 | 2599185162 | Bacteria | 6957254 |
| 603 | 2599376200 | 2599185163 | Bacteria | 6995158 |
| 604 | 2599381984 | 2599185164 | Bacteria | 6841688 |
| 605 | 2599387872 | 2599185165 | Bacteria | 6843250 |
| 606 | 2599395602 | 2599185166 | Bacteria | 6959206 |
| 607 | 2599407367 | 2599185168 | Bacteria | 6997636 |
| 608 | 2599463712 | 2599185181 | Bacteria | 6844519 |
| 609 | 2599468940 | 2599185182 | Bacteria | 6883168 |
| 610 | 2599492731 | 2599185186 | Bacteria | 6831633 |
| 611 | 2599499900 | 2599185188 | Bacteria | 6164180 |
| 612 | 2599506646 | 2599185189 | Bacteria | 5862825 |
| 613 | 2599616434 | 2599185212 | Bacteria | 6765997 |
| 614 | 2599769632 | 2599185248 | Bacteria | 6696816 |
| 615 | 2599887051 | 2599185289 | Bacteria | 6778765 |
| 616 | 2599898380 | 2599185291 | Bacteria | 6775623 |
| 617 | 2599931111 | 2599185300 | Bacteria | 6062622 |
| 618 | 2599944509 | 2599185302 | Bacteria | 5954930 |
| 619 | 2599956148 | 2599185304 | Bacteria | 5951361 |
| 620 | 2599961126 | 2599185305 | Bacteria | 6748700 |
| 621 | 2599964769 | 2599185306 | Bacteria | 6637356 |
| 622 | 2599977300 | 2599185308 | Bacteria | 6621546 |
| 623 | 2599983086 | 2599185309 | Bacteria | 5969593 |
| 624 | 2599991019 | 2599185310 | Bacteria | 6014457 |
| 625 | 2599996816 | 2599185311 | Bacteria | 6354990 |
| 626 | 2600001109 | 2599185312 | Bacteria | 5912071 |
| 627 | 2600011468 | 2599185314 | Bacteria | 6621749 |
| 628 | 2600019298 | 2599185315 | Bacteria | 6771107 |
| 629 | 2600025094 | 2599185316 | Bacteria | 6320029 |
| 630 | 2600031379 | 2599185317 | Bacteria | 6435722 |
| 631 | 2600036924 | 2599185318 | Bacteria | 6961590 |
| 632 | 2600045150 | 2599185319 | Bacteria | 6637840 |
| 633 | 2600048089 | 2599185320 | Bacteria | 5963263 |
| 634 | 2600054357 | 2599185321 | Bacteria | 6764560 |
| 635 | 2600062573 | 2599185322 | Bacteria | 6763055 |
| 636 | 2600066609 | 2599185323 | Bacteria | 6688755 |
| 637 | 2600073959 | 2599185324 | Bacteria | 6590677 |
| 638 | 2600078333 | 2599185325 | Bacteria | 6324919 |
| 639 | 2600216341 | 2599185356 | Bacteria | 6843884 |
| 640 | 2600361097 | 2600254930 | Bacteria | 6431253 |
| 641 | 2601692562 | 2600255296 | Bacteria | 5784754 |
| 642 | 2601776508 | 2600255313 | Bacteria | 6842543 |
| 643 | 2624490004 | 2623620446 | Bacteria | 6500345 |
| 644 | 2643872400 | 2643221571 | Bacteria | 6228673 |
| 645 | 2644189998 | 2643221633 | Bacteria | 6733554 |
| 646 | 2644285652 | 2643221650 | Bacteria | 7029547 |
| 647 | 2644619910 | 2643221713 | Bacteria | 6554480 |
| 648 | 2652545847 | 2651869719 | Bacteria | 6047974 |
| 649 | 2671090580 | 2667528170 | Bacteria | 6786960 |
| 650 | 2671099732 | 2667528171 | Bacteria | 6900659 |
| 651 | 2671129125 | 2667528176 | Bacteria | 6724917 |
| 652 | 2678261217 | 2675903515 | Bacteria | 6580491 |
| 653 | 2715754111 | 2713897148 | Bacteria | 5883533 |
| 654 | 2718632398 | 2718217725 | Bacteria | 5758958 |
| 655 | 2723246781 | 2721755607 | Bacteria | 5841722 |
| 656 | 2729145610 | 2728369097 | Bacteria | 4333476 |
| 657 | 2738807676 | 2738541294 | Bacteria | 6925949 |
| 658 | 2738895036 | 2738541309 | Bacteria | 6926455 |
| 659 | 2739289519 | 2738543020 | Bacteria | 5718238 |
| 660 | 2739294831 | 2738543021 | Bacteria | 5718241 |
| 661 | 2745006528 | 2744054620 | Bacteria | 6551379 |
| 662 | 2757571041 | 2757320392 | Bacteria | 3737298 |
| 663 | 2774119316 | 2773857670 | Bacteria | 6407454 |
| 664 | 2774132220 | 2773857672 | Bacteria | 4993178 |
| 665 | 2784317096 | 2784132072 | Bacteria | 6596533 |
| 666 | 2794594246 | 2791355520 | Bacteria | 5948615 |
| 667 | 2807410244 | 2806310737 | Bacteria | 5751088 |
| 668 | 2807458592 | 2806310745 | Bacteria | 5742165 |
| 669 | 2808858298 | 2808606361 | Bacteria | 6136259 |
| 670 | 2808922522 | 2808606376 | Bacteria | 6248667 |
| 671 | 2808938435 | 2808606378 | Bacteria | 6177535 |
| 672 | 2808944209 | 2808606380 | Bacteria | 6248705 |
| 673 | 2808966783 | 2808606383 | Bacteria | 6138645 |
| 674 | 2809001617 | 2808606389 | Bacteria | 6138126 |
| 675 | 2819705452 | 2818991464 | Bacteria | 6907494 |
| 676 | 2825654050 | 2825651385 | Bacteria | 6715909 |
| 677 | 2842809967 | 2842805378 | Bacteria | 5385175 |
| 678 | 2842831410 | 2842826826 | Bacteria | 5974129 |
| 679 | 2842834399 | 2842832357 | Bacteria | 5959113 |
| 680 | 2842842355 | 2842837860 | Bacteria | 6066181 |
| 681 | 2842846122 | 2842843487 | Bacteria | 6004777 |
| 682 | 2912964403 | 2912963787 | Bacteria | 5646108 |
| 683 | 2913037499 | 2913036834 | Bacteria | 6704877 |
| 684 | 2917071413 | 2917070673 | Bacteria | 6868303 |
| 685 | 2917833910 | 2917832318 | Bacteria | 5346010 |
| 686 | 2919128430 | 2919125081 | Bacteria | 5385106 |
| 687 | 2919158706 | 2919155634 | Bacteria | 4860545 |
| 688 | 2919389531 | 2919385768 | Bacteria | 5897293 |
| 689 | 2919460228 | 2919456309 | Bacteria | 6586567 |
| 690 | 2919486642 | 2919481497 | Bacteria | 6907839 |
| 691 | 2919493136 | 2919487758 | Bacteria | 5929766 |
| 692 | 2919703893 | 2919697872 | Bacteria | 6553725 |
| 693 | 2923591733 | 2923586266 | Bacteria | 6565975 |
| 694 | 2929145036 | 2929144301 | Bacteria | 6622272 |
| 695 | 2929190510 | 2929189879 | Bacteria | 5930554 |
| 696 | 2931371632 | 2931369376 | Bacteria | 6847892 |
| 697 | 2935359239 | 2935353572 | Unclassified | 6955622 |
| 698 | 2939656528 | 2939651529 | Bacteria | 5895393 |
| 699 | 2947235397 | 2947233263 | Bacteria | 6439278 |
| 700 | 2974293110 | 2974289157 | Bacteria | 6080362 |
| 701 | 2974298785 | 2974298342 | Bacteria | 4840922 |
| 702 | 2984501077 | 2984499530 | Bacteria | 5020881 |
| 703 | 2984505475 | 2984504281 | Bacteria | 5262371 |
| 704 | 2988732424 | 2988728565 | Bacteria | 6124362 |
| 705 | 2998140707 | 2998139840 | Bacteria | 6073514 |
| 706 | 3007420232 | 3007419365 | Bacteria | 7026924 |
| 707 | 3007806568 | 3007803356 | Bacteria | 5931491 |
| 708 | 3007859931 | 3007855910 | Bacteria | 5637581 |
| 709 | 3007867250 | 3007866637 | Bacteria | 5899198 |
| 710 | 3007875804 | 3007872151 | Bacteria | 5268868 |
| 711 | 637318052 | 637000220 | Bacteria | 7074893 |
| 712 | 8011355717 | 8011350971 | Bacteria | 6158957 |
| 713 | 8016732612 | 8016728285 | Bacteria | 5263933 |
| 714 | 8019770532 | 8019769354 | Bacteria | 6924660 |
| 715 | 8019782160 | 8019775933 | Bacteria | 6858656 |
| 716 | 8030000035 | 8029995093 | Bacteria | 5990776 |
| 717 | 8054349912 | 8054347763 | Bacteria | 5901107 |
| 718 | 8055880596 | 8055878733 | Bacteria | 5907058 |
| 719 | 8056116938 | 8056115690 | Bacteria | 5527654 |
| 720 | 8056121490 | 8056120720 | Bacteria | 5758328 |
| 721 | 8056132535 | 8056131705 | Bacteria | 6107031 |
| 722 | 8056142340 | 8056137416 | Bacteria | 6147080 |
| 723 | 8056152698 | 8056148874 | Bacteria | 6479865 |
| 724 | 8056158749 | 8056155041 | Bacteria | 6486948 |
| 725 | 8056170341 | 8056166840 | Bacteria | 5820959 |
| 726 | 8057802939 | 8057798959 | Bacteria | 6713499 |
| 727 | Ga0495625_0147625 | |||
| 728 | MRS2a_Contig_727 | |||
| 729 | SwRhRL2b_contig_1615826 | |||
| 730 | JGI25162J39368_1000195 | |||
| 731 | JGI25154J39366_1012163 | |||
| 732 | JGI25163J39215_1000579 | |||
| 733 | JGI25164J39214_1000225 | |||
| 734 | JGI25165J46597_1000291 | |||
| 735 | rootL2_10071690 | |||
| 736 | rootL2_10105701 | |||
| 737 | Ga0055538_1000267 | |||
| 738 | Ga0055539_1000295 | |||
| 739 | Ga0055533_1000065 | |||
| 740 | Ga0055532_1000322 | |||
| 741 | Ga0055525_1000083 | |||
| 742 | Ga0055535_1004161 | |||
| 743 | Ga0055529_1000462 | |||
| 744 | Ga0055530_10000689 | |||
| 745 | Ga0055540_1000535 | |||
| 746 | Ga0055541_1000040 | |||
| 747 | Ga0065714_10000168 | |||
| 748 | Ga0065714_10002357 | |||
| 749 | Ga0065714_10175277 | |||
| 750 | Ga0065714_10503449 | |||
| 751 | Ga0065704_10070617 | |||
| 752 | Ga0065704_10117922 | |||
| 753 | Ga0065704_10258281 | |||
| 754 | Ga0065712_10008795 | |||
| 755 | Ga0065715_10024237 | |||
| 756 | Ga0065715_10689073 | |||
| 757 | Ga0070670_100001525 | |||
| 758 | Ga0070668_100143273 | |||
| 759 | Ga0070669_100293682 | |||
| 760 | Ga0070674_100151358 | |||
| 761 | Ga0070673_100533701 | |||
| 762 | Ga0070667_100076790 | |||
| 763 | Ga0070663_100136478 | |||
| 764 | Ga0070706_100215203 | |||
| 765 | Ga0070706_101719335 | |||
| 766 | Ga0070697_101989901 | |||
| 767 | Ga0075368_10304288 | |||
| 768 | Ga0075364_10043351 | |||
| 769 | Ga0075364_10267456 | |||
| 770 | Ga0075364_10725105 | |||
| 771 | Ga0075432_10037846 | |||
| 772 | Ga0075362_10054820 | |||
| 773 | Ga0075436_100302451 | |||
| 774 | Ga0099823_1035910 | |||
| 775 | Ga0079104_1000580 | |||
| 776 | Ga0079104_1010442 | |||
| 777 | Ga0099826_10003389 | |||
| 778 | Ga0105251_10000400 | |||
| 779 | Ga0105251_10007164 | |||
| 780 | Ga0105251_10011432 | |||
| 781 | Ga0105251_10085373 | |||
| 782 | Ga0105251_10105636 | |||
| 783 | Ga0105251_10164698 | |||
| 784 | Ga0105244_10000571 | |||
| 785 | Ga0105244_10003191 | |||
| 786 | Ga0105244_10008931 | |||
| 787 | Ga0105244_10011441 | |||
| 788 | Ga0105244_10014876 | |||
| 789 | Ga0105244_10017095 | |||
| 790 | Ga0105244_10025821 | |||
| 791 | Ga0105244_10029972 | |||
| 792 | Ga0105244_10037831 | |||
| 793 | Ga0105244_10104872 | |||
| 794 | Ga0105244_10203916 | |||
| 795 | Ga0105244_10220533 | |||
| 796 | Ga0105244_10447917 | |||
| 797 | Ga0105250_10077131 | |||
| 798 | Ga0105250_10082724 | |||
| 799 | Ga0105250_10099084 | |||
| 800 | Ga0105245_10276311 | |||
| 801 | Ga0105243_10000225 | |||
| 802 | Ga0105243_10007889 | |||
| 803 | Ga0105243_10113506 | |||
| 804 | Ga0105243_10228153 | |||
| 805 | Ga0105241_11308807 | |||
| 806 | Ga0105242_10159756 | |||
| 807 | Ga0105242_11218609 | |||
| 808 | Ga0105248_10003881 | |||
| 809 | Ga0105238_10969377 | |||
| 810 | Ga0105249_10009810 | |||
| 811 | Ga0105246_11053400 | |||
| 812 | Ga0157345_1027256 | |||
| 813 | Ga0157373_10000305 | |||
| 814 | Ga0157373_10012441 | |||
| 815 | Ga0157373_10033274 | |||
| 816 | Ga0157373_10237438 | |||
| 817 | Ga0157371_10000648 | |||
| 818 | Ga0157371_10003311 | |||
| 819 | Ga0157371_10003379 | |||
| 820 | Ga0157371_10028415 | |||
| 821 | Ga0157370_10005104 | |||
| 822 | Ga0157370_10055914 | |||
| 823 | Ga0157370_10061179 | |||
| 824 | Ga0157370_10480057 | |||
| 825 | Ga0157369_10001225 | |||
| 826 | Ga0157369_10004980 | |||
| 827 | Ga0157369_10006448 | |||
| 828 | Ga0157369_10033106 | |||
| 829 | Ga0157369_10091235 | |||
| 830 | Ga0157374_10754818 | |||
| 831 | Ga0157378_10773875 | |||
| 832 | Ga0163162_10007954 | |||
| 833 | Ga0163162_10067177 | |||
| 834 | Ga0157372_10003237 | |||
| 835 | Ga0157372_10584345 | |||
| 836 | Ga0157375_10001163 | |||
| 837 | Ga0157375_10004898 | |||
| 838 | Ga0157375_10234817 | |||
| 839 | Ga0157375_11769486 | |||
| 840 | Ga0163163_11878591 | |||
| 841 | Ga0182008_10019749 | |||
| 842 | Ga0157379_11548530 | |||
| 843 | Ga0182006_1001648 | |||
| 844 | Ga0182006_1001723 | |||
| 845 | Ga0182006_1021586 | |||
| 846 | Ga0182006_1060333 | |||
| 847 | Ga0182006_1082202 | |||
| 848 | Ga0182007_10000375 | |||
| 849 | Ga0182005_1001375 | |||
| 850 | Ga0182005_1265821 | |||
| 851 | Ga0163161_10025875 | |||
| 852 | Ga0163161_10052410 | |||
| 853 | Ga0163161_10239656 | |||
| 854 | Ga0163161_10491405 | |||
| 855 | Ga0163161_10492032 | |||
| 856 | Ga0163161_11455665 | |||
| 857 | Ga0213876_10426534 | |||
| 858 | Ga0213875_10275436 | |||
| 859 | Ga0209435_101590 | |||
| 860 | Ga0209760_100031 | |||
| 861 | Ga0209784_100028 | |||
| 862 | Ga0209566_100028 | |||
| 863 | Ga0209674_100047 | |||
| 864 | Ga0209147_100031 | |||
| 865 | Ga0209563_100050 | |||
| 866 | Ga0207427_100067 | |||
| 867 | Ga0209437_100016 | |||
| 868 | Ga0209258_100170 | |||
| 869 | Ga0209646_1000444 | |||
| 870 | Ga0209677_100029 | |||
| 871 | Ga0209759_1020143 | |||
| 872 | Ga0209233_1000156 | |||
| 873 | Ga0209455_1000121 | |||
| 874 | Ga0209676_1000426 | |||
| 875 | Ga0209676_1000534 | |||
| 876 | Ga0209050_1001272 | |||
| 877 | Ga0209051_1000206 | |||
| 878 | Ga0209257_1013385 | |||
| 879 | Ga0207696_1034388 | |||
| 880 | Ga0207696_1047951 | |||
| 881 | Ga0207696_1049995 | |||
| 882 | Ga0207696_1075538 | |||
| 883 | Ga0207655_1000014 | |||
| 884 | Ga0207655_1000532 | |||
| 885 | Ga0207655_1000715 | |||
| 886 | Ga0207655_1002812 | |||
| 887 | Ga0207655_1003033 | |||
| 888 | Ga0207655_1005774 | |||
| 889 | Ga0207655_1009120 | |||
| 890 | Ga0207655_1017777 | |||
| 891 | Ga0207655_1027401 | |||
| 892 | Ga0207655_1057534 | |||
| 893 | Ga0207655_1093252 | |||
| 894 | Ga0207713_1000540 | |||
| 895 | Ga0207713_1001991 | |||
| 896 | Ga0207713_1004877 | |||
| 897 | Ga0207713_1018289 | |||
| 898 | Ga0207713_1029199 | |||
| 899 | Ga0207713_1076410 | |||
| 900 | Ga0207713_1076906 | |||
| 901 | Ga0207713_1076924 | |||
| 902 | Ga0207680_10142542 | |||
| 903 | Ga0207681_10301372 | |||
| 904 | Ga0207681_10998270 | |||
| 905 | Ga0207694_10664415 | |||
| 906 | Ga0207650_10000073 | |||
| 907 | Ga0207687_10451196 | |||
| 908 | Ga0207706_10736066 | |||
| 909 | Ga0207686_10073608 | |||
| 910 | Ga0207709_10000366 | |||
| 911 | Ga0207709_10003976 | |||
| 912 | Ga0207709_10096013 | |||
| 913 | Ga0207709_10142204 | |||
| 914 | Ga0207669_10261762 | |||
| 915 | Ga0207711_10025731 | |||
| 916 | Ga0207651_10471496 | |||
| 917 | Ga0207712_10023432 | |||
| 918 | Ga0207668_10579152 | |||
| 919 | Ga0207658_10226620 | |||
| 920 | Ga0207678_10463169 | |||
| 921 | Ga0209281_1000033 | |||
| 922 | Ga0209281_1005381 | |||
| 923 | Ga0209371_1000132 | |||
| 924 | Ga0209371_1040546 | |||
| 925 | Ga0209983_1018121 | |||
| 926 | Ga0209813_10220940 | |||
| 927 | Ga0207428_10024625 | |||
| 928 | Ga0207428_10388827 | |||
| 929 | Ga0307517_10088988 | |||
| 930 | Ga0268256_1000106 | |||
| 931 | Ga0268256_1040738 | |||
| 932 | Ga0307511_10344644 | |||
| 933 | Ga0316179_1050601 | |||
| 934 | Ga0316178_1092012 | |||
| 935 | Ga0316181_1054663 | |||
| 936 | Ga0307513_10808783 | |||
| 937 | Ga0307408_100000441 | |||
| 938 | Ga0307408_100008474 | |||
| 939 | Ga0307408_100497761 | |||
| 940 | Ga0307408_100575022 | |||
| 941 | Ga0307405_10001479 | |||
| 942 | Ga0307405_10001499 | |||
| 943 | Ga0307413_10003987 | |||
| 944 | Ga0307407_10025104 | |||
| 945 | Ga0307407_10125928 | |||
| 946 | Ga0307407_10826770 | |||
| 947 | Ga0307412_10069557 | |||
| 948 | Ga0307412_10194867 | |||
| 949 | Ga0307412_10437167 | |||
| 950 | Ga0307412_11674299 | |||
| 951 | Ga0307409_100016056 | |||
| 952 | Ga0307409_100441029 | |||
| 953 | Ga0307414_10020180 | |||
| 954 | Ga0307414_10063624 | |||
| 955 | Ga0307414_10240318 | |||
| 956 | Ga0307414_10670352 | |||
| 957 | Ga0307411_10035304 | |||
| 958 | Ga0307411_10050653 | |||
| 959 | Ga0307411_10069651 | |||
| 960 | Ga0307411_11602616 | |||
| 961 | Ga0395899_0977378 | |||
| 962 | Ga0395901_0000104 | |||
| 963 | Ga0436365_0722690 | |||
| 964 | Ga0436365_0849926 | |||
| 965 | Ga0436365_1762761 | |||
| 966 | Ga0436363_0386876 | |||
| 967 | Ga0439438_001139 | |||
| 968 | Ga0439438_002917 | |||
| 969 | Ga0439438_003496 | |||
| 970 | Ga0439438_004112 | |||
| 971 | Ga0439447_001552 | |||
| 972 | Ga0439447_040188 | |||
| 973 | Ga0439466_0000583 | |||
| 974 | Ga0439466_0026609 | |||
| 975 | Ga0439466_0027776 | |||
| 976 | Ga0439466_0071565 | |||
| 977 | Ga0439465_0027238 | |||
| 978 | Ga0451853_2768710 | |||
| 979 | Ga0439431_0010901 | |||
| 980 | Ga0439437_033836 | |||
| 981 | Ga0439445_0014600 | |||
| 982 | Ga0439432_000348 | |||
| 983 | Ga0439432_001422 | |||
| 984 | Ga0439432_009369 | |||
| 985 | Ga0439432_010453 | |||
| 986 | Ga0439432_013098 | |||
| 987 | Ga0439451_000192 | |||
| 988 | Ga0439451_006417 | |||
| 989 | Ga0439451_043929 | |||
| 990 | Ga0439452_000305 | |||
| 991 | Ga0439452_005591 | |||
| 992 | Ga0439452_005880 | |||
| 993 | Ga0439452_016975 | |||
| 994 | Ga0439452_036581 | |||
| 995 | Ga0439456_000241 | |||
| 996 | Ga0439456_000432 | |||
| 997 | Ga0439456_005222 | |||
| 998 | Ga0439463_001213 | |||
| 999 | Ga0439463_090512 | |||
| 1000 | Ga0450911_000337 | |||
| 1001 | Ga0450911_003294 | |||
| 1002 | Ga0450911_016176 | |||
| 1003 | Ga0450913_015191 | |||
| 1004 | Ga0450919_000223 | |||
| 1005 | Ga0450922_005326 | |||
| 1006 | Ga0450890_000369 | |||
| 1007 | Ga0450891_008222 | |||
| 1008 | Ga0450902_004446 | |||
| 1009 | Ga0450903_000573 | |||
| 1010 | Ga0450903_025703 | |||
| 1011 | Ga0450903_030546 | |||
| 1012 | Ga0450904_010332 | |||
| 1013 | Ga0450905_000436 | |||
| 1014 | Ga0450906_000124 | |||
| 1015 | Ga0450906_000338 | |||
| 1016 | Ga0450907_000023 | |||
| 1017 | Ga0450907_000787 | |||
| 1018 | Ga0439446_0004604 | |||
| 1019 | Ga0439446_0008441 | |||
| 1020 | Ga0450908_001020 | |||
| 1021 | Ga0450909_001505 | |||
| 1022 | Ga0439434_0000273 | |||
| 1023 | Ga0439464_0146472 | |||
| 1024 | Ga0439460_0000614 | |||
| 1025 | Ga0439460_0001105 | |||
| 1026 | Ga0450916_008376 | |||
| 1027 | Ga0450918_003244 | |||
| 1028 | Ga0450893_0003300 | |||
| 1029 | Ga0439440_0000050 | |||
| 1030 | Ga0439440_0005371 | |||
| 1031 | Ga0495617_000363 | |||
| 1032 | Ga0495617_000371 | |||
| 1033 | Ga0495617_026399 | |||
| 1034 | Ga0495617_067533 | |||
| 1035 | Ga0495603_0009093 | |||
| 1036 | Ga0495603_0044482 | |||
| 1037 | Ga0495603_0045469 | |||
| 1038 | Ga0495603_0128046 | |||
| 1039 | Ga0495603_0197221 | |||
| 1040 | Ga0495603_0229056 | |||
| 1041 | Ga0495590_0001079 | |||
| 1042 | Ga0495629_0034430 | |||
| 1043 | Ga0495638_0002915 | |||
| 1044 | Ga0495638_0052289 | |||
| 1045 | Ga0495638_0084307 | |||
| 1046 | Ga0495638_0092042 | |||
| 1047 | Ga0495653_0117764 | |||
| 1048 | Ga0495650_0002941 | |||
| 1049 | Ga0495650_0015898 | |||
| 1050 | Ga0495650_0018217 | |||
| 1051 | Ga0495582_0035562 | |||
| 1052 | Ga0495605_0003506 | |||
| 1053 | Ga0495605_0005872 | |||
| 1054 | Ga0495605_0026626 | |||
| 1055 | Ga0495605_0033403 | |||
| 1056 | Ga0495605_0202088 | |||
| 1057 | Ga0495639_0000045 | |||
| 1058 | Ga0495639_0105608 | |||
| 1059 | Ga0495662_0653983 | |||
| 1060 | Ga0495584_0001998 | |||
| 1061 | Ga0495584_0003975 | |||
| 1062 | Ga0495584_0006645 | |||
| 1063 | Ga0495584_0007777 | |||
| 1064 | Ga0495584_0012231 | |||
| 1065 | Ga0495584_0021527 | |||
| 1066 | Ga0495584_0026174 | |||
| 1067 | Ga0495584_0144166 | |||
| 1068 | Ga0495585_0032252 | |||
| 1069 | Ga0495585_0055389 | |||
| 1070 | Ga0495585_0119189 | |||
| 1071 | Ga0495594_0002459 | |||
| 1072 | Ga0495594_0025858 | |||
| 1073 | Ga0495594_0033128 | |||
| 1074 | Ga0495594_0055182 | |||
| 1075 | Ga0495594_0160638 | |||
| 1076 | Ga0495594_0334405 | |||
| 1077 | Ga0495594_0553012 | |||
| 1078 | Ga0495607_0000273 | |||
| 1079 | Ga0495607_0001088 | |||
| 1080 | Ga0495607_0005119 | |||
| 1081 | Ga0495607_0068632 | |||
| 1082 | Ga0495607_0089148 | |||
| 1083 | Ga0495607_0100942 | |||
| 1084 | Ga0495607_0121022 | |||
| 1085 | Ga0495607_0140437 | |||
| 1086 | Ga0495607_0411387 | |||
| 1087 | Ga0495583_0000235 | |||
| 1088 | Ga0495583_0000683 | |||
| 1089 | Ga0495583_0023624 | |||
| 1090 | Ga0495583_0266333 | |||
| 1091 | Ga0495606_0000524 | |||
| 1092 | Ga0495606_0001283 | |||
| 1093 | Ga0495606_0274833 | |||
| 1094 | Ga0495606_0328021 | |||
| 1095 | Ga0495610_0005206 | |||
| 1096 | Ga0495610_0093603 | |||
| 1097 | Ga0495610_0190175 | |||
| 1098 | Ga0495616_0001582 | |||
| 1099 | Ga0495616_0002190 | |||
| 1100 | Ga0495616_0011118 | |||
| 1101 | Ga0495630_0213130 | |||
| 1102 | Ga0495631_0040010 | |||
| 1103 | Ga0495631_0088451 | |||
| 1104 | Ga0495631_0213587 | |||
| 1105 | Ga0495632_0000408 | |||
| 1106 | Ga0495632_0001886 | |||
| 1107 | Ga0495632_0002087 | |||
| 1108 | Ga0495637_0000087 | |||
| 1109 | Ga0495637_0001534 | |||
| 1110 | Ga0495637_0001573 | |||
| 1111 | Ga0495637_0008137 | |||
| 1112 | Ga0495643_0000159 | |||
| 1113 | Ga0495643_0001221 | |||
| 1114 | Ga0495643_0002132 | |||
| 1115 | Ga0495643_0012769 | |||
| 1116 | Ga0495643_0020971 | |||
| 1117 | Ga0495643_0026151 | |||
| 1118 | Ga0495643_0163039 | |||
| 1119 | Ga0495643_0371837 | |||
| 1120 | Ga0495644_0147657 | |||
| 1121 | Ga0495648_0000614 | |||
| 1122 | Ga0495648_0028290 | |||
| 1123 | Ga0495648_0084935 | |||
| 1124 | Ga0495648_0168199 | |||
| 1125 | Ga0495666_0011607 | |||
| 1126 | Ga0495666_0035748 | |||
| 1127 | Ga0495666_0038203 | |||
| 1128 | Ga0495666_0057758 | |||
| 1129 | Ga0495642_0000051 | |||
| 1130 | Ga0495642_0064991 | |||
| 1131 | Ga0495642_0284342 | |||
| 1132 | Ga0495654_0000074 | |||
| 1133 | Ga0495654_0002203 | |||
| 1134 | Ga0495654_0023690 | |||
| 1135 | Ga0495654_0025879 | |||
| 1136 | Ga0495654_0027841 | |||
| 1137 | Ga0495665_0074862 | |||
| 1138 | Ga0495665_0077400 | |||
| 1139 | Ga0495640_0146020 | |||
| 1140 | Ga0495586_0061144 | |||
| 1141 | Ga0495587_0010667 | |||
| 1142 | Ga0495609_0000469 | |||
| 1143 | Ga0495609_0002380 | |||
| 1144 | Ga0495597_0000254 | |||
| 1145 | Ga0495597_0005584 | |||
| 1146 | Ga0495597_0015136 | |||
| 1147 | Ga0495597_0021670 | |||
| 1148 | Ga0495597_0031403 | |||
| 1149 | Ga0495597_0141116 | |||
| 1150 | Ga0495622_0000501 | |||
| 1151 | Ga0495622_0002067 | |||
| 1152 | Ga0495622_0004949 | |||
| 1153 | Ga0495622_0010144 | |||
| 1154 | Ga0495622_0035044 | |||
| 1155 | Ga0495622_0035169 | |||
| 1156 | Ga0495622_0050145 | |||
| 1157 | Ga0495622_0383772 | |||
| 1158 | Ga0495622_0493528 | |||
| 1159 | Ga0495633_0025551 | |||
| 1160 | Ga0495633_0306715 | |||
| 1161 | Ga0495656_0206660 | |||
| 1162 | Ga0495668_0099915 | |||
| 1163 | Ga0495634_0105447 | |||
| 1164 | Ga0495611_0130712 | |||
| 1165 | Ga0495611_0155004 | |||
| 1166 | Ga0495611_0185232 | |||
| 1167 | Ga0495625_0034662 | |||
| 1168 | Ga0495625_0057705 | |||
| 1169 | Ga0495625_0132388 | |||
| 1170 | Ga0495625_0418118 | |||
| 1171 | Ga0495625_0419737 | |||
| 1172 | Ga0495659_0000509 | |||
| 1173 | Ga0495659_0006077 | |||
| 1174 | Ga0495659_0047930 | |||
| 1175 | Ga0495661_0040249 | |||
| 1176 | Ga0495661_0297219 | |||
| 1177 | Ga0495661_0398636 | |||
| 1178 | Ga0495588_0097152 | |||
| 1179 | Ga0495588_0109494 | |||
| 1180 | Ga0495588_0117281 | |||
| 1181 | Ga0495588_0136978 | |||
| 1182 | Ga0495588_0359982 | |||
| 1183 | Ga0495588_0392847 | |||
| 1184 | Ga0495623_0060019 | |||
| 1185 | Ga0495623_0072382 | |||
| 1186 | Ga0495624_0005841 | |||
| 1187 | Ga0495670_0000711 | |||
| 1188 | Ga0495670_0028001 | |||
| 1189 | Ga0495670_0057440 | |||
| 1190 | Ga0495670_0090287 | |||
| 1191 | Ga0495670_0155327 | |||
| 1192 | Ga0495671_0001196 | |||
| 1193 | Ga0495671_0001566 | |||
| 1194 | Ga0495671_0004836 | |||
| 1195 | Ga0495671_0030582 | |||
| 1196 | Ga0495649_0000222 | |||
| 1197 | Ga0495649_0000280 | |||
| 1198 | Ga0495649_0005636 | |||
| 1199 | Ga0495649_0343995 | |||
| 1200 | Ga0495589_0000348 | |||
| 1201 | Ga0495589_0066218 | |||
| 1202 | Ga0495589_0552448 | |||
| 1203 | Ga0495600_0074589 | |||
| 1204 | Ga0495600_0601768 | |||
| 1205 | Ga0495660_0030729 | |||
| 1206 | Ga0495660_0048036 | |||
| 1207 | Ga0495660_0080791 | |||
| 1208 | Ga0495660_0082272 | |||
| 1209 | Ga0495660_0160510 | |||
| 1210 | Ga0495581_0068503 | |||
| 1211 | Ga0495581_0073787 | |||
| 1212 | Ga0495581_0085768 | |||
| 1213 | Ga0495581_0099111 | |||
| 1214 | Ga0495604_0309277 | |||
| 1215 | Ga0495604_1052332 | |||
| 1216 | Ga0495636_0000564 | |||
| 1217 | Ga0495636_0002822 | |||
| 1218 | Ga0495636_0044635 | |||
| 1219 | Ga0495674_0016113 | |||
| 1220 | Ga0495674_0200025 | |||
| 1221 | Ga0495672_0003116 | |||
| 1222 | Ga0495672_0004114 | |||
| 1223 | Ga0495672_0004346 | |||
| 1224 | Ga0495672_0067356 | |||
| 1225 | Ga0495676_0135387 | |||
| 1226 | Ga0495676_0954859 | |||
| 1227 | Ga0495680_0122709 | |||
| 1228 | Ga0495683_0000542 | |||
| 1229 | Ga0495683_0041062 | |||
| 1230 | Ga0495683_0094916 | |||
| 1231 | Ga0495687_000721 | |||
| 1232 | Ga0495687_009090 | |||
| 1233 | Ga0495687_145260 | |||
| 1234 | Ga0495677_0001398 | |||
| 1235 | Ga0495677_0013090 | |||
| 1236 | Ga0495677_0067007 | |||
| 1237 | Ga0495679_030984 | |||
| 1238 | Ga0495679_038725 | |||
| 1239 | Ga0495685_070349 | |||
| 1240 | Ga0495685_168788 | |||
| 1241 | Ga0495673_0000236 | |||
| 1242 | Ga0495673_0001540 | |||
| 1243 | Ga0495673_0001969 | |||
| 1244 | Ga0495673_0013858 | |||
| 1245 | Ga0495673_0029929 | |||
| 1246 | Ga0495681_0000171 | |||
| 1247 | Ga0495681_0004947 | |||
| 1248 | Ga0495681_0016962 | |||
| 1249 | Ga0495681_0083492 | |||
| 1250 | Ga0495681_0248804 | |||
| 1251 | Ga0495686_0137430 | |||
| 1252 | Ga0495593_0024700 | |||
| 1253 | Ga0495593_0079587 | |||
| 1254 | Ga0495593_0317806 | |||
| 1255 | Ga0495626_0002512 | |||
| 1256 | Ga0495626_0018502 | |||
| 1257 | Ga0495626_0040051 | |||
| 1258 | Ga0495626_0057883 | |||
| 1259 | Ga0496102_0015332 | |||
| 1260 | Ga0496104_0265523 | |||
| 1261 | Ga0496105_0175587 | |||
| 1262 | Ga0496106_0162397 | |||
| 1263 | Ga0496107_0521854 | |||
| 1264 | Ga0496111_0821883 | |||
| 1265 | Ga0496114_0024698 | |||
| 1266 | Ga0496114_0037718 | |||
| 1267 | Ga0496115_0014669 | |||
| 1268 | Ga0496115_0363825 | |||
| 1269 | Ga0496115_0385167 | |||
| 1270 | Ga0496115_0528345 | |||
| 1271 | Ga0496115_0877530 | |||
| 1272 | Ga0496116_0000338 | |||
| 1273 | Ga0496116_0001034 | |||
| 1274 | Ga0496116_0078254 | |||
| 1275 | Ga0496117_0004165 | |||
| 1276 | Ga0496117_0004412 | |||
| 1277 | Ga0496117_0005165 | |||
| 1278 | Ga0496117_0079192 | |||
| 1279 | Ga0496118_0002192 | |||
| 1280 | Ga0496118_0414863 | |||
| 1281 | Ga0496119_0000652 | |||
| 1282 | Ga0496119_0057393 | |||
| 1283 | Ga0496120_0010240 | |||
| 1284 | Ga0496120_0050162 | |||
| 1285 | Ga0496121_0000713 | |||
| 1286 | Ga0496121_0075092 | |||
| 1287 | Ga0496121_0191894 | |||
| 1288 | Ga0496122_0001163 | |||
| 1289 | Ga0496122_0006952 | |||
| 1290 | Ga0496122_0163841 | |||
| 1291 | Ga0496122_0182475 | |||
| 1292 | Ga0496123_0002157 | |||
| 1293 | Ga0496123_0003594 | |||
| 1294 | Ga0496124_0001078 | |||
| 1295 | Ga0496124_0018596 | |||
| 1296 | Ga0496124_0050780 | |||
| 1297 | Ga0496124_0112819 | |||
| 1298 | Ga0496124_0149566 | |||
| 1299 | Ga0496124_0294546 | |||
| 1300 | Ga0496125_0035487 | |||
| 1301 | Ga0496125_0041465 | |||
| 1302 | Ga0496125_0043972 | |||
| 1303 | Ga0496125_0060020 | |||
| 1304 | Ga0496126_0009230 | |||
| 1305 | Ga0496126_1267943 | |||
| 1306 | Ga0495678_000979 | |||
| 1307 | Ga0495678_015533 | |||
| 1308 | Ga0495678_068239 | |||
| 1309 | Ga0495682_0029161 | |||
| 1310 | Ga0495682_0186156 | |||
| 1311 | Ga0501241_005235 | |||
| 1312 | nmdc:mga03683_21571_c1 | |||
| 1313 | Ga0500594_0022133 | |||
| 1314 | Ga0500618_000474 | |||
| 1315 | 2510285304 | |||
| 1316 | 2510295886 | |||
| 1317 | 2510313515 | |||
| 1318 | 2511258098 | |||
| 1319 | 2511273180 | |||
| 1320 | 2511324326 | |||
| 1321 | 2511361902 | |||
| 1322 | 2511822666 | |||
| 1323 | 2555667659 | |||
| 1324 | 2597861886 | |||
| 1325 | 2597867619 | |||
| 1326 | 2599356879 | |||
| 1327 | 2599363091 | |||
| 1328 | 2599369957 | |||
| 1329 | 2599376200 | |||
| 1330 | 2599381984 | |||
| 1331 | 2599387872 | |||
| 1332 | 2599395602 | |||
| 1333 | 2599407367 | |||
| 1334 | 2599463712 | |||
| 1335 | 2599468940 | |||
| 1336 | 2599492731 | |||
| 1337 | 2599499900 | |||
| 1338 | 2599506646 | |||
| 1339 | 2599616434 | |||
| 1340 | 2599769632 | |||
| 1341 | 2599887051 | |||
| 1342 | 2599898380 | |||
| 1343 | 2599931111 | |||
| 1344 | 2599944509 | |||
| 1345 | 2599956148 | |||
| 1346 | 2599961126 | |||
| 1347 | 2599964769 | |||
| 1348 | 2599977300 | |||
| 1349 | 2599983086 | |||
| 1350 | 2599991019 | |||
| 1351 | 2599996816 | |||
| 1352 | 2600001109 | |||
| 1353 | 2600011468 | |||
| 1354 | 2600019298 | |||
| 1355 | 2600025094 | |||
| 1356 | 2600031379 | |||
| 1357 | 2600036924 | |||
| 1358 | 2600045150 | |||
| 1359 | 2600048089 | |||
| 1360 | 2600054357 | |||
| 1361 | 2600062573 | |||
| 1362 | 2600066609 | |||
| 1363 | 2600073959 | |||
| 1364 | 2600078333 | |||
| 1365 | 2600216341 | |||
| 1366 | 2600361097 | |||
| 1367 | 2601692562 | |||
| 1368 | 2601776508 | |||
| 1369 | 2624490004 | |||
| 1370 | 2643872400 | |||
| 1371 | 2644189998 | |||
| 1372 | 2644285652 | |||
| 1373 | 2644619910 | |||
| 1374 | 2652545847 | |||
| 1375 | 2671090580 | |||
| 1376 | 2671099732 | |||
| 1377 | 2671129125 | |||
| 1378 | 2678261217 | |||
| 1379 | 2715754111 | |||
| 1380 | 2718632398 | |||
| 1381 | 2723246781 | |||
| 1382 | 2729145610 | |||
| 1383 | 2738807676 | |||
| 1384 | 2738895036 | |||
| 1385 | 2739289519 | |||
| 1386 | 2739294831 | |||
| 1387 | 2745006528 | |||
| 1388 | 2757571041 | |||
| 1389 | 2774119316 | |||
| 1390 | 2774132220 | |||
| 1391 | 2784317096 | |||
| 1392 | 2794594246 | |||
| 1393 | 2807410244 | |||
| 1394 | 2807458592 | |||
| 1395 | 2808858298 | |||
| 1396 | 2808922522 | |||
| 1397 | 2808938435 | |||
| 1398 | 2808944209 | |||
| 1399 | 2808966783 | |||
| 1400 | 2809001617 | |||
| 1401 | 2819705452 | |||
| 1402 | 2825654050 | |||
| 1403 | 2842809967 | |||
| 1404 | 2842831410 | |||
| 1405 | 2842834399 | |||
| 1406 | 2842842355 | |||
| 1407 | 2842846122 | |||
| 1408 | 2912964403 | |||
| 1409 | 2913037499 | |||
| 1410 | 2917071413 | |||
| 1411 | 2917833910 | |||
| 1412 | 2919128430 | |||
| 1413 | 2919158706 | |||
| 1414 | 2919389531 | |||
| 1415 | 2919460228 | |||
| 1416 | 2919486642 | |||
| 1417 | 2919493136 | |||
| 1418 | 2919703893 | |||
| 1419 | 2923591733 | |||
| 1420 | 2929145036 | |||
| 1421 | 2929190510 | |||
| 1422 | 2931371632 | |||
| 1423 | 2935359239 | |||
| 1424 | 2939656528 | |||
| 1425 | 2947235397 | |||
| 1426 | 2974293110 | |||
| 1427 | 2974298785 | |||
| 1428 | 2984501077 | |||
| 1429 | 2984505475 | |||
| 1430 | 2988732424 | |||
| 1431 | 2998140707 | |||
| 1432 | 3007420232 | |||
| 1433 | 3007806568 | |||
| 1434 | 3007859931 | |||
| 1435 | 3007867250 | |||
| 1436 | 3007875804 | |||
| 1437 | 637318052 | |||
| 1438 | 8011355717 | |||
| 1439 | 8016732612 | |||
| 1440 | 8019770532 | |||
| 1441 | 8019782160 | |||
| 1442 | 8030000035 | |||
| 1443 | 8054349912 | |||
| 1444 | 8055880596 | |||
| 1445 | 8056116938 | |||
| 1446 | 8056121490 | |||
| 1447 | 8056132535 | |||
| 1448 | 8056142340 | |||
| 1449 | 8056152698 | |||
| 1450 | 8056158749 | |||
| 1451 | 8056170341 | |||
| 1452 | 8057802939 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6jni-assembly2.cif.gz_D | crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna | 0.9479 | 1 | 127 |
| 7tea-assembly2.cif.gz_C | crystal structure of s. aureus glnr-dna complex | 0.9471 | 1 | 68 |
| 6jyw-assembly1.cif.gz_B | crystal structure of the transcription regulator cadr n81m mutant from p. putida in complex with cadmium(ii) and dna | 0.9468 | 1 | 129 |
| 6jyw-assembly1.cif.gz_A | crystal structure of the transcription regulator cadr n81m mutant from p. putida in complex with cadmium(ii) and dna | 0.9468 | 1 | 129 |
| 6jgx-assembly1.cif.gz_B | crystal structure of the transcriptional regulator cadr from p. putida in complex with cadmium(ii) and dna | 0.9433 | 1 | 127 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P33358_1_73_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9406 | 1 | 68 | 1.10.1660.10 |
| 3hh0C01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9255 | 1 | 68 | 1.10.1660.10 |
| 4wlwA00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9239 | 2 | 131 | 1.10.1660.10 |
| 4r4eA00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9228 | 1 | 72 | 1.10.1660.10 |
| af_P0ACS5_1_128_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.9201 | 1 | 123 | 1.10.1660.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3M4CLW0-F1-model_v4 | deleted | 0.9818 | 1 | 112 |
|
| AF-A0A013WWI6-F1-model_v4 | MerR family transcriptional regulator | 0.9752 | 1 | 129 |
GO:0003677
GO:0003700 GO:0005507 GO:0005737 GO:0045893 |
| AF-A0A3M4CLW0-F1-model_v4 | deleted | 0.9733 | 1 | 112 |
|
| AF-A0A158M7L9-F1-model_v4 | Cu(I)-responsive transcriptional regulator | 0.9726 | 1 | 127 |
GO:0003677
GO:0003700 GO:0005507 GO:0005737 GO:0045893 |
| AF-A0A2S8GVA1-F1-model_v4 | deleted | 0.9723 | 1 | 128 |
|