F477705
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 726 | 318 | 1452 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300048927|Ga0496124_0000129|Ga0496124_0000129_144766_145221 |
| Length | 151 |
| Sequence | MAMRRYPRASIISASAAPMAEIPDAAIVEEKFLAATGPGGQNVNKVATAVQLRIDVFRLGLSPYAYERLKELAGTRMTSAGELLITARQYRTQDANRTDARQRLSDLIDKAHERQARRVKTKPSKAAKXRRVDAKKGRSVVKAGRGKVSFD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 13 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 14 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 17 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 21 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 26 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 27 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 72 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 78 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 107 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 111 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 116 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 118 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 183 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 187 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 188 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 189 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 190 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 192 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 193 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 194 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 195 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 203 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 206 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 207 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 208 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 209 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 211 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 212 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 213 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 218 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 219 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 220 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 221 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 222 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 276 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 277 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 278 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 279 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 284 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 285 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 288 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 289 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 290 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 291 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 292 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 293 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 294 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 295 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 296 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 297 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 298 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 299 | 3300053144 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere | Metagenome | Endosphere |
| 300 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 301 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 302 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 303 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 304 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 305 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 306 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 307 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 309 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 310 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 311 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 312 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 313 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 314 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 315 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 316 | 2928526807 | Sphingomonas trueperi 1770 | Isolate | Rhizosphere |
| 317 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 318 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.76 |
| Metatranscriptomes | 0 |
| Isolates | 1.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.85 |
| Nodule | 0.14 |
| Rhizoplane | 3.17 |
| Rhizosphere | 78.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496124_0000129 | 3300048927 | Bacteria | 156648 |
| 2 | ARcpr5oldR_c011761 | 3300000041 | Bacteria | 748 |
| 3 | ARcpr5yngRDRAFT_c009262 | 3300000043 | Bacteria | 843 |
| 4 | JGI24740J21852_10003761 | 3300001979 | Bacteria | 6606 |
| 5 | JGI24739J22299_10024914 | 3300001989 | Bacteria | 2106 |
| 6 | JGI24737J22298_10000315 | 3300001990 | Bacteria | 16196 |
| 7 | JGI24737J22298_10004866 | 3300001990 | Bacteria | 4657 |
| 8 | JGI24737J22298_10005025 | 3300001990 | Bacteria | 4584 |
| 9 | JGI24737J22298_10034423 | 3300001990 | Bacteria | 1570 |
| 10 | JGI24735J21928_10005077 | 3300002067 | Bacteria | 4380 |
| 11 | JGI24735J21928_10021864 | 3300002067 | Bacteria | 1950 |
| 12 | JGI24735J21928_10051185 | 3300002067 | Bacteria | 1192 |
| 13 | JGI24738J21930_10002201 | 3300002075 | Bacteria | 5187 |
| 14 | JGI24738J21930_10041608 | 3300002075 | Bacteria | 934 |
| 15 | JGI24744J21845_10002683 | 3300002077 | Bacteria | 3628 |
| 16 | JGI25151J46595_10139345 | 3300003187 | Bacteria | 593 |
| 17 | JGI25165J46597_1000040 | 3300003214 | Bacteria | 277491 |
| 18 | JGI25153J46596_10000031 | 3300003215 | Bacteria | 196926 |
| 19 | JGI25153J46596_10000091 | 3300003215 | Bacteria | 105614 |
| 20 | JGI25153J46596_10045061 | 3300003215 | Bacteria | 1320 |
| 21 | rootH2_10005041 | 3300003320 | Bacteria | 1664 |
| 22 | Ga0055525_1000012 | 3300003759 | Bacteria | 486564 |
| 23 | Ga0055542_1000322 | 3300003762 | Bacteria | 51124 |
| 24 | Ga0055529_1000014 | 3300003763 | Bacteria | 367283 |
| 25 | Ga0055526_1003569 | 3300003771 | Bacteria | 9796 |
| 26 | Ga0055537_1001470 | 3300003773 | Bacteria | 9160 |
| 27 | Ga0055537_1001547 | 3300003773 | Bacteria | 8796 |
| 28 | Ga0055524_1001171 | 3300003775 | Bacteria | 15663 |
| 29 | Ga0055536_1026317 | 3300003781 | Bacteria | 1634 |
| 30 | Ga0055530_10009450 | 3300003791 | Bacteria | 3746 |
| 31 | Ga0055530_10022076 | 3300003791 | Bacteria | 1860 |
| 32 | Ga0055530_10075464 | 3300003791 | Bacteria | 718 |
| 33 | Ga0055540_1004562 | 3300003792 | Bacteria | 6168 |
| 34 | Ga0055531_10013567 | 3300003794 | Bacteria | 3746 |
| 35 | Ga0055531_10029632 | 3300003794 | Bacteria | 1860 |
| 36 | Ga0065165_1002705 | 3300005262 | Bacteria | 14222 |
| 37 | Ga0065165_1003177 | 3300005262 | Bacteria | 12034 |
| 38 | Ga0065165_1013615 | 3300005262 | Bacteria | 3220 |
| 39 | Ga0065712_10075190 | 3300005290 | Bacteria | 3901 |
| 40 | Ga0065715_10132303 | 3300005293 | Bacteria | 1993 |
| 41 | Ga0070658_10000022 | 3300005327 | Bacteria | 186706 |
| 42 | Ga0070658_10005125 | 3300005327 | Bacteria | 10668 |
| 43 | Ga0070658_10010467 | 3300005327 | Bacteria | 7440 |
| 44 | Ga0070658_11054536 | 3300005327 | Bacteria | 707 |
| 45 | Ga0070676_10004634 | 3300005328 | Bacteria | 7259 |
| 46 | Ga0070676_10009924 | 3300005328 | Bacteria | 5154 |
| 47 | Ga0070676_10223767 | 3300005328 | Bacteria | 1244 |
| 48 | Ga0070676_10770078 | 3300005328 | Bacteria | 708 |
| 49 | Ga0070676_11104862 | 3300005328 | Bacteria | 599 |
| 50 | Ga0070683_100384779 | 3300005329 | Bacteria | 1337 |
| 51 | Ga0070683_100920270 | 3300005329 | Bacteria | 839 |
| 52 | Ga0070670_100011899 | 3300005331 | Bacteria | 7440 |
| 53 | Ga0070670_100025648 | 3300005331 | Bacteria | 5071 |
| 54 | Ga0070670_100234775 | 3300005331 | Bacteria | 1596 |
| 55 | Ga0070670_100466931 | 3300005331 | Bacteria | 1120 |
| 56 | Ga0070677_10085291 | 3300005333 | Bacteria | 1362 |
| 57 | Ga0068869_100000467 | 3300005334 | Bacteria | 22352 |
| 58 | Ga0070666_10054920 | 3300005335 | Bacteria | 2687 |
| 59 | Ga0070666_10062800 | 3300005335 | Bacteria | 2517 |
| 60 | Ga0070680_100169757 | 3300005336 | Bacteria | 1835 |
| 61 | Ga0068868_100000092 | 3300005338 | Bacteria | 55036 |
| 62 | Ga0068868_100442712 | 3300005338 | Bacteria | 1129 |
| 63 | Ga0070660_100000751 | 3300005339 | Bacteria | 21524 |
| 64 | Ga0070660_100003262 | 3300005339 | Bacteria | 11132 |
| 65 | Ga0070660_100056773 | 3300005339 | Bacteria | 3030 |
| 66 | Ga0070660_100357805 | 3300005339 | Bacteria | 1203 |
| 67 | Ga0070660_100541547 | 3300005339 | Bacteria | 971 |
| 68 | Ga0070661_100000130 | 3300005344 | Bacteria | 62986 |
| 69 | Ga0070661_100033253 | 3300005344 | Bacteria | 3735 |
| 70 | Ga0070661_100164048 | 3300005344 | Bacteria | 1684 |
| 71 | Ga0070661_100236900 | 3300005344 | Bacteria | 1404 |
| 72 | Ga0070692_10001368 | 3300005345 | Bacteria | 8801 |
| 73 | Ga0070692_10061516 | 3300005345 | Bacteria | 1979 |
| 74 | Ga0070668_100000906 | 3300005347 | Bacteria | 20637 |
| 75 | Ga0070668_100022772 | 3300005347 | Bacteria | 4736 |
| 76 | Ga0070668_100029073 | 3300005347 | Bacteria | 4196 |
| 77 | Ga0070668_101124712 | 3300005347 | Bacteria | 710 |
| 78 | Ga0070669_100009672 | 3300005353 | Bacteria | 6867 |
| 79 | Ga0070669_100107486 | 3300005353 | Bacteria | 2113 |
| 80 | Ga0070669_100409854 | 3300005353 | Bacteria | 1110 |
| 81 | Ga0070675_100095820 | 3300005354 | Bacteria | 2492 |
| 82 | Ga0070675_100151839 | 3300005354 | Bacteria | 1986 |
| 83 | Ga0070675_100364353 | 3300005354 | Bacteria | 1284 |
| 84 | Ga0070671_100020082 | 3300005355 | Bacteria | 5443 |
| 85 | Ga0070674_100000035 | 3300005356 | Bacteria | 60166 |
| 86 | Ga0070674_100000329 | 3300005356 | Bacteria | 23441 |
| 87 | Ga0070674_100714248 | 3300005356 | Bacteria | 858 |
| 88 | Ga0070673_100000009 | 3300005364 | Bacteria | 155005 |
| 89 | Ga0070673_100005666 | 3300005364 | Bacteria | 8024 |
| 90 | Ga0070673_100256013 | 3300005364 | Bacteria | 1527 |
| 91 | Ga0070659_100048117 | 3300005366 | Bacteria | 3348 |
| 92 | Ga0070659_100140735 | 3300005366 | Bacteria | 1964 |
| 93 | Ga0070659_100149520 | 3300005366 | Bacteria | 1904 |
| 94 | Ga0070659_100427247 | 3300005366 | Bacteria | 1121 |
| 95 | Ga0070659_100452625 | 3300005366 | Bacteria | 1089 |
| 96 | Ga0070659_102158394 | 3300005366 | Bacteria | 501 |
| 97 | Ga0070667_100000641 | 3300005367 | Bacteria | 33965 |
| 98 | Ga0070667_100002416 | 3300005367 | Bacteria | 16338 |
| 99 | Ga0070667_100018960 | 3300005367 | Bacteria | 5704 |
| 100 | Ga0070667_100203038 | 3300005367 | Bacteria | 1759 |
| 101 | Ga0070667_100603514 | 3300005367 | Bacteria | 1011 |
| 102 | Ga0070663_100009984 | 3300005455 | Bacteria | 5902 |
| 103 | Ga0070663_100086230 | 3300005455 | Bacteria | 2318 |
| 104 | Ga0070663_101402580 | 3300005455 | Bacteria | 619 |
| 105 | Ga0070678_100000060 | 3300005456 | Bacteria | 39901 |
| 106 | Ga0070678_100009721 | 3300005456 | Bacteria | 5843 |
| 107 | Ga0070678_100480004 | 3300005456 | Bacteria | 1094 |
| 108 | Ga0070662_100010272 | 3300005457 | Bacteria | 6137 |
| 109 | Ga0070662_100010751 | 3300005457 | Bacteria | 6024 |
| 110 | Ga0070662_100098202 | 3300005457 | Bacteria | 2211 |
| 111 | Ga0070662_100397579 | 3300005457 | Bacteria | 1137 |
| 112 | Ga0070662_100480689 | 3300005457 | Bacteria | 1034 |
| 113 | Ga0070681_10015840 | 3300005458 | Bacteria | 7516 |
| 114 | Ga0070681_10107967 | 3300005458 | Bacteria | 2724 |
| 115 | Ga0070681_10587461 | 3300005458 | Bacteria | 1028 |
| 116 | Ga0070681_10729352 | 3300005458 | Bacteria | 907 |
| 117 | Ga0068867_100000002 | 3300005459 | Bacteria | 247206 |
| 118 | Ga0068867_100004940 | 3300005459 | Bacteria | 9396 |
| 119 | Ga0068867_101384863 | 3300005459 | Bacteria | 652 |
| 120 | Ga0070679_100000021 | 3300005530 | Bacteria | 124652 |
| 121 | Ga0070679_100637845 | 3300005530 | Bacteria | 1008 |
| 122 | Ga0070684_101007723 | 3300005535 | Bacteria | 782 |
| 123 | Ga0068853_100038814 | 3300005539 | Bacteria | 4058 |
| 124 | Ga0068853_100089389 | 3300005539 | Bacteria | 2705 |
| 125 | Ga0068853_100114747 | 3300005539 | Bacteria | 2396 |
| 126 | Ga0068853_100144186 | 3300005539 | Bacteria | 2139 |
| 127 | Ga0068853_100550260 | 3300005539 | Bacteria | 1093 |
| 128 | Ga0070672_100008045 | 3300005543 | Bacteria | 7202 |
| 129 | Ga0070672_100022207 | 3300005543 | Bacteria | 4655 |
| 130 | Ga0070672_100299934 | 3300005543 | Bacteria | 1362 |
| 131 | Ga0070696_100006792 | 3300005546 | Bacteria | 7642 |
| 132 | Ga0070665_100000115 | 3300005548 | Bacteria | 151164 |
| 133 | Ga0070665_100084334 | 3300005548 | Bacteria | 3183 |
| 134 | Ga0070665_100518185 | 3300005548 | Bacteria | 1204 |
| 135 | Ga0068855_100000333 | 3300005563 | Bacteria | 58773 |
| 136 | Ga0068855_100001164 | 3300005563 | Bacteria | 32603 |
| 137 | Ga0068855_100049033 | 3300005563 | Bacteria | 4983 |
| 138 | Ga0068855_100095443 | 3300005563 | Bacteria | 3427 |
| 139 | Ga0068855_100899917 | 3300005563 | Bacteria | 935 |
| 140 | Ga0068855_101844867 | 3300005563 | Unclassified | 613 |
| 141 | Ga0070664_100008107 | 3300005564 | Bacteria | 8491 |
| 142 | Ga0070664_100105053 | 3300005564 | Bacteria | 2460 |
| 143 | Ga0070664_100272568 | 3300005564 | Bacteria | 1525 |
| 144 | Ga0070664_100514718 | 3300005564 | Bacteria | 1104 |
| 145 | Ga0068857_100004444 | 3300005577 | Bacteria | 11862 |
| 146 | Ga0068854_100000380 | 3300005578 | Bacteria | 28213 |
| 147 | Ga0068854_100025690 | 3300005578 | Bacteria | 4041 |
| 148 | Ga0068854_100119227 | 3300005578 | Bacteria | 2001 |
| 149 | Ga0068854_100241662 | 3300005578 | Bacteria | 1438 |
| 150 | Ga0068854_101001322 | 3300005578 | Bacteria | 740 |
| 151 | Ga0068856_100013110 | 3300005614 | Bacteria | 8029 |
| 152 | Ga0068856_100031423 | 3300005614 | Bacteria | 5194 |
| 153 | Ga0068852_100001302 | 3300005616 | Bacteria | 16691 |
| 154 | Ga0068852_100347958 | 3300005616 | Bacteria | 1446 |
| 155 | Ga0068859_100012317 | 3300005617 | Bacteria | 8605 |
| 156 | Ga0068859_100160863 | 3300005617 | Bacteria | 2324 |
| 157 | Ga0068859_100237719 | 3300005617 | Bacteria | 1910 |
| 158 | Ga0068859_100622361 | 3300005617 | Bacteria | 1172 |
| 159 | Ga0068859_100726087 | 3300005617 | Bacteria | 1083 |
| 160 | Ga0068864_100000016 | 3300005618 | Bacteria | 292454 |
| 161 | Ga0068864_100380181 | 3300005618 | Bacteria | 1338 |
| 162 | Ga0068864_100399098 | 3300005618 | Bacteria | 1306 |
| 163 | Ga0068851_10012325 | 3300005834 | Bacteria | 4027 |
| 164 | Ga0068851_10438833 | 3300005834 | Bacteria | 774 |
| 165 | Ga0068863_100000047 | 3300005841 | Bacteria | 140249 |
| 166 | Ga0068863_100000089 | 3300005841 | Bacteria | 101645 |
| 167 | Ga0068863_100003668 | 3300005841 | Bacteria | 15161 |
| 168 | Ga0068863_100008189 | 3300005841 | Bacteria | 10212 |
| 169 | Ga0068863_100058002 | 3300005841 | Bacteria | 3664 |
| 170 | Ga0068863_100119831 | 3300005841 | Bacteria | 2508 |
| 171 | Ga0068863_101829075 | 3300005841 | Bacteria | 617 |
| 172 | Ga0068858_100008945 | 3300005842 | Bacteria | 9597 |
| 173 | Ga0068860_100001603 | 3300005843 | Bacteria | 24294 |
| 174 | Ga0068860_100148772 | 3300005843 | Bacteria | 2254 |
| 175 | Ga0068860_100315051 | 3300005843 | Bacteria | 1535 |
| 176 | Ga0068862_100000068 | 3300005844 | Bacteria | 123535 |
| 177 | Ga0068862_100000986 | 3300005844 | Bacteria | 27222 |
| 178 | Ga0081539_10007074 | 3300005985 | Bacteria | 10376 |
| 179 | Ga0075369_10038377 | 3300006186 | Bacteria | 2043 |
| 180 | Ga0097621_100021424 | 3300006237 | Bacteria | 4999 |
| 181 | Ga0068871_100004655 | 3300006358 | Bacteria | 9585 |
| 182 | Ga0068871_100171913 | 3300006358 | Bacteria | 1858 |
| 183 | Ga0068871_100285428 | 3300006358 | Bacteria | 1445 |
| 184 | Ga0068865_100000014 | 3300006881 | Bacteria | 138727 |
| 185 | Ga0068865_100195482 | 3300006881 | Bacteria | 1567 |
| 186 | Ga0068865_100384205 | 3300006881 | Bacteria | 1146 |
| 187 | Ga0068865_100459451 | 3300006881 | Bacteria | 1054 |
| 188 | Ga0068865_100803238 | 3300006881 | Bacteria | 812 |
| 189 | Ga0097620_100012317 | 3300006931 | Bacteria | 8605 |
| 190 | Ga0097620_100160860 | 3300006931 | Bacteria | 2324 |
| 191 | Ga0097620_100237718 | 3300006931 | Bacteria | 1910 |
| 192 | Ga0097620_100622359 | 3300006931 | Bacteria | 1172 |
| 193 | Ga0097620_100726105 | 3300006931 | Bacteria | 1083 |
| 194 | Ga0099826_10111731 | 3300006948 | Bacteria | 1627 |
| 195 | Ga0105251_10001932 | 3300009011 | Bacteria | 16960 |
| 196 | Ga0105240_10004046 | 3300009093 | Bacteria | 22558 |
| 197 | Ga0105240_10038634 | 3300009093 | Bacteria | 6121 |
| 198 | Ga0105240_10051063 | 3300009093 | Bacteria | 5207 |
| 199 | Ga0105240_10282098 | 3300009093 | Bacteria | 1908 |
| 200 | Ga0105245_10001236 | 3300009098 | Bacteria | 23068 |
| 201 | Ga0105245_11816733 | 3300009098 | Bacteria | 662 |
| 202 | Ga0105247_10000985 | 3300009101 | Bacteria | 21464 |
| 203 | Ga0105247_10015646 | 3300009101 | Bacteria | 4541 |
| 204 | Ga0105247_10106888 | 3300009101 | Bacteria | 1796 |
| 205 | Ga0105243_10000070 | 3300009148 | Bacteria | 120851 |
| 206 | Ga0105243_10001791 | 3300009148 | Bacteria | 18449 |
| 207 | Ga0105243_10073758 | 3300009148 | Bacteria | 2766 |
| 208 | Ga0105243_10546149 | 3300009148 | Bacteria | 1106 |
| 209 | Ga0105243_10619836 | 3300009148 | Bacteria | 1044 |
| 210 | Ga0105241_10004388 | 3300009174 | Bacteria | 10429 |
| 211 | Ga0105241_10130977 | 3300009174 | Bacteria | 2031 |
| 212 | Ga0105242_10000273 | 3300009176 | Bacteria | 41098 |
| 213 | Ga0105242_11443763 | 3300009176 | Bacteria | 717 |
| 214 | Ga0105248_10000021 | 3300009177 | Bacteria | 276159 |
| 215 | Ga0105248_10002393 | 3300009177 | Bacteria | 20837 |
| 216 | Ga0105248_10018071 | 3300009177 | Bacteria | 7783 |
| 217 | Ga0105237_10004611 | 3300009545 | Bacteria | 15889 |
| 218 | Ga0105237_10017550 | 3300009545 | Bacteria | 7416 |
| 219 | Ga0105237_10032273 | 3300009545 | Bacteria | 5302 |
| 220 | Ga0105237_10078880 | 3300009545 | Bacteria | 3282 |
| 221 | Ga0105237_11523622 | 3300009545 | Bacteria | 675 |
| 222 | Ga0105238_10080044 | 3300009551 | Bacteria | 3257 |
| 223 | Ga0105238_10118232 | 3300009551 | Bacteria | 2631 |
| 224 | Ga0105238_10558728 | 3300009551 | Bacteria | 1149 |
| 225 | Ga0105249_10000017 | 3300009553 | Bacteria | 277115 |
| 226 | Ga0105249_10001264 | 3300009553 | Bacteria | 22162 |
| 227 | Ga0105249_10001584 | 3300009553 | Bacteria | 19942 |
| 228 | Ga0105249_10288452 | 3300009553 | Bacteria | 1642 |
| 229 | Ga0105249_11992838 | 3300009553 | Bacteria | 653 |
| 230 | Ga0105249_12757113 | 3300009553 | Bacteria | 563 |
| 231 | Ga0105249_13212122 | 3300009553 | Bacteria | 525 |
| 232 | Ga0105239_10000546 | 3300010375 | Bacteria | 53959 |
| 233 | Ga0105239_10038762 | 3300010375 | Bacteria | 5221 |
| 234 | Ga0105239_10686070 | 3300010375 | Bacteria | 1171 |
| 235 | Ga0105239_11258994 | 3300010375 | Bacteria | 853 |
| 236 | Ga0105246_10002662 | 3300011119 | Bacteria | 10819 |
| 237 | Ga0105246_10054421 | 3300011119 | Bacteria | 2758 |
| 238 | Ga0157326_1001062 | 3300012513 | Bacteria | 3100 |
| 239 | Ga0157373_10043654 | 3300013100 | Bacteria | 3202 |
| 240 | Ga0157373_10083098 | 3300013100 | Bacteria | 2257 |
| 241 | Ga0157373_10086011 | 3300013100 | Bacteria | 2216 |
| 242 | Ga0157371_10000193 | 3300013102 | Bacteria | 90182 |
| 243 | Ga0157371_10054006 | 3300013102 | Bacteria | 2854 |
| 244 | Ga0157371_10073640 | 3300013102 | Bacteria | 2419 |
| 245 | Ga0157371_10514372 | 3300013102 | Bacteria | 885 |
| 246 | Ga0157371_10554301 | 3300013102 | Bacteria | 852 |
| 247 | Ga0157371_10863917 | 3300013102 | Bacteria | 684 |
| 248 | Ga0157370_10000117 | 3300013104 | Bacteria | 92168 |
| 249 | Ga0157370_10853360 | 3300013104 | Bacteria | 827 |
| 250 | Ga0157369_10030477 | 3300013105 | Bacteria | 5949 |
| 251 | Ga0157369_10170694 | 3300013105 | Bacteria | 2292 |
| 252 | Ga0157374_10000831 | 3300013296 | Bacteria | 27036 |
| 253 | Ga0157374_10005135 | 3300013296 | Bacteria | 10980 |
| 254 | Ga0157374_10041788 | 3300013296 | Bacteria | 4227 |
| 255 | Ga0157374_10335658 | 3300013296 | Bacteria | 1500 |
| 256 | Ga0157378_10000944 | 3300013297 | Bacteria | 26700 |
| 257 | Ga0163162_10011469 | 3300013306 | Bacteria | 8644 |
| 258 | Ga0157372_10182260 | 3300013307 | Bacteria | 2431 |
| 259 | Ga0157372_10275339 | 3300013307 | Bacteria | 1956 |
| 260 | Ga0157372_10286207 | 3300013307 | Bacteria | 1917 |
| 261 | Ga0157372_10337359 | 3300013307 | Bacteria | 1756 |
| 262 | Ga0157375_10002997 | 3300013308 | Bacteria | 14669 |
| 263 | Ga0157375_10111021 | 3300013308 | Bacteria | 2840 |
| 264 | Ga0157375_10141594 | 3300013308 | Bacteria | 2532 |
| 265 | Ga0163163_10013700 | 3300014325 | Bacteria | 7429 |
| 266 | Ga0163163_10067172 | 3300014325 | Bacteria | 3564 |
| 267 | Ga0163163_12888084 | 3300014325 | Bacteria | 536 |
| 268 | Ga0157377_10026133 | 3300014745 | Bacteria | 3121 |
| 269 | Ga0157379_10151556 | 3300014968 | Bacteria | 2091 |
| 270 | Ga0157376_10000186 | 3300014969 | Bacteria | 43043 |
| 271 | Ga0163161_10261965 | 3300017792 | Bacteria | 1350 |
| 272 | Ga0163161_10308905 | 3300017792 | Bacteria | 1247 |
| 273 | Ga0213875_10419316 | 3300021388 | Bacteria | 639 |
| 274 | Ga0209563_100030 | 3300025230 | Bacteria | 489259 |
| 275 | Ga0207427_100441 | 3300025231 | Bacteria | 23126 |
| 276 | Ga0207425_1000049 | 3300025245 | Bacteria | 180735 |
| 277 | Ga0207425_1008078 | 3300025245 | Bacteria | 2723 |
| 278 | Ga0209026_1000675 | 3300025250 | Bacteria | 20558 |
| 279 | Ga0209677_117223 | 3300025253 | Bacteria | 905 |
| 280 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 281 | Ga0209129_1001668 | 3300025258 | Bacteria | 12020 |
| 282 | Ga0209233_1000003 | 3300025261 | Bacteria | 1607366 |
| 283 | Ga0209565_1000007 | 3300025263 | Bacteria | 784361 |
| 284 | Ga0209565_1000170 | 3300025263 | Bacteria | 84580 |
| 285 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 286 | Ga0209455_1024217 | 3300025272 | Bacteria | 1125 |
| 287 | Ga0209673_1007604 | 3300025273 | Bacteria | 4953 |
| 288 | Ga0209673_1032519 | 3300025273 | Bacteria | 1606 |
| 289 | Ga0209675_1004240 | 3300025291 | Bacteria | 6463 |
| 290 | Ga0209676_1010374 | 3300025292 | Bacteria | 3892 |
| 291 | Ga0209676_1023070 | 3300025292 | Bacteria | 2045 |
| 292 | Ga0209025_1000068 | 3300025294 | Bacteria | 294129 |
| 293 | Ga0209564_1000335 | 3300025295 | Bacteria | 91079 |
| 294 | Ga0209564_1026133 | 3300025295 | Bacteria | 1939 |
| 295 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 296 | Ga0209758_1000004 | 3300025297 | Bacteria | 1375322 |
| 297 | Ga0209758_1018028 | 3300025297 | Bacteria | 3482 |
| 298 | Ga0209758_1054268 | 3300025297 | Bacteria | 1370 |
| 299 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 300 | Ga0209050_1006899 | 3300025298 | Bacteria | 6573 |
| 301 | Ga0209050_1021069 | 3300025298 | Bacteria | 2394 |
| 302 | Ga0209256_1000009 | 3300025299 | Bacteria | 922071 |
| 303 | Ga0209256_1000010 | 3300025299 | Bacteria | 912110 |
| 304 | Ga0207426_1032149 | 3300025302 | Bacteria | 1704 |
| 305 | Ga0207426_1111532 | 3300025302 | Bacteria | 688 |
| 306 | Ga0209051_1000191 | 3300025303 | Bacteria | 108763 |
| 307 | Ga0209051_1071930 | 3300025303 | Bacteria | 1037 |
| 308 | Ga0209257_1003180 | 3300025304 | Bacteria | 14609 |
| 309 | Ga0209257_1003572 | 3300025304 | Bacteria | 13185 |
| 310 | Ga0209257_1003678 | 3300025304 | Bacteria | 12808 |
| 311 | Ga0207697_10126939 | 3300025315 | Bacteria | 1101 |
| 312 | Ga0207656_10084319 | 3300025321 | Bacteria | 1433 |
| 313 | Ga0207656_10348198 | 3300025321 | Bacteria | 739 |
| 314 | Ga0207710_10082022 | 3300025900 | Bacteria | 1497 |
| 315 | Ga0207688_10024275 | 3300025901 | Bacteria | 3324 |
| 316 | Ga0207688_10274284 | 3300025901 | Bacteria | 1026 |
| 317 | Ga0207680_10202815 | 3300025903 | Bacteria | 1352 |
| 318 | Ga0207647_10009257 | 3300025904 | Bacteria | 7004 |
| 319 | Ga0207647_10011528 | 3300025904 | Bacteria | 6195 |
| 320 | Ga0207647_10018578 | 3300025904 | Bacteria | 4697 |
| 321 | Ga0207647_10018802 | 3300025904 | Bacteria | 4661 |
| 322 | Ga0207647_10144287 | 3300025904 | Bacteria | 1394 |
| 323 | Ga0207647_10160000 | 3300025904 | Bacteria | 1314 |
| 324 | Ga0207647_10358421 | 3300025904 | Bacteria | 825 |
| 325 | Ga0207645_10015318 | 3300025907 | Bacteria | 5098 |
| 326 | Ga0207645_10025433 | 3300025907 | Bacteria | 3831 |
| 327 | Ga0207645_10509924 | 3300025907 | Bacteria | 815 |
| 328 | Ga0207645_10664613 | 3300025907 | Bacteria | 708 |
| 329 | Ga0207705_10000042 | 3300025909 | Bacteria | 182120 |
| 330 | Ga0207705_10000188 | 3300025909 | Bacteria | 64247 |
| 331 | Ga0207705_10021287 | 3300025909 | Bacteria | 4626 |
| 332 | Ga0207705_10661603 | 3300025909 | Bacteria | 812 |
| 333 | Ga0207705_10955698 | 3300025909 | Bacteria | 663 |
| 334 | Ga0207654_10000227 | 3300025911 | Bacteria | 34512 |
| 335 | Ga0207707_10013301 | 3300025912 | Bacteria | 7172 |
| 336 | Ga0207707_10130828 | 3300025912 | Bacteria | 2195 |
| 337 | Ga0207707_10286433 | 3300025912 | Bacteria | 1426 |
| 338 | Ga0207695_10003844 | 3300025913 | Bacteria | 20795 |
| 339 | Ga0207695_10015444 | 3300025913 | Bacteria | 8988 |
| 340 | Ga0207695_10028168 | 3300025913 | Bacteria | 6237 |
| 341 | Ga0207695_10083252 | 3300025913 | Bacteria | 3232 |
| 342 | Ga0207695_10091255 | 3300025913 | Bacteria | 3060 |
| 343 | Ga0207671_10004049 | 3300025914 | Bacteria | 14213 |
| 344 | Ga0207671_10012108 | 3300025914 | Bacteria | 6965 |
| 345 | Ga0207671_10036679 | 3300025914 | Bacteria | 3637 |
| 346 | Ga0207671_10044525 | 3300025914 | Bacteria | 3282 |
| 347 | Ga0207660_10003328 | 3300025917 | Bacteria | 10490 |
| 348 | Ga0207662_10355880 | 3300025918 | Bacteria | 984 |
| 349 | Ga0207657_10000900 | 3300025919 | Bacteria | 31430 |
| 350 | Ga0207657_10001241 | 3300025919 | Bacteria | 27265 |
| 351 | Ga0207657_10001555 | 3300025919 | Bacteria | 24617 |
| 352 | Ga0207657_10016697 | 3300025919 | Bacteria | 7074 |
| 353 | Ga0207657_10048500 | 3300025919 | Bacteria | 3708 |
| 354 | Ga0207657_10136202 | 3300025919 | Bacteria | 2009 |
| 355 | Ga0207657_10263111 | 3300025919 | Bacteria | 1372 |
| 356 | Ga0207657_10322123 | 3300025919 | Bacteria | 1222 |
| 357 | Ga0207657_10440642 | 3300025919 | Bacteria | 1023 |
| 358 | Ga0207649_10000134 | 3300025920 | Bacteria | 63335 |
| 359 | Ga0207649_10002240 | 3300025920 | Bacteria | 10928 |
| 360 | Ga0207649_10032880 | 3300025920 | Bacteria | 3095 |
| 361 | Ga0207649_10202905 | 3300025920 | Bacteria | 1402 |
| 362 | Ga0207652_10000047 | 3300025921 | Bacteria | 125286 |
| 363 | Ga0207652_10493523 | 3300025921 | Bacteria | 1103 |
| 364 | Ga0207652_11278017 | 3300025921 | Bacteria | 636 |
| 365 | Ga0207681_10008042 | 3300025923 | Bacteria | 6454 |
| 366 | Ga0207681_10146964 | 3300025923 | Bacteria | 1762 |
| 367 | Ga0207694_10000683 | 3300025924 | Bacteria | 30452 |
| 368 | Ga0207650_10000069 | 3300025925 | Bacteria | 138442 |
| 369 | Ga0207650_10003451 | 3300025925 | Bacteria | 10859 |
| 370 | Ga0207650_10050776 | 3300025925 | Bacteria | 3068 |
| 371 | Ga0207650_10216175 | 3300025925 | Bacteria | 1541 |
| 372 | Ga0207650_10740809 | 3300025925 | Bacteria | 831 |
| 373 | Ga0207659_10112865 | 3300025926 | Bacteria | 2069 |
| 374 | Ga0207659_10240661 | 3300025926 | Bacteria | 1464 |
| 375 | Ga0207659_11431214 | 3300025926 | Bacteria | 592 |
| 376 | Ga0207687_10000252 | 3300025927 | Bacteria | 36302 |
| 377 | Ga0207644_10006505 | 3300025931 | Bacteria | 7618 |
| 378 | Ga0207690_10001286 | 3300025932 | Bacteria | 15851 |
| 379 | Ga0207690_10063454 | 3300025932 | Bacteria | 2519 |
| 380 | Ga0207690_10243567 | 3300025932 | Bacteria | 1386 |
| 381 | Ga0207690_10420538 | 3300025932 | Bacteria | 1069 |
| 382 | Ga0207690_10432323 | 3300025932 | Bacteria | 1055 |
| 383 | Ga0207706_10004012 | 3300025933 | Bacteria | 13933 |
| 384 | Ga0207706_10059349 | 3300025933 | Bacteria | 3369 |
| 385 | Ga0207706_10101956 | 3300025933 | Bacteria | 2525 |
| 386 | Ga0207706_10167689 | 3300025933 | Bacteria | 1930 |
| 387 | Ga0207706_10737468 | 3300025933 | Bacteria | 840 |
| 388 | Ga0207706_10893307 | 3300025933 | Bacteria | 751 |
| 389 | Ga0207686_10001911 | 3300025934 | Bacteria | 11532 |
| 390 | Ga0207709_10000066 | 3300025935 | Bacteria | 189194 |
| 391 | Ga0207709_10000246 | 3300025935 | Bacteria | 66685 |
| 392 | Ga0207709_11099301 | 3300025935 | Bacteria | 653 |
| 393 | Ga0207669_10000030 | 3300025937 | Bacteria | 88341 |
| 394 | Ga0207669_10000615 | 3300025937 | Bacteria | 15477 |
| 395 | Ga0207669_10031379 | 3300025937 | Bacteria | 2968 |
| 396 | Ga0207669_10037347 | 3300025937 | Bacteria | 2786 |
| 397 | Ga0207704_10000002 | 3300025938 | Bacteria | 303025 |
| 398 | Ga0207704_10000007 | 3300025938 | Bacteria | 211230 |
| 399 | Ga0207704_10051567 | 3300025938 | Bacteria | 2489 |
| 400 | Ga0207704_10894299 | 3300025938 | Bacteria | 746 |
| 401 | Ga0207704_11304893 | 3300025938 | Bacteria | 621 |
| 402 | Ga0207691_10008730 | 3300025940 | Bacteria | 9719 |
| 403 | Ga0207691_10087107 | 3300025940 | Bacteria | 2801 |
| 404 | Ga0207691_10134528 | 3300025940 | Bacteria | 2182 |
| 405 | Ga0207691_10233886 | 3300025940 | Bacteria | 1590 |
| 406 | Ga0207691_10290423 | 3300025940 | Bacteria | 1406 |
| 407 | Ga0207711_10000025 | 3300025941 | Bacteria | 289972 |
| 408 | Ga0207711_10020383 | 3300025941 | Bacteria | 5527 |
| 409 | Ga0207711_10429445 | 3300025941 | Bacteria | 1229 |
| 410 | Ga0207689_10000060 | 3300025942 | Bacteria | 85326 |
| 411 | Ga0207689_10083820 | 3300025942 | Bacteria | 2621 |
| 412 | Ga0207679_10038837 | 3300025945 | Bacteria | 3396 |
| 413 | Ga0207679_10042339 | 3300025945 | Bacteria | 3272 |
| 414 | Ga0207679_10240411 | 3300025945 | Bacteria | 1534 |
| 415 | Ga0207667_10000002 | 3300025949 | Bacteria | 895662 |
| 416 | Ga0207667_10000017 | 3300025949 | Bacteria | 390654 |
| 417 | Ga0207667_10002977 | 3300025949 | Bacteria | 21052 |
| 418 | Ga0207667_10016552 | 3300025949 | Bacteria | 8328 |
| 419 | Ga0207667_10038294 | 3300025949 | Bacteria | 5123 |
| 420 | Ga0207667_10104027 | 3300025949 | Bacteria | 2928 |
| 421 | Ga0207667_10436746 | 3300025949 | Bacteria | 1331 |
| 422 | Ga0207651_10000004 | 3300025960 | Bacteria | 290191 |
| 423 | Ga0207651_10023484 | 3300025960 | Bacteria | 3794 |
| 424 | Ga0207651_10061183 | 3300025960 | Bacteria | 2617 |
| 425 | Ga0207712_10000012 | 3300025961 | Bacteria | 392363 |
| 426 | Ga0207712_10001388 | 3300025961 | Bacteria | 16564 |
| 427 | Ga0207712_10412158 | 3300025961 | Bacteria | 1138 |
| 428 | Ga0207712_11105837 | 3300025961 | Bacteria | 705 |
| 429 | Ga0207712_11452804 | 3300025961 | Bacteria | 614 |
| 430 | Ga0207712_12001469 | 3300025961 | Bacteria | 518 |
| 431 | Ga0207668_10000062 | 3300025972 | Bacteria | 88123 |
| 432 | Ga0207668_10000459 | 3300025972 | Bacteria | 25616 |
| 433 | Ga0207668_10124865 | 3300025972 | Bacteria | 1955 |
| 434 | Ga0207640_10000406 | 3300025981 | Bacteria | 27343 |
| 435 | Ga0207640_10001048 | 3300025981 | Bacteria | 15292 |
| 436 | Ga0207640_10006873 | 3300025981 | Bacteria | 6257 |
| 437 | Ga0207640_10045007 | 3300025981 | Bacteria | 2832 |
| 438 | Ga0207640_10064358 | 3300025981 | Bacteria | 2441 |
| 439 | Ga0207640_10213160 | 3300025981 | Bacteria | 1473 |
| 440 | Ga0207658_10000153 | 3300025986 | Bacteria | 72252 |
| 441 | Ga0207658_10000539 | 3300025986 | Bacteria | 34304 |
| 442 | Ga0207658_10006472 | 3300025986 | Bacteria | 7994 |
| 443 | Ga0207658_10124004 | 3300025986 | Bacteria | 2064 |
| 444 | Ga0207677_10000060 | 3300026023 | Bacteria | 93186 |
| 445 | Ga0207677_10088000 | 3300026023 | Bacteria | 2251 |
| 446 | Ga0207677_10402104 | 3300026023 | Bacteria | 1162 |
| 447 | Ga0207677_11225198 | 3300026023 | Bacteria | 687 |
| 448 | Ga0207703_10105168 | 3300026035 | Bacteria | 2399 |
| 449 | Ga0207639_10007346 | 3300026041 | Bacteria | 7508 |
| 450 | Ga0207639_10039093 | 3300026041 | Bacteria | 3533 |
| 451 | Ga0207639_10453273 | 3300026041 | Bacteria | 1165 |
| 452 | Ga0207678_10001389 | 3300026067 | Bacteria | 22281 |
| 453 | Ga0207678_10020196 | 3300026067 | Bacteria | 5849 |
| 454 | Ga0207702_10007341 | 3300026078 | Bacteria | 9416 |
| 455 | Ga0207702_10007866 | 3300026078 | Bacteria | 9038 |
| 456 | Ga0207702_10009078 | 3300026078 | Bacteria | 8367 |
| 457 | Ga0207702_10077149 | 3300026078 | Bacteria | 2881 |
| 458 | Ga0207702_10077668 | 3300026078 | Bacteria | 2872 |
| 459 | Ga0207641_10000079 | 3300026088 | Bacteria | 141110 |
| 460 | Ga0207641_10000103 | 3300026088 | Bacteria | 122350 |
| 461 | Ga0207641_10002442 | 3300026088 | Bacteria | 17185 |
| 462 | Ga0207641_10009618 | 3300026088 | Bacteria | 7967 |
| 463 | Ga0207641_10017602 | 3300026088 | Bacteria | 5851 |
| 464 | Ga0207641_10174726 | 3300026088 | Bacteria | 1963 |
| 465 | Ga0207648_10000003 | 3300026089 | Bacteria | 289983 |
| 466 | Ga0207648_10016583 | 3300026089 | Bacteria | 6725 |
| 467 | Ga0207648_11637483 | 3300026089 | Bacteria | 605 |
| 468 | Ga0207676_10000044 | 3300026095 | Bacteria | 161679 |
| 469 | Ga0207676_10147037 | 3300026095 | Bacteria | 2025 |
| 470 | Ga0207676_10198802 | 3300026095 | Bacteria | 1769 |
| 471 | Ga0207674_10000319 | 3300026116 | Bacteria | 61196 |
| 472 | Ga0207674_10069420 | 3300026116 | Bacteria | 3544 |
| 473 | Ga0207674_10234835 | 3300026116 | Bacteria | 1781 |
| 474 | Ga0207674_12187787 | 3300026116 | Bacteria | 516 |
| 475 | Ga0207675_100051165 | 3300026118 | Bacteria | 3854 |
| 476 | Ga0207683_10000075 | 3300026121 | Bacteria | 77829 |
| 477 | Ga0207683_10004168 | 3300026121 | Bacteria | 12512 |
| 478 | Ga0207683_10015350 | 3300026121 | Bacteria | 6523 |
| 479 | Ga0207683_10233772 | 3300026121 | Bacteria | 1676 |
| 480 | Ga0207683_10876324 | 3300026121 | Bacteria | 833 |
| 481 | Ga0207683_11314041 | 3300026121 | Bacteria | 669 |
| 482 | Ga0207698_10001449 | 3300026142 | Bacteria | 13790 |
| 483 | Ga0207698_10006501 | 3300026142 | Bacteria | 7297 |
| 484 | Ga0207698_10737960 | 3300026142 | Bacteria | 983 |
| 485 | Ga0268266_10000015 | 3300028379 | Bacteria | 630629 |
| 486 | Ga0268266_10378178 | 3300028379 | Bacteria | 1335 |
| 487 | Ga0268266_11071695 | 3300028379 | Bacteria | 780 |
| 488 | Ga0268265_10000125 | 3300028380 | Bacteria | 96710 |
| 489 | Ga0268265_10000754 | 3300028380 | Bacteria | 31429 |
| 490 | Ga0268264_10000347 | 3300028381 | Bacteria | 70884 |
| 491 | Ga0268264_10100845 | 3300028381 | Bacteria | 2508 |
| 492 | Ga0268264_10398544 | 3300028381 | Bacteria | 1322 |
| 493 | Ga0268264_11215153 | 3300028381 | Bacteria | 763 |
| 494 | Ga0307517_10107907 | 3300028786 | Bacteria | 2141 |
| 495 | Ga0307513_10016361 | 3300031456 | Bacteria | 8948 |
| 496 | Ga0307513_10026396 | 3300031456 | Bacteria | 6697 |
| 497 | Ga0307408_100006783 | 3300031548 | Bacteria | 7590 |
| 498 | Ga0307408_100006926 | 3300031548 | Bacteria | 7503 |
| 499 | Ga0307405_10058399 | 3300031731 | Bacteria | 2427 |
| 500 | Ga0307405_10073616 | 3300031731 | Bacteria | 2206 |
| 501 | Ga0307413_10006988 | 3300031824 | Bacteria | 5203 |
| 502 | Ga0307413_10052817 | 3300031824 | Bacteria | 2457 |
| 503 | Ga0307413_10775505 | 3300031824 | Bacteria | 804 |
| 504 | Ga0307410_10017150 | 3300031852 | Bacteria | 4339 |
| 505 | Ga0307410_10064810 | 3300031852 | Bacteria | 2511 |
| 506 | Ga0307406_10037403 | 3300031901 | Bacteria | 2997 |
| 507 | Ga0307406_10065133 | 3300031901 | Bacteria | 2367 |
| 508 | Ga0307407_10016684 | 3300031903 | Bacteria | 3662 |
| 509 | Ga0307407_10110075 | 3300031903 | Bacteria | 1727 |
| 510 | Ga0307412_10005086 | 3300031911 | Bacteria | 7355 |
| 511 | Ga0307412_10017698 | 3300031911 | Bacteria | 4269 |
| 512 | Ga0307412_11697139 | 3300031911 | Bacteria | 579 |
| 513 | Ga0307409_100015440 | 3300031995 | Bacteria | 5014 |
| 514 | Ga0307409_100102052 | 3300031995 | Bacteria | 2382 |
| 515 | Ga0307416_100002628 | 3300032002 | Bacteria | 10389 |
| 516 | Ga0307416_100611774 | 3300032002 | Bacteria | 1170 |
| 517 | Ga0307416_103033277 | 3300032002 | Bacteria | 562 |
| 518 | Ga0307414_10007367 | 3300032004 | Bacteria | 6181 |
| 519 | Ga0307414_10354398 | 3300032004 | Bacteria | 1260 |
| 520 | Ga0307411_10005662 | 3300032005 | Bacteria | 6165 |
| 521 | Ga0307411_10009772 | 3300032005 | Bacteria | 5068 |
| 522 | Ga0307415_100052521 | 3300032126 | Bacteria | 2772 |
| 523 | Ga0307415_100100170 | 3300032126 | Bacteria | 2122 |
| 524 | Ga0307415_100887935 | 3300032126 | Bacteria | 821 |
| 525 | Ga0395899_0002738 | 3300037312 | Bacteria | 14208 |
| 526 | Ga0395899_0067795 | 3300037312 | Bacteria | 2618 |
| 527 | Ga0395900_0055176 | 3300037418 | Bacteria | 4091 |
| 528 | Ga0395900_0337395 | 3300037418 | Bacteria | 1483 |
| 529 | Ga0395900_0411067 | 3300037418 | Bacteria | 1315 |
| 530 | Ga0395898_0637887 | 3300037466 | Bacteria | 1008 |
| 531 | Ga0395905_0114530 | 3300037471 | Bacteria | 2533 |
| 532 | Ga0395905_0215918 | 3300037471 | Bacteria | 1796 |
| 533 | Ga0395905_0382755 | 3300037471 | Bacteria | 1301 |
| 534 | Ga0436364_1302975 | 3300037853 | Bacteria | 1044 |
| 535 | Ga0395901_0099192 | 3300038443 | Bacteria | 3054 |
| 536 | Ga0395901_0309646 | 3300038443 | Bacteria | 1636 |
| 537 | Ga0395901_0328606 | 3300038443 | Bacteria | 1581 |
| 538 | Ga0395901_1927983 | 3300038443 | Bacteria | 538 |
| 539 | Ga0237819_02653 | 3300038705 | Bacteria | 3496 |
| 540 | Ga0237816_05045 | 3300039145 | Bacteria | 898 |
| 541 | Ga0436365_0412715 | 3300039437 | Bacteria | 2429 |
| 542 | Ga0439436_0016645 | 3300041404 | Bacteria | 2204 |
| 543 | Ga0439439_0121155 | 3300041406 | Bacteria | 729 |
| 544 | Ga0439461_0004626 | 3300041410 | Bacteria | 2306 |
| 545 | Ga0439465_0006757 | 3300041413 | Bacteria | 3643 |
| 546 | Ga0451793_0255256 | 3300041452 | Bacteria | 634 |
| 547 | Ga0451853_2493251 | 3300041512 | Bacteria | 575 |
| 548 | Ga0439431_0005179 | 3300041997 | Bacteria | 2874 |
| 549 | Ga0439432_010633 | 3300042006 | Bacteria | 3183 |
| 550 | Ga0439446_0064186 | 3300042156 | Bacteria | 1114 |
| 551 | Ga0466966_0067597 | 3300044684 | Bacteria | 2244 |
| 552 | Ga0466966_0319672 | 3300044684 | Bacteria | 933 |
| 553 | Ga0466961_0040935 | 3300044693 | Bacteria | 2970 |
| 554 | Ga0466961_0122674 | 3300044693 | Bacteria | 1631 |
| 555 | Ga0466963_0058844 | 3300044694 | Bacteria | 2563 |
| 556 | Ga0466963_0108707 | 3300044694 | Bacteria | 1902 |
| 557 | Ga0466964_0099856 | 3300044706 | Bacteria | 1278 |
| 558 | Ga0466971_0004979 | 3300044719 | Bacteria | 5746 |
| 559 | Ga0466971_0199951 | 3300044719 | Bacteria | 943 |
| 560 | Ga0466970_0103804 | 3300044765 | Bacteria | 1549 |
| 561 | Ga0466970_0411923 | 3300044765 | Bacteria | 772 |
| 562 | Ga0466957_0009863 | 3300044842 | Bacteria | 5461 |
| 563 | Ga0466957_0128384 | 3300044842 | Bacteria | 1622 |
| 564 | Ga0466957_0131074 | 3300044842 | Bacteria | 1606 |
| 565 | Ga0466957_0169830 | 3300044842 | Bacteria | 1420 |
| 566 | Ga0466959_0036850 | 3300045049 | Bacteria | 3613 |
| 567 | Ga0466958_0022147 | 3300045836 | Bacteria | 3720 |
| 568 | Ga0466958_0048182 | 3300045836 | Bacteria | 2574 |
| 569 | Ga0466967_0003933 | 3300045976 | Bacteria | 9871 |
| 570 | Ga0495617_125856 | 3300046452 | Bacteria | 824 |
| 571 | Ga0495592_0786948 | 3300046454 | Bacteria | 566 |
| 572 | Ga0495638_0309533 | 3300046460 | Bacteria | 848 |
| 573 | Ga0495650_0000259 | 3300046471 | Bacteria | 102151 |
| 574 | Ga0495650_0006744 | 3300046471 | Bacteria | 7102 |
| 575 | Ga0495584_0005639 | 3300046491 | Bacteria | 6615 |
| 576 | Ga0495584_0059190 | 3300046491 | Bacteria | 1927 |
| 577 | Ga0495585_0009056 | 3300046492 | Bacteria | 5997 |
| 578 | Ga0495596_0018840 | 3300046500 | Bacteria | 2842 |
| 579 | Ga0495583_0033072 | 3300046506 | Bacteria | 2489 |
| 580 | Ga0495583_0042526 | 3300046506 | Bacteria | 2121 |
| 581 | Ga0495583_0122490 | 3300046506 | Bacteria | 1093 |
| 582 | Ga0495606_0000029 | 3300046507 | Bacteria | 250473 |
| 583 | Ga0495606_0066199 | 3300046507 | Bacteria | 2292 |
| 584 | Ga0495616_0090193 | 3300046513 | Bacteria | 1453 |
| 585 | Ga0495616_0183023 | 3300046513 | Bacteria | 930 |
| 586 | Ga0495631_0009935 | 3300046518 | Bacteria | 4732 |
| 587 | Ga0495631_0332613 | 3300046518 | Bacteria | 646 |
| 588 | Ga0495637_0038137 | 3300046520 | Bacteria | 2082 |
| 589 | Ga0495637_0135631 | 3300046520 | Bacteria | 937 |
| 590 | Ga0495643_0000163 | 3300046522 | Bacteria | 106228 |
| 591 | Ga0495643_0006968 | 3300046522 | Bacteria | 7349 |
| 592 | Ga0495643_0007751 | 3300046522 | Bacteria | 6874 |
| 593 | Ga0495643_0317560 | 3300046522 | Bacteria | 705 |
| 594 | Ga0495648_0000291 | 3300046524 | Bacteria | 56777 |
| 595 | Ga0495663_0000756 | 3300046525 | Bacteria | 11088 |
| 596 | Ga0495642_0071207 | 3300046528 | Bacteria | 1454 |
| 597 | Ga0495587_0468400 | 3300046536 | Bacteria | 697 |
| 598 | Ga0495597_0097196 | 3300046542 | Bacteria | 1244 |
| 599 | Ga0495622_0006792 | 3300046557 | Bacteria | 5309 |
| 600 | Ga0495633_0002070 | 3300046558 | Bacteria | 14437 |
| 601 | Ga0495633_0027359 | 3300046558 | Bacteria | 2788 |
| 602 | Ga0495668_0000016 | 3300046616 | Bacteria | 438197 |
| 603 | Ga0495668_0048602 | 3300046616 | Bacteria | 2353 |
| 604 | Ga0495668_0146365 | 3300046616 | Bacteria | 1293 |
| 605 | Ga0495611_0143960 | 3300046648 | Bacteria | 1113 |
| 606 | Ga0495611_0558796 | 3300046648 | Bacteria | 518 |
| 607 | Ga0495625_0000092 | 3300046660 | Bacteria | 146172 |
| 608 | Ga0495625_0004356 | 3300046660 | Bacteria | 13449 |
| 609 | Ga0495625_0010250 | 3300046660 | Bacteria | 7771 |
| 610 | Ga0495625_0014866 | 3300046660 | Bacteria | 6191 |
| 611 | Ga0495625_0054925 | 3300046660 | Bacteria | 2843 |
| 612 | Ga0495661_0064241 | 3300046665 | Bacteria | 2167 |
| 613 | Ga0495669_0000039 | 3300046684 | Bacteria | 92973 |
| 614 | Ga0495669_0010231 | 3300046684 | Bacteria | 3962 |
| 615 | Ga0495669_0022480 | 3300046684 | Bacteria | 2739 |
| 616 | Ga0495669_0051827 | 3300046684 | Bacteria | 1842 |
| 617 | Ga0495669_0059502 | 3300046684 | Bacteria | 1725 |
| 618 | Ga0495670_0000015 | 3300046691 | Bacteria | 131137 |
| 619 | Ga0495670_0221147 | 3300046691 | Bacteria | 1006 |
| 620 | Ga0495670_0720909 | 3300046691 | Bacteria | 544 |
| 621 | Ga0495649_0058382 | 3300046694 | Bacteria | 2079 |
| 622 | Ga0495600_0024882 | 3300046809 | Bacteria | 3854 |
| 623 | Ga0495600_0110165 | 3300046809 | Bacteria | 1792 |
| 624 | Ga0495660_0196273 | 3300046810 | Bacteria | 966 |
| 625 | Ga0495636_0235789 | 3300047318 | Bacteria | 843 |
| 626 | Ga0495683_0000947 | 3300047323 | Bacteria | 20420 |
| 627 | Ga0495683_0047570 | 3300047323 | Bacteria | 2152 |
| 628 | Ga0495683_0271664 | 3300047323 | Bacteria | 737 |
| 629 | Ga0495687_000098 | 3300047443 | Bacteria | 132403 |
| 630 | Ga0495687_000471 | 3300047443 | Bacteria | 48815 |
| 631 | Ga0495677_0002246 | 3300047445 | Bacteria | 7635 |
| 632 | Ga0495677_0013510 | 3300047445 | Bacteria | 2973 |
| 633 | Ga0495677_0018391 | 3300047445 | Bacteria | 2533 |
| 634 | Ga0495685_138427 | 3300047447 | Bacteria | 794 |
| 635 | Ga0495681_0007945 | 3300047470 | Bacteria | 6700 |
| 636 | Ga0495681_0153535 | 3300047470 | Bacteria | 964 |
| 637 | Ga0495686_0000486 | 3300047472 | Bacteria | 58640 |
| 638 | Ga0495686_0040153 | 3300047472 | Bacteria | 2986 |
| 639 | Ga0496100_0464024 | 3300048903 | Bacteria | 972 |
| 640 | Ga0496100_0562510 | 3300048903 | Bacteria | 883 |
| 641 | Ga0496101_0464135 | 3300048904 | Bacteria | 999 |
| 642 | Ga0496102_0000961 | 3300048905 | Bacteria | 27087 |
| 643 | Ga0496102_0634626 | 3300048905 | Bacteria | 991 |
| 644 | Ga0496103_0000145 | 3300048906 | Bacteria | 74388 |
| 645 | Ga0496103_0085761 | 3300048906 | Bacteria | 1984 |
| 646 | Ga0496103_0299526 | 3300048906 | Bacteria | 1034 |
| 647 | Ga0496104_0003941 | 3300048907 | Bacteria | 12844 |
| 648 | Ga0496105_0000218 | 3300048908 | Bacteria | 38487 |
| 649 | Ga0496107_0185584 | 3300048910 | Bacteria | 1545 |
| 650 | Ga0496108_0006377 | 3300048911 | Bacteria | 9561 |
| 651 | Ga0496109_0043625 | 3300048912 | Bacteria | 4066 |
| 652 | Ga0496110_0007061 | 3300048913 | Bacteria | 8937 |
| 653 | Ga0496111_0003030 | 3300048914 | Bacteria | 10300 |
| 654 | Ga0496112_0043596 | 3300048915 | Bacteria | 4392 |
| 655 | Ga0496113_0006174 | 3300048916 | Bacteria | 7564 |
| 656 | Ga0496113_0753739 | 3300048916 | Bacteria | 775 |
| 657 | Ga0496114_0026742 | 3300048917 | Bacteria | 4726 |
| 658 | Ga0496115_0000195 | 3300048918 | Bacteria | 56609 |
| 659 | Ga0496115_0001359 | 3300048918 | Bacteria | 17461 |
| 660 | Ga0496116_0010920 | 3300048919 | Bacteria | 7566 |
| 661 | Ga0496117_0000910 | 3300048920 | Bacteria | 45331 |
| 662 | Ga0496117_0003090 | 3300048920 | Bacteria | 19927 |
| 663 | Ga0496117_0151533 | 3300048920 | Bacteria | 1372 |
| 664 | Ga0496118_0000091 | 3300048921 | Bacteria | 173092 |
| 665 | Ga0496118_0000339 | 3300048921 | Bacteria | 80008 |
| 666 | Ga0496119_0010325 | 3300048922 | Bacteria | 7869 |
| 667 | Ga0496120_0059756 | 3300048923 | Bacteria | 2135 |
| 668 | Ga0496120_0074129 | 3300048923 | Bacteria | 1860 |
| 669 | Ga0496121_0000105 | 3300048924 | Bacteria | 191437 |
| 670 | Ga0496121_0000429 | 3300048924 | Bacteria | 82577 |
| 671 | Ga0496121_0003357 | 3300048924 | Bacteria | 22967 |
| 672 | Ga0496121_0014603 | 3300048924 | Bacteria | 8313 |
| 673 | Ga0496121_0330273 | 3300048924 | Bacteria | 1023 |
| 674 | Ga0496122_0128770 | 3300048925 | Bacteria | 1614 |
| 675 | Ga0496122_0219332 | 3300048925 | Bacteria | 1093 |
| 676 | Ga0496123_0042673 | 3300048926 | Bacteria | 3127 |
| 677 | Ga0496123_0070886 | 3300048926 | Bacteria | 2178 |
| 678 | Ga0496123_0170339 | 3300048926 | Bacteria | 1149 |
| 679 | Ga0496123_0292996 | 3300048926 | Bacteria | 780 |
| 680 | Ga0496124_0000375 | 3300048927 | Bacteria | 81352 |
| 681 | Ga0496124_0018814 | 3300048927 | Bacteria | 6452 |
| 682 | Ga0496124_0050792 | 3300048927 | Bacteria | 3531 |
| 683 | Ga0496124_0178404 | 3300048927 | Bacteria | 1637 |
| 684 | Ga0496124_0380187 | 3300048927 | Bacteria | 988 |
| 685 | Ga0496125_0052345 | 3300048928 | Bacteria | 3357 |
| 686 | Ga0496126_0000443 | 3300048929 | Bacteria | 82811 |
| 687 | Ga0496126_0010422 | 3300048929 | Bacteria | 9742 |
| 688 | Ga0496126_0038558 | 3300048929 | Bacteria | 4445 |
| 689 | Ga0495682_0374199 | 3300049460 | Bacteria | 502 |
| 690 | Ga0501070_0636980 | 3300049586 | Bacteria | 847 |
| 691 | nmdc:mga0sz30_48265_c1 | 3300050516 | Bacteria | 1801 |
| 692 | Ga0500610_0000063 | 3300053079 | Bacteria | 33821 |
| 693 | Ga0500643_000466 | 3300053087 | Bacteria | 29832 |
| 694 | Ga0500643_001269 | 3300053087 | Bacteria | 14922 |
| 695 | Ga0500643_018551 | 3300053087 | Bacteria | 2307 |
| 696 | Ga0500647_0117418 | 3300053091 | Bacteria | 1261 |
| 697 | Ga0500641_0006923 | 3300053096 | Bacteria | 4033 |
| 698 | Ga0500556_0231231 | 3300053104 | Bacteria | 729 |
| 699 | Ga0500562_046930 | 3300053108 | Bacteria | 1152 |
| 700 | Ga0500562_071691 | 3300053108 | Bacteria | 935 |
| 701 | Ga0500595_000475 | 3300053119 | Bacteria | 24774 |
| 702 | Ga0500597_001091 | 3300053120 | Bacteria | 6523 |
| 703 | Ga0500607_155702 | 3300053121 | Bacteria | 1052 |
| 704 | Ga0500642_0004242 | 3300053130 | Bacteria | 4456 |
| 705 | Ga0500658_0019033 | 3300053134 | Bacteria | 2580 |
| 706 | Ga0500585_150412 | 3300053144 | Bacteria | 813 |
| 707 | Ga0500588_0037695 | 3300053146 | Bacteria | 1437 |
| 708 | Ga0500616_0017435 | 3300053153 | Bacteria | 4073 |
| 709 | Ga0500619_083722 | 3300053154 | Bacteria | 1073 |
| 710 | Ga0500624_000023 | 3300053157 | Bacteria | 114997 |
| 711 | Ga0500627_0170718 | 3300053158 | Bacteria | 980 |
| 712 | Ga0500636_0000462 | 3300053177 | Bacteria | 22121 |
| 713 | Ga0500637_0000013 | 3300053178 | Bacteria | 73168 |
| 714 | Ga0500645_000002 | 3300053730 | Bacteria | 388892 |
| 715 | Ga0500645_031256 | 3300053730 | Bacteria | 1600 |
| 716 | Ga0500609_015863 | 3300053731 | Bacteria | 1021 |
| 717 | Ga0500596_000052 | 3300053735 | Bacteria | 15694 |
| 718 | 2600228610 | 2599185359 | Bacteria | 4772316 |
| 719 | 2644125898 | 2643221622 | Bacteria | 4212502 |
| 720 | 2819714579 | 2818991466 | Bacteria | 4748179 |
| 721 | 2879165613 | 2879163058 | Bacteria | 4223965 |
| 722 | 2885431565 | 2885429604 | Bacteria | 3642894 |
| 723 | 2886633996 | 2886627955 | Bacteria | 7618130 |
| 724 | 2928529082 | 2928526807 | Bacteria | 4760224 |
| 725 | 2928968599 | 2928968154 | Bacteria | 4633371 |
| 726 | 8057102116 | 8057101203 | Bacteria | 5034064 |
| 727 | Ga0496124_0000129 | |||
| 728 | ARcpr5oldR_c011761 | |||
| 729 | ARcpr5yngRDRAFT_c009262 | |||
| 730 | JGI24740J21852_10003761 | |||
| 731 | JGI24739J22299_10024914 | |||
| 732 | JGI24737J22298_10000315 | |||
| 733 | JGI24737J22298_10004866 | |||
| 734 | JGI24737J22298_10005025 | |||
| 735 | JGI24737J22298_10034423 | |||
| 736 | JGI24735J21928_10005077 | |||
| 737 | JGI24735J21928_10021864 | |||
| 738 | JGI24735J21928_10051185 | |||
| 739 | JGI24738J21930_10002201 | |||
| 740 | JGI24738J21930_10041608 | |||
| 741 | JGI24744J21845_10002683 | |||
| 742 | JGI25151J46595_10139345 | |||
| 743 | JGI25165J46597_1000040 | |||
| 744 | JGI25153J46596_10000031 | |||
| 745 | JGI25153J46596_10000091 | |||
| 746 | JGI25153J46596_10045061 | |||
| 747 | rootH2_10005041 | |||
| 748 | Ga0055525_1000012 | |||
| 749 | Ga0055542_1000322 | |||
| 750 | Ga0055529_1000014 | |||
| 751 | Ga0055526_1003569 | |||
| 752 | Ga0055537_1001470 | |||
| 753 | Ga0055537_1001547 | |||
| 754 | Ga0055524_1001171 | |||
| 755 | Ga0055536_1026317 | |||
| 756 | Ga0055530_10009450 | |||
| 757 | Ga0055530_10022076 | |||
| 758 | Ga0055530_10075464 | |||
| 759 | Ga0055540_1004562 | |||
| 760 | Ga0055531_10013567 | |||
| 761 | Ga0055531_10029632 | |||
| 762 | Ga0065165_1002705 | |||
| 763 | Ga0065165_1003177 | |||
| 764 | Ga0065165_1013615 | |||
| 765 | Ga0065712_10075190 | |||
| 766 | Ga0065715_10132303 | |||
| 767 | Ga0070658_10000022 | |||
| 768 | Ga0070658_10005125 | |||
| 769 | Ga0070658_10010467 | |||
| 770 | Ga0070658_11054536 | |||
| 771 | Ga0070676_10004634 | |||
| 772 | Ga0070676_10009924 | |||
| 773 | Ga0070676_10223767 | |||
| 774 | Ga0070676_10770078 | |||
| 775 | Ga0070676_11104862 | |||
| 776 | Ga0070683_100384779 | |||
| 777 | Ga0070683_100920270 | |||
| 778 | Ga0070670_100011899 | |||
| 779 | Ga0070670_100025648 | |||
| 780 | Ga0070670_100234775 | |||
| 781 | Ga0070670_100466931 | |||
| 782 | Ga0070677_10085291 | |||
| 783 | Ga0068869_100000467 | |||
| 784 | Ga0070666_10054920 | |||
| 785 | Ga0070666_10062800 | |||
| 786 | Ga0070680_100169757 | |||
| 787 | Ga0068868_100000092 | |||
| 788 | Ga0068868_100442712 | |||
| 789 | Ga0070660_100000751 | |||
| 790 | Ga0070660_100003262 | |||
| 791 | Ga0070660_100056773 | |||
| 792 | Ga0070660_100357805 | |||
| 793 | Ga0070660_100541547 | |||
| 794 | Ga0070661_100000130 | |||
| 795 | Ga0070661_100033253 | |||
| 796 | Ga0070661_100164048 | |||
| 797 | Ga0070661_100236900 | |||
| 798 | Ga0070692_10001368 | |||
| 799 | Ga0070692_10061516 | |||
| 800 | Ga0070668_100000906 | |||
| 801 | Ga0070668_100022772 | |||
| 802 | Ga0070668_100029073 | |||
| 803 | Ga0070668_101124712 | |||
| 804 | Ga0070669_100009672 | |||
| 805 | Ga0070669_100107486 | |||
| 806 | Ga0070669_100409854 | |||
| 807 | Ga0070675_100095820 | |||
| 808 | Ga0070675_100151839 | |||
| 809 | Ga0070675_100364353 | |||
| 810 | Ga0070671_100020082 | |||
| 811 | Ga0070674_100000035 | |||
| 812 | Ga0070674_100000329 | |||
| 813 | Ga0070674_100714248 | |||
| 814 | Ga0070673_100000009 | |||
| 815 | Ga0070673_100005666 | |||
| 816 | Ga0070673_100256013 | |||
| 817 | Ga0070659_100048117 | |||
| 818 | Ga0070659_100140735 | |||
| 819 | Ga0070659_100149520 | |||
| 820 | Ga0070659_100427247 | |||
| 821 | Ga0070659_100452625 | |||
| 822 | Ga0070659_102158394 | |||
| 823 | Ga0070667_100000641 | |||
| 824 | Ga0070667_100002416 | |||
| 825 | Ga0070667_100018960 | |||
| 826 | Ga0070667_100203038 | |||
| 827 | Ga0070667_100603514 | |||
| 828 | Ga0070663_100009984 | |||
| 829 | Ga0070663_100086230 | |||
| 830 | Ga0070663_101402580 | |||
| 831 | Ga0070678_100000060 | |||
| 832 | Ga0070678_100009721 | |||
| 833 | Ga0070678_100480004 | |||
| 834 | Ga0070662_100010272 | |||
| 835 | Ga0070662_100010751 | |||
| 836 | Ga0070662_100098202 | |||
| 837 | Ga0070662_100397579 | |||
| 838 | Ga0070662_100480689 | |||
| 839 | Ga0070681_10015840 | |||
| 840 | Ga0070681_10107967 | |||
| 841 | Ga0070681_10587461 | |||
| 842 | Ga0070681_10729352 | |||
| 843 | Ga0068867_100000002 | |||
| 844 | Ga0068867_100004940 | |||
| 845 | Ga0068867_101384863 | |||
| 846 | Ga0070679_100000021 | |||
| 847 | Ga0070679_100637845 | |||
| 848 | Ga0070684_101007723 | |||
| 849 | Ga0068853_100038814 | |||
| 850 | Ga0068853_100089389 | |||
| 851 | Ga0068853_100114747 | |||
| 852 | Ga0068853_100144186 | |||
| 853 | Ga0068853_100550260 | |||
| 854 | Ga0070672_100008045 | |||
| 855 | Ga0070672_100022207 | |||
| 856 | Ga0070672_100299934 | |||
| 857 | Ga0070696_100006792 | |||
| 858 | Ga0070665_100000115 | |||
| 859 | Ga0070665_100084334 | |||
| 860 | Ga0070665_100518185 | |||
| 861 | Ga0068855_100000333 | |||
| 862 | Ga0068855_100001164 | |||
| 863 | Ga0068855_100049033 | |||
| 864 | Ga0068855_100095443 | |||
| 865 | Ga0068855_100899917 | |||
| 866 | Ga0068855_101844867 | |||
| 867 | Ga0070664_100008107 | |||
| 868 | Ga0070664_100105053 | |||
| 869 | Ga0070664_100272568 | |||
| 870 | Ga0070664_100514718 | |||
| 871 | Ga0068857_100004444 | |||
| 872 | Ga0068854_100000380 | |||
| 873 | Ga0068854_100025690 | |||
| 874 | Ga0068854_100119227 | |||
| 875 | Ga0068854_100241662 | |||
| 876 | Ga0068854_101001322 | |||
| 877 | Ga0068856_100013110 | |||
| 878 | Ga0068856_100031423 | |||
| 879 | Ga0068852_100001302 | |||
| 880 | Ga0068852_100347958 | |||
| 881 | Ga0068859_100012317 | |||
| 882 | Ga0068859_100160863 | |||
| 883 | Ga0068859_100237719 | |||
| 884 | Ga0068859_100622361 | |||
| 885 | Ga0068859_100726087 | |||
| 886 | Ga0068864_100000016 | |||
| 887 | Ga0068864_100380181 | |||
| 888 | Ga0068864_100399098 | |||
| 889 | Ga0068851_10012325 | |||
| 890 | Ga0068851_10438833 | |||
| 891 | Ga0068863_100000047 | |||
| 892 | Ga0068863_100000089 | |||
| 893 | Ga0068863_100003668 | |||
| 894 | Ga0068863_100008189 | |||
| 895 | Ga0068863_100058002 | |||
| 896 | Ga0068863_100119831 | |||
| 897 | Ga0068863_101829075 | |||
| 898 | Ga0068858_100008945 | |||
| 899 | Ga0068860_100001603 | |||
| 900 | Ga0068860_100148772 | |||
| 901 | Ga0068860_100315051 | |||
| 902 | Ga0068862_100000068 | |||
| 903 | Ga0068862_100000986 | |||
| 904 | Ga0081539_10007074 | |||
| 905 | Ga0075369_10038377 | |||
| 906 | Ga0097621_100021424 | |||
| 907 | Ga0068871_100004655 | |||
| 908 | Ga0068871_100171913 | |||
| 909 | Ga0068871_100285428 | |||
| 910 | Ga0068865_100000014 | |||
| 911 | Ga0068865_100195482 | |||
| 912 | Ga0068865_100384205 | |||
| 913 | Ga0068865_100459451 | |||
| 914 | Ga0068865_100803238 | |||
| 915 | Ga0097620_100012317 | |||
| 916 | Ga0097620_100160860 | |||
| 917 | Ga0097620_100237718 | |||
| 918 | Ga0097620_100622359 | |||
| 919 | Ga0097620_100726105 | |||
| 920 | Ga0099826_10111731 | |||
| 921 | Ga0105251_10001932 | |||
| 922 | Ga0105240_10004046 | |||
| 923 | Ga0105240_10038634 | |||
| 924 | Ga0105240_10051063 | |||
| 925 | Ga0105240_10282098 | |||
| 926 | Ga0105245_10001236 | |||
| 927 | Ga0105245_11816733 | |||
| 928 | Ga0105247_10000985 | |||
| 929 | Ga0105247_10015646 | |||
| 930 | Ga0105247_10106888 | |||
| 931 | Ga0105243_10000070 | |||
| 932 | Ga0105243_10001791 | |||
| 933 | Ga0105243_10073758 | |||
| 934 | Ga0105243_10546149 | |||
| 935 | Ga0105243_10619836 | |||
| 936 | Ga0105241_10004388 | |||
| 937 | Ga0105241_10130977 | |||
| 938 | Ga0105242_10000273 | |||
| 939 | Ga0105242_11443763 | |||
| 940 | Ga0105248_10000021 | |||
| 941 | Ga0105248_10002393 | |||
| 942 | Ga0105248_10018071 | |||
| 943 | Ga0105237_10004611 | |||
| 944 | Ga0105237_10017550 | |||
| 945 | Ga0105237_10032273 | |||
| 946 | Ga0105237_10078880 | |||
| 947 | Ga0105237_11523622 | |||
| 948 | Ga0105238_10080044 | |||
| 949 | Ga0105238_10118232 | |||
| 950 | Ga0105238_10558728 | |||
| 951 | Ga0105249_10000017 | |||
| 952 | Ga0105249_10001264 | |||
| 953 | Ga0105249_10001584 | |||
| 954 | Ga0105249_10288452 | |||
| 955 | Ga0105249_11992838 | |||
| 956 | Ga0105249_12757113 | |||
| 957 | Ga0105249_13212122 | |||
| 958 | Ga0105239_10000546 | |||
| 959 | Ga0105239_10038762 | |||
| 960 | Ga0105239_10686070 | |||
| 961 | Ga0105239_11258994 | |||
| 962 | Ga0105246_10002662 | |||
| 963 | Ga0105246_10054421 | |||
| 964 | Ga0157326_1001062 | |||
| 965 | Ga0157373_10043654 | |||
| 966 | Ga0157373_10083098 | |||
| 967 | Ga0157373_10086011 | |||
| 968 | Ga0157371_10000193 | |||
| 969 | Ga0157371_10054006 | |||
| 970 | Ga0157371_10073640 | |||
| 971 | Ga0157371_10514372 | |||
| 972 | Ga0157371_10554301 | |||
| 973 | Ga0157371_10863917 | |||
| 974 | Ga0157370_10000117 | |||
| 975 | Ga0157370_10853360 | |||
| 976 | Ga0157369_10030477 | |||
| 977 | Ga0157369_10170694 | |||
| 978 | Ga0157374_10000831 | |||
| 979 | Ga0157374_10005135 | |||
| 980 | Ga0157374_10041788 | |||
| 981 | Ga0157374_10335658 | |||
| 982 | Ga0157378_10000944 | |||
| 983 | Ga0163162_10011469 | |||
| 984 | Ga0157372_10182260 | |||
| 985 | Ga0157372_10275339 | |||
| 986 | Ga0157372_10286207 | |||
| 987 | Ga0157372_10337359 | |||
| 988 | Ga0157375_10002997 | |||
| 989 | Ga0157375_10111021 | |||
| 990 | Ga0157375_10141594 | |||
| 991 | Ga0163163_10013700 | |||
| 992 | Ga0163163_10067172 | |||
| 993 | Ga0163163_12888084 | |||
| 994 | Ga0157377_10026133 | |||
| 995 | Ga0157379_10151556 | |||
| 996 | Ga0157376_10000186 | |||
| 997 | Ga0163161_10261965 | |||
| 998 | Ga0163161_10308905 | |||
| 999 | Ga0213875_10419316 | |||
| 1000 | Ga0209563_100030 | |||
| 1001 | Ga0207427_100441 | |||
| 1002 | Ga0207425_1000049 | |||
| 1003 | Ga0207425_1008078 | |||
| 1004 | Ga0209026_1000675 | |||
| 1005 | Ga0209677_117223 | |||
| 1006 | Ga0209148_1000011 | |||
| 1007 | Ga0209129_1001668 | |||
| 1008 | Ga0209233_1000003 | |||
| 1009 | Ga0209565_1000007 | |||
| 1010 | Ga0209565_1000170 | |||
| 1011 | Ga0209455_1000006 | |||
| 1012 | Ga0209455_1024217 | |||
| 1013 | Ga0209673_1007604 | |||
| 1014 | Ga0209673_1032519 | |||
| 1015 | Ga0209675_1004240 | |||
| 1016 | Ga0209676_1010374 | |||
| 1017 | Ga0209676_1023070 | |||
| 1018 | Ga0209025_1000068 | |||
| 1019 | Ga0209564_1000335 | |||
| 1020 | Ga0209564_1026133 | |||
| 1021 | Ga0209758_1000001 | |||
| 1022 | Ga0209758_1000004 | |||
| 1023 | Ga0209758_1018028 | |||
| 1024 | Ga0209758_1054268 | |||
| 1025 | Ga0209050_1000001 | |||
| 1026 | Ga0209050_1006899 | |||
| 1027 | Ga0209050_1021069 | |||
| 1028 | Ga0209256_1000009 | |||
| 1029 | Ga0209256_1000010 | |||
| 1030 | Ga0207426_1032149 | |||
| 1031 | Ga0207426_1111532 | |||
| 1032 | Ga0209051_1000191 | |||
| 1033 | Ga0209051_1071930 | |||
| 1034 | Ga0209257_1003180 | |||
| 1035 | Ga0209257_1003572 | |||
| 1036 | Ga0209257_1003678 | |||
| 1037 | Ga0207697_10126939 | |||
| 1038 | Ga0207656_10084319 | |||
| 1039 | Ga0207656_10348198 | |||
| 1040 | Ga0207710_10082022 | |||
| 1041 | Ga0207688_10024275 | |||
| 1042 | Ga0207688_10274284 | |||
| 1043 | Ga0207680_10202815 | |||
| 1044 | Ga0207647_10009257 | |||
| 1045 | Ga0207647_10011528 | |||
| 1046 | Ga0207647_10018578 | |||
| 1047 | Ga0207647_10018802 | |||
| 1048 | Ga0207647_10144287 | |||
| 1049 | Ga0207647_10160000 | |||
| 1050 | Ga0207647_10358421 | |||
| 1051 | Ga0207645_10015318 | |||
| 1052 | Ga0207645_10025433 | |||
| 1053 | Ga0207645_10509924 | |||
| 1054 | Ga0207645_10664613 | |||
| 1055 | Ga0207705_10000042 | |||
| 1056 | Ga0207705_10000188 | |||
| 1057 | Ga0207705_10021287 | |||
| 1058 | Ga0207705_10661603 | |||
| 1059 | Ga0207705_10955698 | |||
| 1060 | Ga0207654_10000227 | |||
| 1061 | Ga0207707_10013301 | |||
| 1062 | Ga0207707_10130828 | |||
| 1063 | Ga0207707_10286433 | |||
| 1064 | Ga0207695_10003844 | |||
| 1065 | Ga0207695_10015444 | |||
| 1066 | Ga0207695_10028168 | |||
| 1067 | Ga0207695_10083252 | |||
| 1068 | Ga0207695_10091255 | |||
| 1069 | Ga0207671_10004049 | |||
| 1070 | Ga0207671_10012108 | |||
| 1071 | Ga0207671_10036679 | |||
| 1072 | Ga0207671_10044525 | |||
| 1073 | Ga0207660_10003328 | |||
| 1074 | Ga0207662_10355880 | |||
| 1075 | Ga0207657_10000900 | |||
| 1076 | Ga0207657_10001241 | |||
| 1077 | Ga0207657_10001555 | |||
| 1078 | Ga0207657_10016697 | |||
| 1079 | Ga0207657_10048500 | |||
| 1080 | Ga0207657_10136202 | |||
| 1081 | Ga0207657_10263111 | |||
| 1082 | Ga0207657_10322123 | |||
| 1083 | Ga0207657_10440642 | |||
| 1084 | Ga0207649_10000134 | |||
| 1085 | Ga0207649_10002240 | |||
| 1086 | Ga0207649_10032880 | |||
| 1087 | Ga0207649_10202905 | |||
| 1088 | Ga0207652_10000047 | |||
| 1089 | Ga0207652_10493523 | |||
| 1090 | Ga0207652_11278017 | |||
| 1091 | Ga0207681_10008042 | |||
| 1092 | Ga0207681_10146964 | |||
| 1093 | Ga0207694_10000683 | |||
| 1094 | Ga0207650_10000069 | |||
| 1095 | Ga0207650_10003451 | |||
| 1096 | Ga0207650_10050776 | |||
| 1097 | Ga0207650_10216175 | |||
| 1098 | Ga0207650_10740809 | |||
| 1099 | Ga0207659_10112865 | |||
| 1100 | Ga0207659_10240661 | |||
| 1101 | Ga0207659_11431214 | |||
| 1102 | Ga0207687_10000252 | |||
| 1103 | Ga0207644_10006505 | |||
| 1104 | Ga0207690_10001286 | |||
| 1105 | Ga0207690_10063454 | |||
| 1106 | Ga0207690_10243567 | |||
| 1107 | Ga0207690_10420538 | |||
| 1108 | Ga0207690_10432323 | |||
| 1109 | Ga0207706_10004012 | |||
| 1110 | Ga0207706_10059349 | |||
| 1111 | Ga0207706_10101956 | |||
| 1112 | Ga0207706_10167689 | |||
| 1113 | Ga0207706_10737468 | |||
| 1114 | Ga0207706_10893307 | |||
| 1115 | Ga0207686_10001911 | |||
| 1116 | Ga0207709_10000066 | |||
| 1117 | Ga0207709_10000246 | |||
| 1118 | Ga0207709_11099301 | |||
| 1119 | Ga0207669_10000030 | |||
| 1120 | Ga0207669_10000615 | |||
| 1121 | Ga0207669_10031379 | |||
| 1122 | Ga0207669_10037347 | |||
| 1123 | Ga0207704_10000002 | |||
| 1124 | Ga0207704_10000007 | |||
| 1125 | Ga0207704_10051567 | |||
| 1126 | Ga0207704_10894299 | |||
| 1127 | Ga0207704_11304893 | |||
| 1128 | Ga0207691_10008730 | |||
| 1129 | Ga0207691_10087107 | |||
| 1130 | Ga0207691_10134528 | |||
| 1131 | Ga0207691_10233886 | |||
| 1132 | Ga0207691_10290423 | |||
| 1133 | Ga0207711_10000025 | |||
| 1134 | Ga0207711_10020383 | |||
| 1135 | Ga0207711_10429445 | |||
| 1136 | Ga0207689_10000060 | |||
| 1137 | Ga0207689_10083820 | |||
| 1138 | Ga0207679_10038837 | |||
| 1139 | Ga0207679_10042339 | |||
| 1140 | Ga0207679_10240411 | |||
| 1141 | Ga0207667_10000002 | |||
| 1142 | Ga0207667_10000017 | |||
| 1143 | Ga0207667_10002977 | |||
| 1144 | Ga0207667_10016552 | |||
| 1145 | Ga0207667_10038294 | |||
| 1146 | Ga0207667_10104027 | |||
| 1147 | Ga0207667_10436746 | |||
| 1148 | Ga0207651_10000004 | |||
| 1149 | Ga0207651_10023484 | |||
| 1150 | Ga0207651_10061183 | |||
| 1151 | Ga0207712_10000012 | |||
| 1152 | Ga0207712_10001388 | |||
| 1153 | Ga0207712_10412158 | |||
| 1154 | Ga0207712_11105837 | |||
| 1155 | Ga0207712_11452804 | |||
| 1156 | Ga0207712_12001469 | |||
| 1157 | Ga0207668_10000062 | |||
| 1158 | Ga0207668_10000459 | |||
| 1159 | Ga0207668_10124865 | |||
| 1160 | Ga0207640_10000406 | |||
| 1161 | Ga0207640_10001048 | |||
| 1162 | Ga0207640_10006873 | |||
| 1163 | Ga0207640_10045007 | |||
| 1164 | Ga0207640_10064358 | |||
| 1165 | Ga0207640_10213160 | |||
| 1166 | Ga0207658_10000153 | |||
| 1167 | Ga0207658_10000539 | |||
| 1168 | Ga0207658_10006472 | |||
| 1169 | Ga0207658_10124004 | |||
| 1170 | Ga0207677_10000060 | |||
| 1171 | Ga0207677_10088000 | |||
| 1172 | Ga0207677_10402104 | |||
| 1173 | Ga0207677_11225198 | |||
| 1174 | Ga0207703_10105168 | |||
| 1175 | Ga0207639_10007346 | |||
| 1176 | Ga0207639_10039093 | |||
| 1177 | Ga0207639_10453273 | |||
| 1178 | Ga0207678_10001389 | |||
| 1179 | Ga0207678_10020196 | |||
| 1180 | Ga0207702_10007341 | |||
| 1181 | Ga0207702_10007866 | |||
| 1182 | Ga0207702_10009078 | |||
| 1183 | Ga0207702_10077149 | |||
| 1184 | Ga0207702_10077668 | |||
| 1185 | Ga0207641_10000079 | |||
| 1186 | Ga0207641_10000103 | |||
| 1187 | Ga0207641_10002442 | |||
| 1188 | Ga0207641_10009618 | |||
| 1189 | Ga0207641_10017602 | |||
| 1190 | Ga0207641_10174726 | |||
| 1191 | Ga0207648_10000003 | |||
| 1192 | Ga0207648_10016583 | |||
| 1193 | Ga0207648_11637483 | |||
| 1194 | Ga0207676_10000044 | |||
| 1195 | Ga0207676_10147037 | |||
| 1196 | Ga0207676_10198802 | |||
| 1197 | Ga0207674_10000319 | |||
| 1198 | Ga0207674_10069420 | |||
| 1199 | Ga0207674_10234835 | |||
| 1200 | Ga0207674_12187787 | |||
| 1201 | Ga0207675_100051165 | |||
| 1202 | Ga0207683_10000075 | |||
| 1203 | Ga0207683_10004168 | |||
| 1204 | Ga0207683_10015350 | |||
| 1205 | Ga0207683_10233772 | |||
| 1206 | Ga0207683_10876324 | |||
| 1207 | Ga0207683_11314041 | |||
| 1208 | Ga0207698_10001449 | |||
| 1209 | Ga0207698_10006501 | |||
| 1210 | Ga0207698_10737960 | |||
| 1211 | Ga0268266_10000015 | |||
| 1212 | Ga0268266_10378178 | |||
| 1213 | Ga0268266_11071695 | |||
| 1214 | Ga0268265_10000125 | |||
| 1215 | Ga0268265_10000754 | |||
| 1216 | Ga0268264_10000347 | |||
| 1217 | Ga0268264_10100845 | |||
| 1218 | Ga0268264_10398544 | |||
| 1219 | Ga0268264_11215153 | |||
| 1220 | Ga0307517_10107907 | |||
| 1221 | Ga0307513_10016361 | |||
| 1222 | Ga0307513_10026396 | |||
| 1223 | Ga0307408_100006783 | |||
| 1224 | Ga0307408_100006926 | |||
| 1225 | Ga0307405_10058399 | |||
| 1226 | Ga0307405_10073616 | |||
| 1227 | Ga0307413_10006988 | |||
| 1228 | Ga0307413_10052817 | |||
| 1229 | Ga0307413_10775505 | |||
| 1230 | Ga0307410_10017150 | |||
| 1231 | Ga0307410_10064810 | |||
| 1232 | Ga0307406_10037403 | |||
| 1233 | Ga0307406_10065133 | |||
| 1234 | Ga0307407_10016684 | |||
| 1235 | Ga0307407_10110075 | |||
| 1236 | Ga0307412_10005086 | |||
| 1237 | Ga0307412_10017698 | |||
| 1238 | Ga0307412_11697139 | |||
| 1239 | Ga0307409_100015440 | |||
| 1240 | Ga0307409_100102052 | |||
| 1241 | Ga0307416_100002628 | |||
| 1242 | Ga0307416_100611774 | |||
| 1243 | Ga0307416_103033277 | |||
| 1244 | Ga0307414_10007367 | |||
| 1245 | Ga0307414_10354398 | |||
| 1246 | Ga0307411_10005662 | |||
| 1247 | Ga0307411_10009772 | |||
| 1248 | Ga0307415_100052521 | |||
| 1249 | Ga0307415_100100170 | |||
| 1250 | Ga0307415_100887935 | |||
| 1251 | Ga0395899_0002738 | |||
| 1252 | Ga0395899_0067795 | |||
| 1253 | Ga0395900_0055176 | |||
| 1254 | Ga0395900_0337395 | |||
| 1255 | Ga0395900_0411067 | |||
| 1256 | Ga0395898_0637887 | |||
| 1257 | Ga0395905_0114530 | |||
| 1258 | Ga0395905_0215918 | |||
| 1259 | Ga0395905_0382755 | |||
| 1260 | Ga0436364_1302975 | |||
| 1261 | Ga0395901_0099192 | |||
| 1262 | Ga0395901_0309646 | |||
| 1263 | Ga0395901_0328606 | |||
| 1264 | Ga0395901_1927983 | |||
| 1265 | Ga0237819_02653 | |||
| 1266 | Ga0237816_05045 | |||
| 1267 | Ga0436365_0412715 | |||
| 1268 | Ga0439436_0016645 | |||
| 1269 | Ga0439439_0121155 | |||
| 1270 | Ga0439461_0004626 | |||
| 1271 | Ga0439465_0006757 | |||
| 1272 | Ga0451793_0255256 | |||
| 1273 | Ga0451853_2493251 | |||
| 1274 | Ga0439431_0005179 | |||
| 1275 | Ga0439432_010633 | |||
| 1276 | Ga0439446_0064186 | |||
| 1277 | Ga0466966_0067597 | |||
| 1278 | Ga0466966_0319672 | |||
| 1279 | Ga0466961_0040935 | |||
| 1280 | Ga0466961_0122674 | |||
| 1281 | Ga0466963_0058844 | |||
| 1282 | Ga0466963_0108707 | |||
| 1283 | Ga0466964_0099856 | |||
| 1284 | Ga0466971_0004979 | |||
| 1285 | Ga0466971_0199951 | |||
| 1286 | Ga0466970_0103804 | |||
| 1287 | Ga0466970_0411923 | |||
| 1288 | Ga0466957_0009863 | |||
| 1289 | Ga0466957_0128384 | |||
| 1290 | Ga0466957_0131074 | |||
| 1291 | Ga0466957_0169830 | |||
| 1292 | Ga0466959_0036850 | |||
| 1293 | Ga0466958_0022147 | |||
| 1294 | Ga0466958_0048182 | |||
| 1295 | Ga0466967_0003933 | |||
| 1296 | Ga0495617_125856 | |||
| 1297 | Ga0495592_0786948 | |||
| 1298 | Ga0495638_0309533 | |||
| 1299 | Ga0495650_0000259 | |||
| 1300 | Ga0495650_0006744 | |||
| 1301 | Ga0495584_0005639 | |||
| 1302 | Ga0495584_0059190 | |||
| 1303 | Ga0495585_0009056 | |||
| 1304 | Ga0495596_0018840 | |||
| 1305 | Ga0495583_0033072 | |||
| 1306 | Ga0495583_0042526 | |||
| 1307 | Ga0495583_0122490 | |||
| 1308 | Ga0495606_0000029 | |||
| 1309 | Ga0495606_0066199 | |||
| 1310 | Ga0495616_0090193 | |||
| 1311 | Ga0495616_0183023 | |||
| 1312 | Ga0495631_0009935 | |||
| 1313 | Ga0495631_0332613 | |||
| 1314 | Ga0495637_0038137 | |||
| 1315 | Ga0495637_0135631 | |||
| 1316 | Ga0495643_0000163 | |||
| 1317 | Ga0495643_0006968 | |||
| 1318 | Ga0495643_0007751 | |||
| 1319 | Ga0495643_0317560 | |||
| 1320 | Ga0495648_0000291 | |||
| 1321 | Ga0495663_0000756 | |||
| 1322 | Ga0495642_0071207 | |||
| 1323 | Ga0495587_0468400 | |||
| 1324 | Ga0495597_0097196 | |||
| 1325 | Ga0495622_0006792 | |||
| 1326 | Ga0495633_0002070 | |||
| 1327 | Ga0495633_0027359 | |||
| 1328 | Ga0495668_0000016 | |||
| 1329 | Ga0495668_0048602 | |||
| 1330 | Ga0495668_0146365 | |||
| 1331 | Ga0495611_0143960 | |||
| 1332 | Ga0495611_0558796 | |||
| 1333 | Ga0495625_0000092 | |||
| 1334 | Ga0495625_0004356 | |||
| 1335 | Ga0495625_0010250 | |||
| 1336 | Ga0495625_0014866 | |||
| 1337 | Ga0495625_0054925 | |||
| 1338 | Ga0495661_0064241 | |||
| 1339 | Ga0495669_0000039 | |||
| 1340 | Ga0495669_0010231 | |||
| 1341 | Ga0495669_0022480 | |||
| 1342 | Ga0495669_0051827 | |||
| 1343 | Ga0495669_0059502 | |||
| 1344 | Ga0495670_0000015 | |||
| 1345 | Ga0495670_0221147 | |||
| 1346 | Ga0495670_0720909 | |||
| 1347 | Ga0495649_0058382 | |||
| 1348 | Ga0495600_0024882 | |||
| 1349 | Ga0495600_0110165 | |||
| 1350 | Ga0495660_0196273 | |||
| 1351 | Ga0495636_0235789 | |||
| 1352 | Ga0495683_0000947 | |||
| 1353 | Ga0495683_0047570 | |||
| 1354 | Ga0495683_0271664 | |||
| 1355 | Ga0495687_000098 | |||
| 1356 | Ga0495687_000471 | |||
| 1357 | Ga0495677_0002246 | |||
| 1358 | Ga0495677_0013510 | |||
| 1359 | Ga0495677_0018391 | |||
| 1360 | Ga0495685_138427 | |||
| 1361 | Ga0495681_0007945 | |||
| 1362 | Ga0495681_0153535 | |||
| 1363 | Ga0495686_0000486 | |||
| 1364 | Ga0495686_0040153 | |||
| 1365 | Ga0496100_0464024 | |||
| 1366 | Ga0496100_0562510 | |||
| 1367 | Ga0496101_0464135 | |||
| 1368 | Ga0496102_0000961 | |||
| 1369 | Ga0496102_0634626 | |||
| 1370 | Ga0496103_0000145 | |||
| 1371 | Ga0496103_0085761 | |||
| 1372 | Ga0496103_0299526 | |||
| 1373 | Ga0496104_0003941 | |||
| 1374 | Ga0496105_0000218 | |||
| 1375 | Ga0496107_0185584 | |||
| 1376 | Ga0496108_0006377 | |||
| 1377 | Ga0496109_0043625 | |||
| 1378 | Ga0496110_0007061 | |||
| 1379 | Ga0496111_0003030 | |||
| 1380 | Ga0496112_0043596 | |||
| 1381 | Ga0496113_0006174 | |||
| 1382 | Ga0496113_0753739 | |||
| 1383 | Ga0496114_0026742 | |||
| 1384 | Ga0496115_0000195 | |||
| 1385 | Ga0496115_0001359 | |||
| 1386 | Ga0496116_0010920 | |||
| 1387 | Ga0496117_0000910 | |||
| 1388 | Ga0496117_0003090 | |||
| 1389 | Ga0496117_0151533 | |||
| 1390 | Ga0496118_0000091 | |||
| 1391 | Ga0496118_0000339 | |||
| 1392 | Ga0496119_0010325 | |||
| 1393 | Ga0496120_0059756 | |||
| 1394 | Ga0496120_0074129 | |||
| 1395 | Ga0496121_0000105 | |||
| 1396 | Ga0496121_0000429 | |||
| 1397 | Ga0496121_0003357 | |||
| 1398 | Ga0496121_0014603 | |||
| 1399 | Ga0496121_0330273 | |||
| 1400 | Ga0496122_0128770 | |||
| 1401 | Ga0496122_0219332 | |||
| 1402 | Ga0496123_0042673 | |||
| 1403 | Ga0496123_0070886 | |||
| 1404 | Ga0496123_0170339 | |||
| 1405 | Ga0496123_0292996 | |||
| 1406 | Ga0496124_0000375 | |||
| 1407 | Ga0496124_0018814 | |||
| 1408 | Ga0496124_0050792 | |||
| 1409 | Ga0496124_0178404 | |||
| 1410 | Ga0496124_0380187 | |||
| 1411 | Ga0496125_0052345 | |||
| 1412 | Ga0496126_0000443 | |||
| 1413 | Ga0496126_0010422 | |||
| 1414 | Ga0496126_0038558 | |||
| 1415 | Ga0495682_0374199 | |||
| 1416 | Ga0501070_0636980 | |||
| 1417 | nmdc:mga0sz30_48265_c1 | |||
| 1418 | Ga0500610_0000063 | |||
| 1419 | Ga0500643_000466 | |||
| 1420 | Ga0500643_001269 | |||
| 1421 | Ga0500643_018551 | |||
| 1422 | Ga0500647_0117418 | |||
| 1423 | Ga0500641_0006923 | |||
| 1424 | Ga0500556_0231231 | |||
| 1425 | Ga0500562_046930 | |||
| 1426 | Ga0500562_071691 | |||
| 1427 | Ga0500595_000475 | |||
| 1428 | Ga0500597_001091 | |||
| 1429 | Ga0500607_155702 | |||
| 1430 | Ga0500642_0004242 | |||
| 1431 | Ga0500658_0019033 | |||
| 1432 | Ga0500585_150412 | |||
| 1433 | Ga0500588_0037695 | |||
| 1434 | Ga0500616_0017435 | |||
| 1435 | Ga0500619_083722 | |||
| 1436 | Ga0500624_000023 | |||
| 1437 | Ga0500627_0170718 | |||
| 1438 | Ga0500636_0000462 | |||
| 1439 | Ga0500637_0000013 | |||
| 1440 | Ga0500645_000002 | |||
| 1441 | Ga0500645_031256 | |||
| 1442 | Ga0500609_015863 | |||
| 1443 | Ga0500596_000052 | |||
| 1444 | 2600228610 | |||
| 1445 | 2644125898 | |||
| 1446 | 2819714579 | |||
| 1447 | 2879165613 | |||
| 1448 | 2885431565 | |||
| 1449 | 2886633996 | |||
| 1450 | 2928529082 | |||
| 1451 | 2928968599 | |||
| 1452 | 8057102116 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3j7y-assembly1.cif.gz_p | structure of the large ribosomal subunit from human mitochondria | 0.8374 | 5 | 93 |
| 7a5g-assembly1.cif.gz_b6 | structure of the elongating human mitoribosome bound to mtef-tu.gmppcp and a/t mt-trna | 0.8062 | 11 | 93 |
| 7oi6-assembly1.cif.gz_p | cryo-em structure of late human 39s mitoribosome assembly intermediates, state 1 | 0.8009 | 1 | 93 |
| 7jt1-assembly1.cif.gz_9 | 70s ribosome stalled on long mrna with arfb-1 and arfb-2 bound (+9-iii) | 0.7956 | 30 | 93 |
| 1l4s-assembly1.cif.gz_A | solution structure of ribosome associated factor y | 0.7956 | 31 | 95 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R0GKX2_1_61_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8649 | 35 | 92 | 3.30.160.20 |
| 3j7yp00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8374 | 5 | 93 | 3.30.160.20 |
| af_A0A0R0GKX2_1_61_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8164 | 35 | 92 | 3.30.160.20 |
| af_Q7XD96_1552_1629_3.30.160.20 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; | 0.8154 | 31 | 91 | 3.30.160.20 |
| af_Q5AI30_155_260_3.30.1460.20 | Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; | 0.8066 | 6 | 98 | 3.30.1460.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352HBL5-F1-model_v4 | deleted | 0.8699 | 11 | 95 |
|
| AF-A0A3D2PIA2-F1-model_v4 | deleted | 0.8593 | 11 | 94 |
|
| AF-A0A7S2IT84-F1-model_v4 | Prokaryotic-type class I peptide chain release factors domain-containing protein | 0.8567 | 4 | 93 |
GO:0004045
GO:0005762 GO:0016150 GO:0070126 |
| AF-A0A2E7U4D1-F1-model_v4 | deleted | 0.8552 | 4 | 96 |
|
| AF-A0A7Z9SFB3-F1-model_v4 | Aminoacyl-tRNA hydrolase | 0.8527 | 1 | 97 |
GO:0003747
GO:0004045 GO:0043022 GO:0072344 |