F477705

General Info

Members Datasets Scaffolds Average Seq Length
726 318 1452 133

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0000129|Ga0496124_0000129_144766_145221
Length 151
Sequence MAMRRYPRASIISASAAPMAEIPDAAIVEEKFLAATGPGGQNVNKVATAVQLRIDVFRLGLSPYAYERLKELAGTRMTSAGELLITARQYRTQDANRTDARQRLSDLIDKAHERQARRVKTKPSKAAKXRRVDAKKGRSVVKAGRGKVSFD

Samples

Sample ID Description Type Environment
1 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
39 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
45 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
46 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
189 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
203 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
206 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
207 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
208 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
209 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
210 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
211 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
212 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
213 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
219 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
220 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
221 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
225 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
226 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
229 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
230 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
252 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
253 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
254 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
255 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
256 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
257 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
258 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
259 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
260 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
261 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
262 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
263 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
279 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
286 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
287 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
288 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
289 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
290 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
291 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
292 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
293 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
294 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
295 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
296 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
297 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
298 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
299 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
300 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
303 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
304 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
305 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
306 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
308 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
309 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
310 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
311 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
312 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
313 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
314 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
315 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
316 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
317 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
318 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.76
Metatranscriptomes 0
Isolates 1.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.85
Nodule 0.14
Rhizoplane 3.17
Rhizosphere 78.65
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496124_0000129 3300048927 Bacteria 156648
2 ARcpr5oldR_c011761 3300000041 Bacteria 748
3 ARcpr5yngRDRAFT_c009262 3300000043 Bacteria 843
4 JGI24740J21852_10003761 3300001979 Bacteria 6606
5 JGI24739J22299_10024914 3300001989 Bacteria 2106
6 JGI24737J22298_10000315 3300001990 Bacteria 16196
7 JGI24737J22298_10004866 3300001990 Bacteria 4657
8 JGI24737J22298_10005025 3300001990 Bacteria 4584
9 JGI24737J22298_10034423 3300001990 Bacteria 1570
10 JGI24735J21928_10005077 3300002067 Bacteria 4380
11 JGI24735J21928_10021864 3300002067 Bacteria 1950
12 JGI24735J21928_10051185 3300002067 Bacteria 1192
13 JGI24738J21930_10002201 3300002075 Bacteria 5187
14 JGI24738J21930_10041608 3300002075 Bacteria 934
15 JGI24744J21845_10002683 3300002077 Bacteria 3628
16 JGI25151J46595_10139345 3300003187 Bacteria 593
17 JGI25165J46597_1000040 3300003214 Bacteria 277491
18 JGI25153J46596_10000031 3300003215 Bacteria 196926
19 JGI25153J46596_10000091 3300003215 Bacteria 105614
20 JGI25153J46596_10045061 3300003215 Bacteria 1320
21 rootH2_10005041 3300003320 Bacteria 1664
22 Ga0055525_1000012 3300003759 Bacteria 486564
23 Ga0055542_1000322 3300003762 Bacteria 51124
24 Ga0055529_1000014 3300003763 Bacteria 367283
25 Ga0055526_1003569 3300003771 Bacteria 9796
26 Ga0055537_1001470 3300003773 Bacteria 9160
27 Ga0055537_1001547 3300003773 Bacteria 8796
28 Ga0055524_1001171 3300003775 Bacteria 15663
29 Ga0055536_1026317 3300003781 Bacteria 1634
30 Ga0055530_10009450 3300003791 Bacteria 3746
31 Ga0055530_10022076 3300003791 Bacteria 1860
32 Ga0055530_10075464 3300003791 Bacteria 718
33 Ga0055540_1004562 3300003792 Bacteria 6168
34 Ga0055531_10013567 3300003794 Bacteria 3746
35 Ga0055531_10029632 3300003794 Bacteria 1860
36 Ga0065165_1002705 3300005262 Bacteria 14222
37 Ga0065165_1003177 3300005262 Bacteria 12034
38 Ga0065165_1013615 3300005262 Bacteria 3220
39 Ga0065712_10075190 3300005290 Bacteria 3901
40 Ga0065715_10132303 3300005293 Bacteria 1993
41 Ga0070658_10000022 3300005327 Bacteria 186706
42 Ga0070658_10005125 3300005327 Bacteria 10668
43 Ga0070658_10010467 3300005327 Bacteria 7440
44 Ga0070658_11054536 3300005327 Bacteria 707
45 Ga0070676_10004634 3300005328 Bacteria 7259
46 Ga0070676_10009924 3300005328 Bacteria 5154
47 Ga0070676_10223767 3300005328 Bacteria 1244
48 Ga0070676_10770078 3300005328 Bacteria 708
49 Ga0070676_11104862 3300005328 Bacteria 599
50 Ga0070683_100384779 3300005329 Bacteria 1337
51 Ga0070683_100920270 3300005329 Bacteria 839
52 Ga0070670_100011899 3300005331 Bacteria 7440
53 Ga0070670_100025648 3300005331 Bacteria 5071
54 Ga0070670_100234775 3300005331 Bacteria 1596
55 Ga0070670_100466931 3300005331 Bacteria 1120
56 Ga0070677_10085291 3300005333 Bacteria 1362
57 Ga0068869_100000467 3300005334 Bacteria 22352
58 Ga0070666_10054920 3300005335 Bacteria 2687
59 Ga0070666_10062800 3300005335 Bacteria 2517
60 Ga0070680_100169757 3300005336 Bacteria 1835
61 Ga0068868_100000092 3300005338 Bacteria 55036
62 Ga0068868_100442712 3300005338 Bacteria 1129
63 Ga0070660_100000751 3300005339 Bacteria 21524
64 Ga0070660_100003262 3300005339 Bacteria 11132
65 Ga0070660_100056773 3300005339 Bacteria 3030
66 Ga0070660_100357805 3300005339 Bacteria 1203
67 Ga0070660_100541547 3300005339 Bacteria 971
68 Ga0070661_100000130 3300005344 Bacteria 62986
69 Ga0070661_100033253 3300005344 Bacteria 3735
70 Ga0070661_100164048 3300005344 Bacteria 1684
71 Ga0070661_100236900 3300005344 Bacteria 1404
72 Ga0070692_10001368 3300005345 Bacteria 8801
73 Ga0070692_10061516 3300005345 Bacteria 1979
74 Ga0070668_100000906 3300005347 Bacteria 20637
75 Ga0070668_100022772 3300005347 Bacteria 4736
76 Ga0070668_100029073 3300005347 Bacteria 4196
77 Ga0070668_101124712 3300005347 Bacteria 710
78 Ga0070669_100009672 3300005353 Bacteria 6867
79 Ga0070669_100107486 3300005353 Bacteria 2113
80 Ga0070669_100409854 3300005353 Bacteria 1110
81 Ga0070675_100095820 3300005354 Bacteria 2492
82 Ga0070675_100151839 3300005354 Bacteria 1986
83 Ga0070675_100364353 3300005354 Bacteria 1284
84 Ga0070671_100020082 3300005355 Bacteria 5443
85 Ga0070674_100000035 3300005356 Bacteria 60166
86 Ga0070674_100000329 3300005356 Bacteria 23441
87 Ga0070674_100714248 3300005356 Bacteria 858
88 Ga0070673_100000009 3300005364 Bacteria 155005
89 Ga0070673_100005666 3300005364 Bacteria 8024
90 Ga0070673_100256013 3300005364 Bacteria 1527
91 Ga0070659_100048117 3300005366 Bacteria 3348
92 Ga0070659_100140735 3300005366 Bacteria 1964
93 Ga0070659_100149520 3300005366 Bacteria 1904
94 Ga0070659_100427247 3300005366 Bacteria 1121
95 Ga0070659_100452625 3300005366 Bacteria 1089
96 Ga0070659_102158394 3300005366 Bacteria 501
97 Ga0070667_100000641 3300005367 Bacteria 33965
98 Ga0070667_100002416 3300005367 Bacteria 16338
99 Ga0070667_100018960 3300005367 Bacteria 5704
100 Ga0070667_100203038 3300005367 Bacteria 1759
101 Ga0070667_100603514 3300005367 Bacteria 1011
102 Ga0070663_100009984 3300005455 Bacteria 5902
103 Ga0070663_100086230 3300005455 Bacteria 2318
104 Ga0070663_101402580 3300005455 Bacteria 619
105 Ga0070678_100000060 3300005456 Bacteria 39901
106 Ga0070678_100009721 3300005456 Bacteria 5843
107 Ga0070678_100480004 3300005456 Bacteria 1094
108 Ga0070662_100010272 3300005457 Bacteria 6137
109 Ga0070662_100010751 3300005457 Bacteria 6024
110 Ga0070662_100098202 3300005457 Bacteria 2211
111 Ga0070662_100397579 3300005457 Bacteria 1137
112 Ga0070662_100480689 3300005457 Bacteria 1034
113 Ga0070681_10015840 3300005458 Bacteria 7516
114 Ga0070681_10107967 3300005458 Bacteria 2724
115 Ga0070681_10587461 3300005458 Bacteria 1028
116 Ga0070681_10729352 3300005458 Bacteria 907
117 Ga0068867_100000002 3300005459 Bacteria 247206
118 Ga0068867_100004940 3300005459 Bacteria 9396
119 Ga0068867_101384863 3300005459 Bacteria 652
120 Ga0070679_100000021 3300005530 Bacteria 124652
121 Ga0070679_100637845 3300005530 Bacteria 1008
122 Ga0070684_101007723 3300005535 Bacteria 782
123 Ga0068853_100038814 3300005539 Bacteria 4058
124 Ga0068853_100089389 3300005539 Bacteria 2705
125 Ga0068853_100114747 3300005539 Bacteria 2396
126 Ga0068853_100144186 3300005539 Bacteria 2139
127 Ga0068853_100550260 3300005539 Bacteria 1093
128 Ga0070672_100008045 3300005543 Bacteria 7202
129 Ga0070672_100022207 3300005543 Bacteria 4655
130 Ga0070672_100299934 3300005543 Bacteria 1362
131 Ga0070696_100006792 3300005546 Bacteria 7642
132 Ga0070665_100000115 3300005548 Bacteria 151164
133 Ga0070665_100084334 3300005548 Bacteria 3183
134 Ga0070665_100518185 3300005548 Bacteria 1204
135 Ga0068855_100000333 3300005563 Bacteria 58773
136 Ga0068855_100001164 3300005563 Bacteria 32603
137 Ga0068855_100049033 3300005563 Bacteria 4983
138 Ga0068855_100095443 3300005563 Bacteria 3427
139 Ga0068855_100899917 3300005563 Bacteria 935
140 Ga0068855_101844867 3300005563 Unclassified 613
141 Ga0070664_100008107 3300005564 Bacteria 8491
142 Ga0070664_100105053 3300005564 Bacteria 2460
143 Ga0070664_100272568 3300005564 Bacteria 1525
144 Ga0070664_100514718 3300005564 Bacteria 1104
145 Ga0068857_100004444 3300005577 Bacteria 11862
146 Ga0068854_100000380 3300005578 Bacteria 28213
147 Ga0068854_100025690 3300005578 Bacteria 4041
148 Ga0068854_100119227 3300005578 Bacteria 2001
149 Ga0068854_100241662 3300005578 Bacteria 1438
150 Ga0068854_101001322 3300005578 Bacteria 740
151 Ga0068856_100013110 3300005614 Bacteria 8029
152 Ga0068856_100031423 3300005614 Bacteria 5194
153 Ga0068852_100001302 3300005616 Bacteria 16691
154 Ga0068852_100347958 3300005616 Bacteria 1446
155 Ga0068859_100012317 3300005617 Bacteria 8605
156 Ga0068859_100160863 3300005617 Bacteria 2324
157 Ga0068859_100237719 3300005617 Bacteria 1910
158 Ga0068859_100622361 3300005617 Bacteria 1172
159 Ga0068859_100726087 3300005617 Bacteria 1083
160 Ga0068864_100000016 3300005618 Bacteria 292454
161 Ga0068864_100380181 3300005618 Bacteria 1338
162 Ga0068864_100399098 3300005618 Bacteria 1306
163 Ga0068851_10012325 3300005834 Bacteria 4027
164 Ga0068851_10438833 3300005834 Bacteria 774
165 Ga0068863_100000047 3300005841 Bacteria 140249
166 Ga0068863_100000089 3300005841 Bacteria 101645
167 Ga0068863_100003668 3300005841 Bacteria 15161
168 Ga0068863_100008189 3300005841 Bacteria 10212
169 Ga0068863_100058002 3300005841 Bacteria 3664
170 Ga0068863_100119831 3300005841 Bacteria 2508
171 Ga0068863_101829075 3300005841 Bacteria 617
172 Ga0068858_100008945 3300005842 Bacteria 9597
173 Ga0068860_100001603 3300005843 Bacteria 24294
174 Ga0068860_100148772 3300005843 Bacteria 2254
175 Ga0068860_100315051 3300005843 Bacteria 1535
176 Ga0068862_100000068 3300005844 Bacteria 123535
177 Ga0068862_100000986 3300005844 Bacteria 27222
178 Ga0081539_10007074 3300005985 Bacteria 10376
179 Ga0075369_10038377 3300006186 Bacteria 2043
180 Ga0097621_100021424 3300006237 Bacteria 4999
181 Ga0068871_100004655 3300006358 Bacteria 9585
182 Ga0068871_100171913 3300006358 Bacteria 1858
183 Ga0068871_100285428 3300006358 Bacteria 1445
184 Ga0068865_100000014 3300006881 Bacteria 138727
185 Ga0068865_100195482 3300006881 Bacteria 1567
186 Ga0068865_100384205 3300006881 Bacteria 1146
187 Ga0068865_100459451 3300006881 Bacteria 1054
188 Ga0068865_100803238 3300006881 Bacteria 812
189 Ga0097620_100012317 3300006931 Bacteria 8605
190 Ga0097620_100160860 3300006931 Bacteria 2324
191 Ga0097620_100237718 3300006931 Bacteria 1910
192 Ga0097620_100622359 3300006931 Bacteria 1172
193 Ga0097620_100726105 3300006931 Bacteria 1083
194 Ga0099826_10111731 3300006948 Bacteria 1627
195 Ga0105251_10001932 3300009011 Bacteria 16960
196 Ga0105240_10004046 3300009093 Bacteria 22558
197 Ga0105240_10038634 3300009093 Bacteria 6121
198 Ga0105240_10051063 3300009093 Bacteria 5207
199 Ga0105240_10282098 3300009093 Bacteria 1908
200 Ga0105245_10001236 3300009098 Bacteria 23068
201 Ga0105245_11816733 3300009098 Bacteria 662
202 Ga0105247_10000985 3300009101 Bacteria 21464
203 Ga0105247_10015646 3300009101 Bacteria 4541
204 Ga0105247_10106888 3300009101 Bacteria 1796
205 Ga0105243_10000070 3300009148 Bacteria 120851
206 Ga0105243_10001791 3300009148 Bacteria 18449
207 Ga0105243_10073758 3300009148 Bacteria 2766
208 Ga0105243_10546149 3300009148 Bacteria 1106
209 Ga0105243_10619836 3300009148 Bacteria 1044
210 Ga0105241_10004388 3300009174 Bacteria 10429
211 Ga0105241_10130977 3300009174 Bacteria 2031
212 Ga0105242_10000273 3300009176 Bacteria 41098
213 Ga0105242_11443763 3300009176 Bacteria 717
214 Ga0105248_10000021 3300009177 Bacteria 276159
215 Ga0105248_10002393 3300009177 Bacteria 20837
216 Ga0105248_10018071 3300009177 Bacteria 7783
217 Ga0105237_10004611 3300009545 Bacteria 15889
218 Ga0105237_10017550 3300009545 Bacteria 7416
219 Ga0105237_10032273 3300009545 Bacteria 5302
220 Ga0105237_10078880 3300009545 Bacteria 3282
221 Ga0105237_11523622 3300009545 Bacteria 675
222 Ga0105238_10080044 3300009551 Bacteria 3257
223 Ga0105238_10118232 3300009551 Bacteria 2631
224 Ga0105238_10558728 3300009551 Bacteria 1149
225 Ga0105249_10000017 3300009553 Bacteria 277115
226 Ga0105249_10001264 3300009553 Bacteria 22162
227 Ga0105249_10001584 3300009553 Bacteria 19942
228 Ga0105249_10288452 3300009553 Bacteria 1642
229 Ga0105249_11992838 3300009553 Bacteria 653
230 Ga0105249_12757113 3300009553 Bacteria 563
231 Ga0105249_13212122 3300009553 Bacteria 525
232 Ga0105239_10000546 3300010375 Bacteria 53959
233 Ga0105239_10038762 3300010375 Bacteria 5221
234 Ga0105239_10686070 3300010375 Bacteria 1171
235 Ga0105239_11258994 3300010375 Bacteria 853
236 Ga0105246_10002662 3300011119 Bacteria 10819
237 Ga0105246_10054421 3300011119 Bacteria 2758
238 Ga0157326_1001062 3300012513 Bacteria 3100
239 Ga0157373_10043654 3300013100 Bacteria 3202
240 Ga0157373_10083098 3300013100 Bacteria 2257
241 Ga0157373_10086011 3300013100 Bacteria 2216
242 Ga0157371_10000193 3300013102 Bacteria 90182
243 Ga0157371_10054006 3300013102 Bacteria 2854
244 Ga0157371_10073640 3300013102 Bacteria 2419
245 Ga0157371_10514372 3300013102 Bacteria 885
246 Ga0157371_10554301 3300013102 Bacteria 852
247 Ga0157371_10863917 3300013102 Bacteria 684
248 Ga0157370_10000117 3300013104 Bacteria 92168
249 Ga0157370_10853360 3300013104 Bacteria 827
250 Ga0157369_10030477 3300013105 Bacteria 5949
251 Ga0157369_10170694 3300013105 Bacteria 2292
252 Ga0157374_10000831 3300013296 Bacteria 27036
253 Ga0157374_10005135 3300013296 Bacteria 10980
254 Ga0157374_10041788 3300013296 Bacteria 4227
255 Ga0157374_10335658 3300013296 Bacteria 1500
256 Ga0157378_10000944 3300013297 Bacteria 26700
257 Ga0163162_10011469 3300013306 Bacteria 8644
258 Ga0157372_10182260 3300013307 Bacteria 2431
259 Ga0157372_10275339 3300013307 Bacteria 1956
260 Ga0157372_10286207 3300013307 Bacteria 1917
261 Ga0157372_10337359 3300013307 Bacteria 1756
262 Ga0157375_10002997 3300013308 Bacteria 14669
263 Ga0157375_10111021 3300013308 Bacteria 2840
264 Ga0157375_10141594 3300013308 Bacteria 2532
265 Ga0163163_10013700 3300014325 Bacteria 7429
266 Ga0163163_10067172 3300014325 Bacteria 3564
267 Ga0163163_12888084 3300014325 Bacteria 536
268 Ga0157377_10026133 3300014745 Bacteria 3121
269 Ga0157379_10151556 3300014968 Bacteria 2091
270 Ga0157376_10000186 3300014969 Bacteria 43043
271 Ga0163161_10261965 3300017792 Bacteria 1350
272 Ga0163161_10308905 3300017792 Bacteria 1247
273 Ga0213875_10419316 3300021388 Bacteria 639
274 Ga0209563_100030 3300025230 Bacteria 489259
275 Ga0207427_100441 3300025231 Bacteria 23126
276 Ga0207425_1000049 3300025245 Bacteria 180735
277 Ga0207425_1008078 3300025245 Bacteria 2723
278 Ga0209026_1000675 3300025250 Bacteria 20558
279 Ga0209677_117223 3300025253 Bacteria 905
280 Ga0209148_1000011 3300025254 Bacteria 1196503
281 Ga0209129_1001668 3300025258 Bacteria 12020
282 Ga0209233_1000003 3300025261 Bacteria 1607366
283 Ga0209565_1000007 3300025263 Bacteria 784361
284 Ga0209565_1000170 3300025263 Bacteria 84580
285 Ga0209455_1000006 3300025272 Bacteria 1196503
286 Ga0209455_1024217 3300025272 Bacteria 1125
287 Ga0209673_1007604 3300025273 Bacteria 4953
288 Ga0209673_1032519 3300025273 Bacteria 1606
289 Ga0209675_1004240 3300025291 Bacteria 6463
290 Ga0209676_1010374 3300025292 Bacteria 3892
291 Ga0209676_1023070 3300025292 Bacteria 2045
292 Ga0209025_1000068 3300025294 Bacteria 294129
293 Ga0209564_1000335 3300025295 Bacteria 91079
294 Ga0209564_1026133 3300025295 Bacteria 1939
295 Ga0209758_1000001 3300025297 Bacteria 1981790
296 Ga0209758_1000004 3300025297 Bacteria 1375322
297 Ga0209758_1018028 3300025297 Bacteria 3482
298 Ga0209758_1054268 3300025297 Bacteria 1370
299 Ga0209050_1000001 3300025298 Bacteria 3563507
300 Ga0209050_1006899 3300025298 Bacteria 6573
301 Ga0209050_1021069 3300025298 Bacteria 2394
302 Ga0209256_1000009 3300025299 Bacteria 922071
303 Ga0209256_1000010 3300025299 Bacteria 912110
304 Ga0207426_1032149 3300025302 Bacteria 1704
305 Ga0207426_1111532 3300025302 Bacteria 688
306 Ga0209051_1000191 3300025303 Bacteria 108763
307 Ga0209051_1071930 3300025303 Bacteria 1037
308 Ga0209257_1003180 3300025304 Bacteria 14609
309 Ga0209257_1003572 3300025304 Bacteria 13185
310 Ga0209257_1003678 3300025304 Bacteria 12808
311 Ga0207697_10126939 3300025315 Bacteria 1101
312 Ga0207656_10084319 3300025321 Bacteria 1433
313 Ga0207656_10348198 3300025321 Bacteria 739
314 Ga0207710_10082022 3300025900 Bacteria 1497
315 Ga0207688_10024275 3300025901 Bacteria 3324
316 Ga0207688_10274284 3300025901 Bacteria 1026
317 Ga0207680_10202815 3300025903 Bacteria 1352
318 Ga0207647_10009257 3300025904 Bacteria 7004
319 Ga0207647_10011528 3300025904 Bacteria 6195
320 Ga0207647_10018578 3300025904 Bacteria 4697
321 Ga0207647_10018802 3300025904 Bacteria 4661
322 Ga0207647_10144287 3300025904 Bacteria 1394
323 Ga0207647_10160000 3300025904 Bacteria 1314
324 Ga0207647_10358421 3300025904 Bacteria 825
325 Ga0207645_10015318 3300025907 Bacteria 5098
326 Ga0207645_10025433 3300025907 Bacteria 3831
327 Ga0207645_10509924 3300025907 Bacteria 815
328 Ga0207645_10664613 3300025907 Bacteria 708
329 Ga0207705_10000042 3300025909 Bacteria 182120
330 Ga0207705_10000188 3300025909 Bacteria 64247
331 Ga0207705_10021287 3300025909 Bacteria 4626
332 Ga0207705_10661603 3300025909 Bacteria 812
333 Ga0207705_10955698 3300025909 Bacteria 663
334 Ga0207654_10000227 3300025911 Bacteria 34512
335 Ga0207707_10013301 3300025912 Bacteria 7172
336 Ga0207707_10130828 3300025912 Bacteria 2195
337 Ga0207707_10286433 3300025912 Bacteria 1426
338 Ga0207695_10003844 3300025913 Bacteria 20795
339 Ga0207695_10015444 3300025913 Bacteria 8988
340 Ga0207695_10028168 3300025913 Bacteria 6237
341 Ga0207695_10083252 3300025913 Bacteria 3232
342 Ga0207695_10091255 3300025913 Bacteria 3060
343 Ga0207671_10004049 3300025914 Bacteria 14213
344 Ga0207671_10012108 3300025914 Bacteria 6965
345 Ga0207671_10036679 3300025914 Bacteria 3637
346 Ga0207671_10044525 3300025914 Bacteria 3282
347 Ga0207660_10003328 3300025917 Bacteria 10490
348 Ga0207662_10355880 3300025918 Bacteria 984
349 Ga0207657_10000900 3300025919 Bacteria 31430
350 Ga0207657_10001241 3300025919 Bacteria 27265
351 Ga0207657_10001555 3300025919 Bacteria 24617
352 Ga0207657_10016697 3300025919 Bacteria 7074
353 Ga0207657_10048500 3300025919 Bacteria 3708
354 Ga0207657_10136202 3300025919 Bacteria 2009
355 Ga0207657_10263111 3300025919 Bacteria 1372
356 Ga0207657_10322123 3300025919 Bacteria 1222
357 Ga0207657_10440642 3300025919 Bacteria 1023
358 Ga0207649_10000134 3300025920 Bacteria 63335
359 Ga0207649_10002240 3300025920 Bacteria 10928
360 Ga0207649_10032880 3300025920 Bacteria 3095
361 Ga0207649_10202905 3300025920 Bacteria 1402
362 Ga0207652_10000047 3300025921 Bacteria 125286
363 Ga0207652_10493523 3300025921 Bacteria 1103
364 Ga0207652_11278017 3300025921 Bacteria 636
365 Ga0207681_10008042 3300025923 Bacteria 6454
366 Ga0207681_10146964 3300025923 Bacteria 1762
367 Ga0207694_10000683 3300025924 Bacteria 30452
368 Ga0207650_10000069 3300025925 Bacteria 138442
369 Ga0207650_10003451 3300025925 Bacteria 10859
370 Ga0207650_10050776 3300025925 Bacteria 3068
371 Ga0207650_10216175 3300025925 Bacteria 1541
372 Ga0207650_10740809 3300025925 Bacteria 831
373 Ga0207659_10112865 3300025926 Bacteria 2069
374 Ga0207659_10240661 3300025926 Bacteria 1464
375 Ga0207659_11431214 3300025926 Bacteria 592
376 Ga0207687_10000252 3300025927 Bacteria 36302
377 Ga0207644_10006505 3300025931 Bacteria 7618
378 Ga0207690_10001286 3300025932 Bacteria 15851
379 Ga0207690_10063454 3300025932 Bacteria 2519
380 Ga0207690_10243567 3300025932 Bacteria 1386
381 Ga0207690_10420538 3300025932 Bacteria 1069
382 Ga0207690_10432323 3300025932 Bacteria 1055
383 Ga0207706_10004012 3300025933 Bacteria 13933
384 Ga0207706_10059349 3300025933 Bacteria 3369
385 Ga0207706_10101956 3300025933 Bacteria 2525
386 Ga0207706_10167689 3300025933 Bacteria 1930
387 Ga0207706_10737468 3300025933 Bacteria 840
388 Ga0207706_10893307 3300025933 Bacteria 751
389 Ga0207686_10001911 3300025934 Bacteria 11532
390 Ga0207709_10000066 3300025935 Bacteria 189194
391 Ga0207709_10000246 3300025935 Bacteria 66685
392 Ga0207709_11099301 3300025935 Bacteria 653
393 Ga0207669_10000030 3300025937 Bacteria 88341
394 Ga0207669_10000615 3300025937 Bacteria 15477
395 Ga0207669_10031379 3300025937 Bacteria 2968
396 Ga0207669_10037347 3300025937 Bacteria 2786
397 Ga0207704_10000002 3300025938 Bacteria 303025
398 Ga0207704_10000007 3300025938 Bacteria 211230
399 Ga0207704_10051567 3300025938 Bacteria 2489
400 Ga0207704_10894299 3300025938 Bacteria 746
401 Ga0207704_11304893 3300025938 Bacteria 621
402 Ga0207691_10008730 3300025940 Bacteria 9719
403 Ga0207691_10087107 3300025940 Bacteria 2801
404 Ga0207691_10134528 3300025940 Bacteria 2182
405 Ga0207691_10233886 3300025940 Bacteria 1590
406 Ga0207691_10290423 3300025940 Bacteria 1406
407 Ga0207711_10000025 3300025941 Bacteria 289972
408 Ga0207711_10020383 3300025941 Bacteria 5527
409 Ga0207711_10429445 3300025941 Bacteria 1229
410 Ga0207689_10000060 3300025942 Bacteria 85326
411 Ga0207689_10083820 3300025942 Bacteria 2621
412 Ga0207679_10038837 3300025945 Bacteria 3396
413 Ga0207679_10042339 3300025945 Bacteria 3272
414 Ga0207679_10240411 3300025945 Bacteria 1534
415 Ga0207667_10000002 3300025949 Bacteria 895662
416 Ga0207667_10000017 3300025949 Bacteria 390654
417 Ga0207667_10002977 3300025949 Bacteria 21052
418 Ga0207667_10016552 3300025949 Bacteria 8328
419 Ga0207667_10038294 3300025949 Bacteria 5123
420 Ga0207667_10104027 3300025949 Bacteria 2928
421 Ga0207667_10436746 3300025949 Bacteria 1331
422 Ga0207651_10000004 3300025960 Bacteria 290191
423 Ga0207651_10023484 3300025960 Bacteria 3794
424 Ga0207651_10061183 3300025960 Bacteria 2617
425 Ga0207712_10000012 3300025961 Bacteria 392363
426 Ga0207712_10001388 3300025961 Bacteria 16564
427 Ga0207712_10412158 3300025961 Bacteria 1138
428 Ga0207712_11105837 3300025961 Bacteria 705
429 Ga0207712_11452804 3300025961 Bacteria 614
430 Ga0207712_12001469 3300025961 Bacteria 518
431 Ga0207668_10000062 3300025972 Bacteria 88123
432 Ga0207668_10000459 3300025972 Bacteria 25616
433 Ga0207668_10124865 3300025972 Bacteria 1955
434 Ga0207640_10000406 3300025981 Bacteria 27343
435 Ga0207640_10001048 3300025981 Bacteria 15292
436 Ga0207640_10006873 3300025981 Bacteria 6257
437 Ga0207640_10045007 3300025981 Bacteria 2832
438 Ga0207640_10064358 3300025981 Bacteria 2441
439 Ga0207640_10213160 3300025981 Bacteria 1473
440 Ga0207658_10000153 3300025986 Bacteria 72252
441 Ga0207658_10000539 3300025986 Bacteria 34304
442 Ga0207658_10006472 3300025986 Bacteria 7994
443 Ga0207658_10124004 3300025986 Bacteria 2064
444 Ga0207677_10000060 3300026023 Bacteria 93186
445 Ga0207677_10088000 3300026023 Bacteria 2251
446 Ga0207677_10402104 3300026023 Bacteria 1162
447 Ga0207677_11225198 3300026023 Bacteria 687
448 Ga0207703_10105168 3300026035 Bacteria 2399
449 Ga0207639_10007346 3300026041 Bacteria 7508
450 Ga0207639_10039093 3300026041 Bacteria 3533
451 Ga0207639_10453273 3300026041 Bacteria 1165
452 Ga0207678_10001389 3300026067 Bacteria 22281
453 Ga0207678_10020196 3300026067 Bacteria 5849
454 Ga0207702_10007341 3300026078 Bacteria 9416
455 Ga0207702_10007866 3300026078 Bacteria 9038
456 Ga0207702_10009078 3300026078 Bacteria 8367
457 Ga0207702_10077149 3300026078 Bacteria 2881
458 Ga0207702_10077668 3300026078 Bacteria 2872
459 Ga0207641_10000079 3300026088 Bacteria 141110
460 Ga0207641_10000103 3300026088 Bacteria 122350
461 Ga0207641_10002442 3300026088 Bacteria 17185
462 Ga0207641_10009618 3300026088 Bacteria 7967
463 Ga0207641_10017602 3300026088 Bacteria 5851
464 Ga0207641_10174726 3300026088 Bacteria 1963
465 Ga0207648_10000003 3300026089 Bacteria 289983
466 Ga0207648_10016583 3300026089 Bacteria 6725
467 Ga0207648_11637483 3300026089 Bacteria 605
468 Ga0207676_10000044 3300026095 Bacteria 161679
469 Ga0207676_10147037 3300026095 Bacteria 2025
470 Ga0207676_10198802 3300026095 Bacteria 1769
471 Ga0207674_10000319 3300026116 Bacteria 61196
472 Ga0207674_10069420 3300026116 Bacteria 3544
473 Ga0207674_10234835 3300026116 Bacteria 1781
474 Ga0207674_12187787 3300026116 Bacteria 516
475 Ga0207675_100051165 3300026118 Bacteria 3854
476 Ga0207683_10000075 3300026121 Bacteria 77829
477 Ga0207683_10004168 3300026121 Bacteria 12512
478 Ga0207683_10015350 3300026121 Bacteria 6523
479 Ga0207683_10233772 3300026121 Bacteria 1676
480 Ga0207683_10876324 3300026121 Bacteria 833
481 Ga0207683_11314041 3300026121 Bacteria 669
482 Ga0207698_10001449 3300026142 Bacteria 13790
483 Ga0207698_10006501 3300026142 Bacteria 7297
484 Ga0207698_10737960 3300026142 Bacteria 983
485 Ga0268266_10000015 3300028379 Bacteria 630629
486 Ga0268266_10378178 3300028379 Bacteria 1335
487 Ga0268266_11071695 3300028379 Bacteria 780
488 Ga0268265_10000125 3300028380 Bacteria 96710
489 Ga0268265_10000754 3300028380 Bacteria 31429
490 Ga0268264_10000347 3300028381 Bacteria 70884
491 Ga0268264_10100845 3300028381 Bacteria 2508
492 Ga0268264_10398544 3300028381 Bacteria 1322
493 Ga0268264_11215153 3300028381 Bacteria 763
494 Ga0307517_10107907 3300028786 Bacteria 2141
495 Ga0307513_10016361 3300031456 Bacteria 8948
496 Ga0307513_10026396 3300031456 Bacteria 6697
497 Ga0307408_100006783 3300031548 Bacteria 7590
498 Ga0307408_100006926 3300031548 Bacteria 7503
499 Ga0307405_10058399 3300031731 Bacteria 2427
500 Ga0307405_10073616 3300031731 Bacteria 2206
501 Ga0307413_10006988 3300031824 Bacteria 5203
502 Ga0307413_10052817 3300031824 Bacteria 2457
503 Ga0307413_10775505 3300031824 Bacteria 804
504 Ga0307410_10017150 3300031852 Bacteria 4339
505 Ga0307410_10064810 3300031852 Bacteria 2511
506 Ga0307406_10037403 3300031901 Bacteria 2997
507 Ga0307406_10065133 3300031901 Bacteria 2367
508 Ga0307407_10016684 3300031903 Bacteria 3662
509 Ga0307407_10110075 3300031903 Bacteria 1727
510 Ga0307412_10005086 3300031911 Bacteria 7355
511 Ga0307412_10017698 3300031911 Bacteria 4269
512 Ga0307412_11697139 3300031911 Bacteria 579
513 Ga0307409_100015440 3300031995 Bacteria 5014
514 Ga0307409_100102052 3300031995 Bacteria 2382
515 Ga0307416_100002628 3300032002 Bacteria 10389
516 Ga0307416_100611774 3300032002 Bacteria 1170
517 Ga0307416_103033277 3300032002 Bacteria 562
518 Ga0307414_10007367 3300032004 Bacteria 6181
519 Ga0307414_10354398 3300032004 Bacteria 1260
520 Ga0307411_10005662 3300032005 Bacteria 6165
521 Ga0307411_10009772 3300032005 Bacteria 5068
522 Ga0307415_100052521 3300032126 Bacteria 2772
523 Ga0307415_100100170 3300032126 Bacteria 2122
524 Ga0307415_100887935 3300032126 Bacteria 821
525 Ga0395899_0002738 3300037312 Bacteria 14208
526 Ga0395899_0067795 3300037312 Bacteria 2618
527 Ga0395900_0055176 3300037418 Bacteria 4091
528 Ga0395900_0337395 3300037418 Bacteria 1483
529 Ga0395900_0411067 3300037418 Bacteria 1315
530 Ga0395898_0637887 3300037466 Bacteria 1008
531 Ga0395905_0114530 3300037471 Bacteria 2533
532 Ga0395905_0215918 3300037471 Bacteria 1796
533 Ga0395905_0382755 3300037471 Bacteria 1301
534 Ga0436364_1302975 3300037853 Bacteria 1044
535 Ga0395901_0099192 3300038443 Bacteria 3054
536 Ga0395901_0309646 3300038443 Bacteria 1636
537 Ga0395901_0328606 3300038443 Bacteria 1581
538 Ga0395901_1927983 3300038443 Bacteria 538
539 Ga0237819_02653 3300038705 Bacteria 3496
540 Ga0237816_05045 3300039145 Bacteria 898
541 Ga0436365_0412715 3300039437 Bacteria 2429
542 Ga0439436_0016645 3300041404 Bacteria 2204
543 Ga0439439_0121155 3300041406 Bacteria 729
544 Ga0439461_0004626 3300041410 Bacteria 2306
545 Ga0439465_0006757 3300041413 Bacteria 3643
546 Ga0451793_0255256 3300041452 Bacteria 634
547 Ga0451853_2493251 3300041512 Bacteria 575
548 Ga0439431_0005179 3300041997 Bacteria 2874
549 Ga0439432_010633 3300042006 Bacteria 3183
550 Ga0439446_0064186 3300042156 Bacteria 1114
551 Ga0466966_0067597 3300044684 Bacteria 2244
552 Ga0466966_0319672 3300044684 Bacteria 933
553 Ga0466961_0040935 3300044693 Bacteria 2970
554 Ga0466961_0122674 3300044693 Bacteria 1631
555 Ga0466963_0058844 3300044694 Bacteria 2563
556 Ga0466963_0108707 3300044694 Bacteria 1902
557 Ga0466964_0099856 3300044706 Bacteria 1278
558 Ga0466971_0004979 3300044719 Bacteria 5746
559 Ga0466971_0199951 3300044719 Bacteria 943
560 Ga0466970_0103804 3300044765 Bacteria 1549
561 Ga0466970_0411923 3300044765 Bacteria 772
562 Ga0466957_0009863 3300044842 Bacteria 5461
563 Ga0466957_0128384 3300044842 Bacteria 1622
564 Ga0466957_0131074 3300044842 Bacteria 1606
565 Ga0466957_0169830 3300044842 Bacteria 1420
566 Ga0466959_0036850 3300045049 Bacteria 3613
567 Ga0466958_0022147 3300045836 Bacteria 3720
568 Ga0466958_0048182 3300045836 Bacteria 2574
569 Ga0466967_0003933 3300045976 Bacteria 9871
570 Ga0495617_125856 3300046452 Bacteria 824
571 Ga0495592_0786948 3300046454 Bacteria 566
572 Ga0495638_0309533 3300046460 Bacteria 848
573 Ga0495650_0000259 3300046471 Bacteria 102151
574 Ga0495650_0006744 3300046471 Bacteria 7102
575 Ga0495584_0005639 3300046491 Bacteria 6615
576 Ga0495584_0059190 3300046491 Bacteria 1927
577 Ga0495585_0009056 3300046492 Bacteria 5997
578 Ga0495596_0018840 3300046500 Bacteria 2842
579 Ga0495583_0033072 3300046506 Bacteria 2489
580 Ga0495583_0042526 3300046506 Bacteria 2121
581 Ga0495583_0122490 3300046506 Bacteria 1093
582 Ga0495606_0000029 3300046507 Bacteria 250473
583 Ga0495606_0066199 3300046507 Bacteria 2292
584 Ga0495616_0090193 3300046513 Bacteria 1453
585 Ga0495616_0183023 3300046513 Bacteria 930
586 Ga0495631_0009935 3300046518 Bacteria 4732
587 Ga0495631_0332613 3300046518 Bacteria 646
588 Ga0495637_0038137 3300046520 Bacteria 2082
589 Ga0495637_0135631 3300046520 Bacteria 937
590 Ga0495643_0000163 3300046522 Bacteria 106228
591 Ga0495643_0006968 3300046522 Bacteria 7349
592 Ga0495643_0007751 3300046522 Bacteria 6874
593 Ga0495643_0317560 3300046522 Bacteria 705
594 Ga0495648_0000291 3300046524 Bacteria 56777
595 Ga0495663_0000756 3300046525 Bacteria 11088
596 Ga0495642_0071207 3300046528 Bacteria 1454
597 Ga0495587_0468400 3300046536 Bacteria 697
598 Ga0495597_0097196 3300046542 Bacteria 1244
599 Ga0495622_0006792 3300046557 Bacteria 5309
600 Ga0495633_0002070 3300046558 Bacteria 14437
601 Ga0495633_0027359 3300046558 Bacteria 2788
602 Ga0495668_0000016 3300046616 Bacteria 438197
603 Ga0495668_0048602 3300046616 Bacteria 2353
604 Ga0495668_0146365 3300046616 Bacteria 1293
605 Ga0495611_0143960 3300046648 Bacteria 1113
606 Ga0495611_0558796 3300046648 Bacteria 518
607 Ga0495625_0000092 3300046660 Bacteria 146172
608 Ga0495625_0004356 3300046660 Bacteria 13449
609 Ga0495625_0010250 3300046660 Bacteria 7771
610 Ga0495625_0014866 3300046660 Bacteria 6191
611 Ga0495625_0054925 3300046660 Bacteria 2843
612 Ga0495661_0064241 3300046665 Bacteria 2167
613 Ga0495669_0000039 3300046684 Bacteria 92973
614 Ga0495669_0010231 3300046684 Bacteria 3962
615 Ga0495669_0022480 3300046684 Bacteria 2739
616 Ga0495669_0051827 3300046684 Bacteria 1842
617 Ga0495669_0059502 3300046684 Bacteria 1725
618 Ga0495670_0000015 3300046691 Bacteria 131137
619 Ga0495670_0221147 3300046691 Bacteria 1006
620 Ga0495670_0720909 3300046691 Bacteria 544
621 Ga0495649_0058382 3300046694 Bacteria 2079
622 Ga0495600_0024882 3300046809 Bacteria 3854
623 Ga0495600_0110165 3300046809 Bacteria 1792
624 Ga0495660_0196273 3300046810 Bacteria 966
625 Ga0495636_0235789 3300047318 Bacteria 843
626 Ga0495683_0000947 3300047323 Bacteria 20420
627 Ga0495683_0047570 3300047323 Bacteria 2152
628 Ga0495683_0271664 3300047323 Bacteria 737
629 Ga0495687_000098 3300047443 Bacteria 132403
630 Ga0495687_000471 3300047443 Bacteria 48815
631 Ga0495677_0002246 3300047445 Bacteria 7635
632 Ga0495677_0013510 3300047445 Bacteria 2973
633 Ga0495677_0018391 3300047445 Bacteria 2533
634 Ga0495685_138427 3300047447 Bacteria 794
635 Ga0495681_0007945 3300047470 Bacteria 6700
636 Ga0495681_0153535 3300047470 Bacteria 964
637 Ga0495686_0000486 3300047472 Bacteria 58640
638 Ga0495686_0040153 3300047472 Bacteria 2986
639 Ga0496100_0464024 3300048903 Bacteria 972
640 Ga0496100_0562510 3300048903 Bacteria 883
641 Ga0496101_0464135 3300048904 Bacteria 999
642 Ga0496102_0000961 3300048905 Bacteria 27087
643 Ga0496102_0634626 3300048905 Bacteria 991
644 Ga0496103_0000145 3300048906 Bacteria 74388
645 Ga0496103_0085761 3300048906 Bacteria 1984
646 Ga0496103_0299526 3300048906 Bacteria 1034
647 Ga0496104_0003941 3300048907 Bacteria 12844
648 Ga0496105_0000218 3300048908 Bacteria 38487
649 Ga0496107_0185584 3300048910 Bacteria 1545
650 Ga0496108_0006377 3300048911 Bacteria 9561
651 Ga0496109_0043625 3300048912 Bacteria 4066
652 Ga0496110_0007061 3300048913 Bacteria 8937
653 Ga0496111_0003030 3300048914 Bacteria 10300
654 Ga0496112_0043596 3300048915 Bacteria 4392
655 Ga0496113_0006174 3300048916 Bacteria 7564
656 Ga0496113_0753739 3300048916 Bacteria 775
657 Ga0496114_0026742 3300048917 Bacteria 4726
658 Ga0496115_0000195 3300048918 Bacteria 56609
659 Ga0496115_0001359 3300048918 Bacteria 17461
660 Ga0496116_0010920 3300048919 Bacteria 7566
661 Ga0496117_0000910 3300048920 Bacteria 45331
662 Ga0496117_0003090 3300048920 Bacteria 19927
663 Ga0496117_0151533 3300048920 Bacteria 1372
664 Ga0496118_0000091 3300048921 Bacteria 173092
665 Ga0496118_0000339 3300048921 Bacteria 80008
666 Ga0496119_0010325 3300048922 Bacteria 7869
667 Ga0496120_0059756 3300048923 Bacteria 2135
668 Ga0496120_0074129 3300048923 Bacteria 1860
669 Ga0496121_0000105 3300048924 Bacteria 191437
670 Ga0496121_0000429 3300048924 Bacteria 82577
671 Ga0496121_0003357 3300048924 Bacteria 22967
672 Ga0496121_0014603 3300048924 Bacteria 8313
673 Ga0496121_0330273 3300048924 Bacteria 1023
674 Ga0496122_0128770 3300048925 Bacteria 1614
675 Ga0496122_0219332 3300048925 Bacteria 1093
676 Ga0496123_0042673 3300048926 Bacteria 3127
677 Ga0496123_0070886 3300048926 Bacteria 2178
678 Ga0496123_0170339 3300048926 Bacteria 1149
679 Ga0496123_0292996 3300048926 Bacteria 780
680 Ga0496124_0000375 3300048927 Bacteria 81352
681 Ga0496124_0018814 3300048927 Bacteria 6452
682 Ga0496124_0050792 3300048927 Bacteria 3531
683 Ga0496124_0178404 3300048927 Bacteria 1637
684 Ga0496124_0380187 3300048927 Bacteria 988
685 Ga0496125_0052345 3300048928 Bacteria 3357
686 Ga0496126_0000443 3300048929 Bacteria 82811
687 Ga0496126_0010422 3300048929 Bacteria 9742
688 Ga0496126_0038558 3300048929 Bacteria 4445
689 Ga0495682_0374199 3300049460 Bacteria 502
690 Ga0501070_0636980 3300049586 Bacteria 847
691 nmdc:mga0sz30_48265_c1 3300050516 Bacteria 1801
692 Ga0500610_0000063 3300053079 Bacteria 33821
693 Ga0500643_000466 3300053087 Bacteria 29832
694 Ga0500643_001269 3300053087 Bacteria 14922
695 Ga0500643_018551 3300053087 Bacteria 2307
696 Ga0500647_0117418 3300053091 Bacteria 1261
697 Ga0500641_0006923 3300053096 Bacteria 4033
698 Ga0500556_0231231 3300053104 Bacteria 729
699 Ga0500562_046930 3300053108 Bacteria 1152
700 Ga0500562_071691 3300053108 Bacteria 935
701 Ga0500595_000475 3300053119 Bacteria 24774
702 Ga0500597_001091 3300053120 Bacteria 6523
703 Ga0500607_155702 3300053121 Bacteria 1052
704 Ga0500642_0004242 3300053130 Bacteria 4456
705 Ga0500658_0019033 3300053134 Bacteria 2580
706 Ga0500585_150412 3300053144 Bacteria 813
707 Ga0500588_0037695 3300053146 Bacteria 1437
708 Ga0500616_0017435 3300053153 Bacteria 4073
709 Ga0500619_083722 3300053154 Bacteria 1073
710 Ga0500624_000023 3300053157 Bacteria 114997
711 Ga0500627_0170718 3300053158 Bacteria 980
712 Ga0500636_0000462 3300053177 Bacteria 22121
713 Ga0500637_0000013 3300053178 Bacteria 73168
714 Ga0500645_000002 3300053730 Bacteria 388892
715 Ga0500645_031256 3300053730 Bacteria 1600
716 Ga0500609_015863 3300053731 Bacteria 1021
717 Ga0500596_000052 3300053735 Bacteria 15694
718 2600228610 2599185359 Bacteria 4772316
719 2644125898 2643221622 Bacteria 4212502
720 2819714579 2818991466 Bacteria 4748179
721 2879165613 2879163058 Bacteria 4223965
722 2885431565 2885429604 Bacteria 3642894
723 2886633996 2886627955 Bacteria 7618130
724 2928529082 2928526807 Bacteria 4760224
725 2928968599 2928968154 Bacteria 4633371
726 8057102116 8057101203 Bacteria 5034064
727 Ga0496124_0000129
728 ARcpr5oldR_c011761
729 ARcpr5yngRDRAFT_c009262
730 JGI24740J21852_10003761
731 JGI24739J22299_10024914
732 JGI24737J22298_10000315
733 JGI24737J22298_10004866
734 JGI24737J22298_10005025
735 JGI24737J22298_10034423
736 JGI24735J21928_10005077
737 JGI24735J21928_10021864
738 JGI24735J21928_10051185
739 JGI24738J21930_10002201
740 JGI24738J21930_10041608
741 JGI24744J21845_10002683
742 JGI25151J46595_10139345
743 JGI25165J46597_1000040
744 JGI25153J46596_10000031
745 JGI25153J46596_10000091
746 JGI25153J46596_10045061
747 rootH2_10005041
748 Ga0055525_1000012
749 Ga0055542_1000322
750 Ga0055529_1000014
751 Ga0055526_1003569
752 Ga0055537_1001470
753 Ga0055537_1001547
754 Ga0055524_1001171
755 Ga0055536_1026317
756 Ga0055530_10009450
757 Ga0055530_10022076
758 Ga0055530_10075464
759 Ga0055540_1004562
760 Ga0055531_10013567
761 Ga0055531_10029632
762 Ga0065165_1002705
763 Ga0065165_1003177
764 Ga0065165_1013615
765 Ga0065712_10075190
766 Ga0065715_10132303
767 Ga0070658_10000022
768 Ga0070658_10005125
769 Ga0070658_10010467
770 Ga0070658_11054536
771 Ga0070676_10004634
772 Ga0070676_10009924
773 Ga0070676_10223767
774 Ga0070676_10770078
775 Ga0070676_11104862
776 Ga0070683_100384779
777 Ga0070683_100920270
778 Ga0070670_100011899
779 Ga0070670_100025648
780 Ga0070670_100234775
781 Ga0070670_100466931
782 Ga0070677_10085291
783 Ga0068869_100000467
784 Ga0070666_10054920
785 Ga0070666_10062800
786 Ga0070680_100169757
787 Ga0068868_100000092
788 Ga0068868_100442712
789 Ga0070660_100000751
790 Ga0070660_100003262
791 Ga0070660_100056773
792 Ga0070660_100357805
793 Ga0070660_100541547
794 Ga0070661_100000130
795 Ga0070661_100033253
796 Ga0070661_100164048
797 Ga0070661_100236900
798 Ga0070692_10001368
799 Ga0070692_10061516
800 Ga0070668_100000906
801 Ga0070668_100022772
802 Ga0070668_100029073
803 Ga0070668_101124712
804 Ga0070669_100009672
805 Ga0070669_100107486
806 Ga0070669_100409854
807 Ga0070675_100095820
808 Ga0070675_100151839
809 Ga0070675_100364353
810 Ga0070671_100020082
811 Ga0070674_100000035
812 Ga0070674_100000329
813 Ga0070674_100714248
814 Ga0070673_100000009
815 Ga0070673_100005666
816 Ga0070673_100256013
817 Ga0070659_100048117
818 Ga0070659_100140735
819 Ga0070659_100149520
820 Ga0070659_100427247
821 Ga0070659_100452625
822 Ga0070659_102158394
823 Ga0070667_100000641
824 Ga0070667_100002416
825 Ga0070667_100018960
826 Ga0070667_100203038
827 Ga0070667_100603514
828 Ga0070663_100009984
829 Ga0070663_100086230
830 Ga0070663_101402580
831 Ga0070678_100000060
832 Ga0070678_100009721
833 Ga0070678_100480004
834 Ga0070662_100010272
835 Ga0070662_100010751
836 Ga0070662_100098202
837 Ga0070662_100397579
838 Ga0070662_100480689
839 Ga0070681_10015840
840 Ga0070681_10107967
841 Ga0070681_10587461
842 Ga0070681_10729352
843 Ga0068867_100000002
844 Ga0068867_100004940
845 Ga0068867_101384863
846 Ga0070679_100000021
847 Ga0070679_100637845
848 Ga0070684_101007723
849 Ga0068853_100038814
850 Ga0068853_100089389
851 Ga0068853_100114747
852 Ga0068853_100144186
853 Ga0068853_100550260
854 Ga0070672_100008045
855 Ga0070672_100022207
856 Ga0070672_100299934
857 Ga0070696_100006792
858 Ga0070665_100000115
859 Ga0070665_100084334
860 Ga0070665_100518185
861 Ga0068855_100000333
862 Ga0068855_100001164
863 Ga0068855_100049033
864 Ga0068855_100095443
865 Ga0068855_100899917
866 Ga0068855_101844867
867 Ga0070664_100008107
868 Ga0070664_100105053
869 Ga0070664_100272568
870 Ga0070664_100514718
871 Ga0068857_100004444
872 Ga0068854_100000380
873 Ga0068854_100025690
874 Ga0068854_100119227
875 Ga0068854_100241662
876 Ga0068854_101001322
877 Ga0068856_100013110
878 Ga0068856_100031423
879 Ga0068852_100001302
880 Ga0068852_100347958
881 Ga0068859_100012317
882 Ga0068859_100160863
883 Ga0068859_100237719
884 Ga0068859_100622361
885 Ga0068859_100726087
886 Ga0068864_100000016
887 Ga0068864_100380181
888 Ga0068864_100399098
889 Ga0068851_10012325
890 Ga0068851_10438833
891 Ga0068863_100000047
892 Ga0068863_100000089
893 Ga0068863_100003668
894 Ga0068863_100008189
895 Ga0068863_100058002
896 Ga0068863_100119831
897 Ga0068863_101829075
898 Ga0068858_100008945
899 Ga0068860_100001603
900 Ga0068860_100148772
901 Ga0068860_100315051
902 Ga0068862_100000068
903 Ga0068862_100000986
904 Ga0081539_10007074
905 Ga0075369_10038377
906 Ga0097621_100021424
907 Ga0068871_100004655
908 Ga0068871_100171913
909 Ga0068871_100285428
910 Ga0068865_100000014
911 Ga0068865_100195482
912 Ga0068865_100384205
913 Ga0068865_100459451
914 Ga0068865_100803238
915 Ga0097620_100012317
916 Ga0097620_100160860
917 Ga0097620_100237718
918 Ga0097620_100622359
919 Ga0097620_100726105
920 Ga0099826_10111731
921 Ga0105251_10001932
922 Ga0105240_10004046
923 Ga0105240_10038634
924 Ga0105240_10051063
925 Ga0105240_10282098
926 Ga0105245_10001236
927 Ga0105245_11816733
928 Ga0105247_10000985
929 Ga0105247_10015646
930 Ga0105247_10106888
931 Ga0105243_10000070
932 Ga0105243_10001791
933 Ga0105243_10073758
934 Ga0105243_10546149
935 Ga0105243_10619836
936 Ga0105241_10004388
937 Ga0105241_10130977
938 Ga0105242_10000273
939 Ga0105242_11443763
940 Ga0105248_10000021
941 Ga0105248_10002393
942 Ga0105248_10018071
943 Ga0105237_10004611
944 Ga0105237_10017550
945 Ga0105237_10032273
946 Ga0105237_10078880
947 Ga0105237_11523622
948 Ga0105238_10080044
949 Ga0105238_10118232
950 Ga0105238_10558728
951 Ga0105249_10000017
952 Ga0105249_10001264
953 Ga0105249_10001584
954 Ga0105249_10288452
955 Ga0105249_11992838
956 Ga0105249_12757113
957 Ga0105249_13212122
958 Ga0105239_10000546
959 Ga0105239_10038762
960 Ga0105239_10686070
961 Ga0105239_11258994
962 Ga0105246_10002662
963 Ga0105246_10054421
964 Ga0157326_1001062
965 Ga0157373_10043654
966 Ga0157373_10083098
967 Ga0157373_10086011
968 Ga0157371_10000193
969 Ga0157371_10054006
970 Ga0157371_10073640
971 Ga0157371_10514372
972 Ga0157371_10554301
973 Ga0157371_10863917
974 Ga0157370_10000117
975 Ga0157370_10853360
976 Ga0157369_10030477
977 Ga0157369_10170694
978 Ga0157374_10000831
979 Ga0157374_10005135
980 Ga0157374_10041788
981 Ga0157374_10335658
982 Ga0157378_10000944
983 Ga0163162_10011469
984 Ga0157372_10182260
985 Ga0157372_10275339
986 Ga0157372_10286207
987 Ga0157372_10337359
988 Ga0157375_10002997
989 Ga0157375_10111021
990 Ga0157375_10141594
991 Ga0163163_10013700
992 Ga0163163_10067172
993 Ga0163163_12888084
994 Ga0157377_10026133
995 Ga0157379_10151556
996 Ga0157376_10000186
997 Ga0163161_10261965
998 Ga0163161_10308905
999 Ga0213875_10419316
1000 Ga0209563_100030
1001 Ga0207427_100441
1002 Ga0207425_1000049
1003 Ga0207425_1008078
1004 Ga0209026_1000675
1005 Ga0209677_117223
1006 Ga0209148_1000011
1007 Ga0209129_1001668
1008 Ga0209233_1000003
1009 Ga0209565_1000007
1010 Ga0209565_1000170
1011 Ga0209455_1000006
1012 Ga0209455_1024217
1013 Ga0209673_1007604
1014 Ga0209673_1032519
1015 Ga0209675_1004240
1016 Ga0209676_1010374
1017 Ga0209676_1023070
1018 Ga0209025_1000068
1019 Ga0209564_1000335
1020 Ga0209564_1026133
1021 Ga0209758_1000001
1022 Ga0209758_1000004
1023 Ga0209758_1018028
1024 Ga0209758_1054268
1025 Ga0209050_1000001
1026 Ga0209050_1006899
1027 Ga0209050_1021069
1028 Ga0209256_1000009
1029 Ga0209256_1000010
1030 Ga0207426_1032149
1031 Ga0207426_1111532
1032 Ga0209051_1000191
1033 Ga0209051_1071930
1034 Ga0209257_1003180
1035 Ga0209257_1003572
1036 Ga0209257_1003678
1037 Ga0207697_10126939
1038 Ga0207656_10084319
1039 Ga0207656_10348198
1040 Ga0207710_10082022
1041 Ga0207688_10024275
1042 Ga0207688_10274284
1043 Ga0207680_10202815
1044 Ga0207647_10009257
1045 Ga0207647_10011528
1046 Ga0207647_10018578
1047 Ga0207647_10018802
1048 Ga0207647_10144287
1049 Ga0207647_10160000
1050 Ga0207647_10358421
1051 Ga0207645_10015318
1052 Ga0207645_10025433
1053 Ga0207645_10509924
1054 Ga0207645_10664613
1055 Ga0207705_10000042
1056 Ga0207705_10000188
1057 Ga0207705_10021287
1058 Ga0207705_10661603
1059 Ga0207705_10955698
1060 Ga0207654_10000227
1061 Ga0207707_10013301
1062 Ga0207707_10130828
1063 Ga0207707_10286433
1064 Ga0207695_10003844
1065 Ga0207695_10015444
1066 Ga0207695_10028168
1067 Ga0207695_10083252
1068 Ga0207695_10091255
1069 Ga0207671_10004049
1070 Ga0207671_10012108
1071 Ga0207671_10036679
1072 Ga0207671_10044525
1073 Ga0207660_10003328
1074 Ga0207662_10355880
1075 Ga0207657_10000900
1076 Ga0207657_10001241
1077 Ga0207657_10001555
1078 Ga0207657_10016697
1079 Ga0207657_10048500
1080 Ga0207657_10136202
1081 Ga0207657_10263111
1082 Ga0207657_10322123
1083 Ga0207657_10440642
1084 Ga0207649_10000134
1085 Ga0207649_10002240
1086 Ga0207649_10032880
1087 Ga0207649_10202905
1088 Ga0207652_10000047
1089 Ga0207652_10493523
1090 Ga0207652_11278017
1091 Ga0207681_10008042
1092 Ga0207681_10146964
1093 Ga0207694_10000683
1094 Ga0207650_10000069
1095 Ga0207650_10003451
1096 Ga0207650_10050776
1097 Ga0207650_10216175
1098 Ga0207650_10740809
1099 Ga0207659_10112865
1100 Ga0207659_10240661
1101 Ga0207659_11431214
1102 Ga0207687_10000252
1103 Ga0207644_10006505
1104 Ga0207690_10001286
1105 Ga0207690_10063454
1106 Ga0207690_10243567
1107 Ga0207690_10420538
1108 Ga0207690_10432323
1109 Ga0207706_10004012
1110 Ga0207706_10059349
1111 Ga0207706_10101956
1112 Ga0207706_10167689
1113 Ga0207706_10737468
1114 Ga0207706_10893307
1115 Ga0207686_10001911
1116 Ga0207709_10000066
1117 Ga0207709_10000246
1118 Ga0207709_11099301
1119 Ga0207669_10000030
1120 Ga0207669_10000615
1121 Ga0207669_10031379
1122 Ga0207669_10037347
1123 Ga0207704_10000002
1124 Ga0207704_10000007
1125 Ga0207704_10051567
1126 Ga0207704_10894299
1127 Ga0207704_11304893
1128 Ga0207691_10008730
1129 Ga0207691_10087107
1130 Ga0207691_10134528
1131 Ga0207691_10233886
1132 Ga0207691_10290423
1133 Ga0207711_10000025
1134 Ga0207711_10020383
1135 Ga0207711_10429445
1136 Ga0207689_10000060
1137 Ga0207689_10083820
1138 Ga0207679_10038837
1139 Ga0207679_10042339
1140 Ga0207679_10240411
1141 Ga0207667_10000002
1142 Ga0207667_10000017
1143 Ga0207667_10002977
1144 Ga0207667_10016552
1145 Ga0207667_10038294
1146 Ga0207667_10104027
1147 Ga0207667_10436746
1148 Ga0207651_10000004
1149 Ga0207651_10023484
1150 Ga0207651_10061183
1151 Ga0207712_10000012
1152 Ga0207712_10001388
1153 Ga0207712_10412158
1154 Ga0207712_11105837
1155 Ga0207712_11452804
1156 Ga0207712_12001469
1157 Ga0207668_10000062
1158 Ga0207668_10000459
1159 Ga0207668_10124865
1160 Ga0207640_10000406
1161 Ga0207640_10001048
1162 Ga0207640_10006873
1163 Ga0207640_10045007
1164 Ga0207640_10064358
1165 Ga0207640_10213160
1166 Ga0207658_10000153
1167 Ga0207658_10000539
1168 Ga0207658_10006472
1169 Ga0207658_10124004
1170 Ga0207677_10000060
1171 Ga0207677_10088000
1172 Ga0207677_10402104
1173 Ga0207677_11225198
1174 Ga0207703_10105168
1175 Ga0207639_10007346
1176 Ga0207639_10039093
1177 Ga0207639_10453273
1178 Ga0207678_10001389
1179 Ga0207678_10020196
1180 Ga0207702_10007341
1181 Ga0207702_10007866
1182 Ga0207702_10009078
1183 Ga0207702_10077149
1184 Ga0207702_10077668
1185 Ga0207641_10000079
1186 Ga0207641_10000103
1187 Ga0207641_10002442
1188 Ga0207641_10009618
1189 Ga0207641_10017602
1190 Ga0207641_10174726
1191 Ga0207648_10000003
1192 Ga0207648_10016583
1193 Ga0207648_11637483
1194 Ga0207676_10000044
1195 Ga0207676_10147037
1196 Ga0207676_10198802
1197 Ga0207674_10000319
1198 Ga0207674_10069420
1199 Ga0207674_10234835
1200 Ga0207674_12187787
1201 Ga0207675_100051165
1202 Ga0207683_10000075
1203 Ga0207683_10004168
1204 Ga0207683_10015350
1205 Ga0207683_10233772
1206 Ga0207683_10876324
1207 Ga0207683_11314041
1208 Ga0207698_10001449
1209 Ga0207698_10006501
1210 Ga0207698_10737960
1211 Ga0268266_10000015
1212 Ga0268266_10378178
1213 Ga0268266_11071695
1214 Ga0268265_10000125
1215 Ga0268265_10000754
1216 Ga0268264_10000347
1217 Ga0268264_10100845
1218 Ga0268264_10398544
1219 Ga0268264_11215153
1220 Ga0307517_10107907
1221 Ga0307513_10016361
1222 Ga0307513_10026396
1223 Ga0307408_100006783
1224 Ga0307408_100006926
1225 Ga0307405_10058399
1226 Ga0307405_10073616
1227 Ga0307413_10006988
1228 Ga0307413_10052817
1229 Ga0307413_10775505
1230 Ga0307410_10017150
1231 Ga0307410_10064810
1232 Ga0307406_10037403
1233 Ga0307406_10065133
1234 Ga0307407_10016684
1235 Ga0307407_10110075
1236 Ga0307412_10005086
1237 Ga0307412_10017698
1238 Ga0307412_11697139
1239 Ga0307409_100015440
1240 Ga0307409_100102052
1241 Ga0307416_100002628
1242 Ga0307416_100611774
1243 Ga0307416_103033277
1244 Ga0307414_10007367
1245 Ga0307414_10354398
1246 Ga0307411_10005662
1247 Ga0307411_10009772
1248 Ga0307415_100052521
1249 Ga0307415_100100170
1250 Ga0307415_100887935
1251 Ga0395899_0002738
1252 Ga0395899_0067795
1253 Ga0395900_0055176
1254 Ga0395900_0337395
1255 Ga0395900_0411067
1256 Ga0395898_0637887
1257 Ga0395905_0114530
1258 Ga0395905_0215918
1259 Ga0395905_0382755
1260 Ga0436364_1302975
1261 Ga0395901_0099192
1262 Ga0395901_0309646
1263 Ga0395901_0328606
1264 Ga0395901_1927983
1265 Ga0237819_02653
1266 Ga0237816_05045
1267 Ga0436365_0412715
1268 Ga0439436_0016645
1269 Ga0439439_0121155
1270 Ga0439461_0004626
1271 Ga0439465_0006757
1272 Ga0451793_0255256
1273 Ga0451853_2493251
1274 Ga0439431_0005179
1275 Ga0439432_010633
1276 Ga0439446_0064186
1277 Ga0466966_0067597
1278 Ga0466966_0319672
1279 Ga0466961_0040935
1280 Ga0466961_0122674
1281 Ga0466963_0058844
1282 Ga0466963_0108707
1283 Ga0466964_0099856
1284 Ga0466971_0004979
1285 Ga0466971_0199951
1286 Ga0466970_0103804
1287 Ga0466970_0411923
1288 Ga0466957_0009863
1289 Ga0466957_0128384
1290 Ga0466957_0131074
1291 Ga0466957_0169830
1292 Ga0466959_0036850
1293 Ga0466958_0022147
1294 Ga0466958_0048182
1295 Ga0466967_0003933
1296 Ga0495617_125856
1297 Ga0495592_0786948
1298 Ga0495638_0309533
1299 Ga0495650_0000259
1300 Ga0495650_0006744
1301 Ga0495584_0005639
1302 Ga0495584_0059190
1303 Ga0495585_0009056
1304 Ga0495596_0018840
1305 Ga0495583_0033072
1306 Ga0495583_0042526
1307 Ga0495583_0122490
1308 Ga0495606_0000029
1309 Ga0495606_0066199
1310 Ga0495616_0090193
1311 Ga0495616_0183023
1312 Ga0495631_0009935
1313 Ga0495631_0332613
1314 Ga0495637_0038137
1315 Ga0495637_0135631
1316 Ga0495643_0000163
1317 Ga0495643_0006968
1318 Ga0495643_0007751
1319 Ga0495643_0317560
1320 Ga0495648_0000291
1321 Ga0495663_0000756
1322 Ga0495642_0071207
1323 Ga0495587_0468400
1324 Ga0495597_0097196
1325 Ga0495622_0006792
1326 Ga0495633_0002070
1327 Ga0495633_0027359
1328 Ga0495668_0000016
1329 Ga0495668_0048602
1330 Ga0495668_0146365
1331 Ga0495611_0143960
1332 Ga0495611_0558796
1333 Ga0495625_0000092
1334 Ga0495625_0004356
1335 Ga0495625_0010250
1336 Ga0495625_0014866
1337 Ga0495625_0054925
1338 Ga0495661_0064241
1339 Ga0495669_0000039
1340 Ga0495669_0010231
1341 Ga0495669_0022480
1342 Ga0495669_0051827
1343 Ga0495669_0059502
1344 Ga0495670_0000015
1345 Ga0495670_0221147
1346 Ga0495670_0720909
1347 Ga0495649_0058382
1348 Ga0495600_0024882
1349 Ga0495600_0110165
1350 Ga0495660_0196273
1351 Ga0495636_0235789
1352 Ga0495683_0000947
1353 Ga0495683_0047570
1354 Ga0495683_0271664
1355 Ga0495687_000098
1356 Ga0495687_000471
1357 Ga0495677_0002246
1358 Ga0495677_0013510
1359 Ga0495677_0018391
1360 Ga0495685_138427
1361 Ga0495681_0007945
1362 Ga0495681_0153535
1363 Ga0495686_0000486
1364 Ga0495686_0040153
1365 Ga0496100_0464024
1366 Ga0496100_0562510
1367 Ga0496101_0464135
1368 Ga0496102_0000961
1369 Ga0496102_0634626
1370 Ga0496103_0000145
1371 Ga0496103_0085761
1372 Ga0496103_0299526
1373 Ga0496104_0003941
1374 Ga0496105_0000218
1375 Ga0496107_0185584
1376 Ga0496108_0006377
1377 Ga0496109_0043625
1378 Ga0496110_0007061
1379 Ga0496111_0003030
1380 Ga0496112_0043596
1381 Ga0496113_0006174
1382 Ga0496113_0753739
1383 Ga0496114_0026742
1384 Ga0496115_0000195
1385 Ga0496115_0001359
1386 Ga0496116_0010920
1387 Ga0496117_0000910
1388 Ga0496117_0003090
1389 Ga0496117_0151533
1390 Ga0496118_0000091
1391 Ga0496118_0000339
1392 Ga0496119_0010325
1393 Ga0496120_0059756
1394 Ga0496120_0074129
1395 Ga0496121_0000105
1396 Ga0496121_0000429
1397 Ga0496121_0003357
1398 Ga0496121_0014603
1399 Ga0496121_0330273
1400 Ga0496122_0128770
1401 Ga0496122_0219332
1402 Ga0496123_0042673
1403 Ga0496123_0070886
1404 Ga0496123_0170339
1405 Ga0496123_0292996
1406 Ga0496124_0000375
1407 Ga0496124_0018814
1408 Ga0496124_0050792
1409 Ga0496124_0178404
1410 Ga0496124_0380187
1411 Ga0496125_0052345
1412 Ga0496126_0000443
1413 Ga0496126_0010422
1414 Ga0496126_0038558
1415 Ga0495682_0374199
1416 Ga0501070_0636980
1417 nmdc:mga0sz30_48265_c1
1418 Ga0500610_0000063
1419 Ga0500643_000466
1420 Ga0500643_001269
1421 Ga0500643_018551
1422 Ga0500647_0117418
1423 Ga0500641_0006923
1424 Ga0500556_0231231
1425 Ga0500562_046930
1426 Ga0500562_071691
1427 Ga0500595_000475
1428 Ga0500597_001091
1429 Ga0500607_155702
1430 Ga0500642_0004242
1431 Ga0500658_0019033
1432 Ga0500585_150412
1433 Ga0500588_0037695
1434 Ga0500616_0017435
1435 Ga0500619_083722
1436 Ga0500624_000023
1437 Ga0500627_0170718
1438 Ga0500636_0000462
1439 Ga0500637_0000013
1440 Ga0500645_000002
1441 Ga0500645_031256
1442 Ga0500609_015863
1443 Ga0500596_000052
1444 2600228610
1445 2644125898
1446 2819714579
1447 2879165613
1448 2885431565
1449 2886633996
1450 2928529082
1451 2928968599
1452 8057102116

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00472

RF-1

RF-1 domain

17

149

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
3j7y-assembly1.cif.gz_p structure of the large ribosomal subunit from human mitochondria 0.8374 5 93
7a5g-assembly1.cif.gz_b6 structure of the elongating human mitoribosome bound to mtef-tu.gmppcp and a/t mt-trna 0.8062 11 93
7oi6-assembly1.cif.gz_p cryo-em structure of late human 39s mitoribosome assembly intermediates, state 1 0.8009 1 93
7jt1-assembly1.cif.gz_9 70s ribosome stalled on long mrna with arfb-1 and arfb-2 bound (+9-iii) 0.7956 30 93
1l4s-assembly1.cif.gz_A solution structure of ribosome associated factor y 0.7956 31 95
ID Description Score Start End Superfamily
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8649 35 92 3.30.160.20
3j7yp00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8374 5 93 3.30.160.20
af_A0A0R0GKX2_1_61_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8164 35 92 3.30.160.20
af_Q7XD96_1552_1629_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.8154 31 91 3.30.160.20
af_Q5AI30_155_260_3.30.1460.20 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.8066 6 98 3.30.1460.20
ID Description Score Start End GO Terms
AF-A0A352HBL5-F1-model_v4 deleted 0.8699 11 95
AF-A0A3D2PIA2-F1-model_v4 deleted 0.8593 11 94
AF-A0A7S2IT84-F1-model_v4 Prokaryotic-type class I peptide chain release factors domain-containing protein 0.8567 4 93 GO:0004045
GO:0005762
GO:0016150
GO:0070126
AF-A0A2E7U4D1-F1-model_v4 deleted 0.8552 4 96
AF-A0A7Z9SFB3-F1-model_v4 Aminoacyl-tRNA hydrolase 0.8527 1 97 GO:0003747
GO:0004045
GO:0043022
GO:0072344

Map