metagRoot

F477709

General Info

Members	Datasets	Scaffolds	Average Seq Length
726	389	1452	128

Family's Representative Sequence

Representative Sequence	3300049742\|Ga0501080_0590776\|Ga0501080_0590776_403_837
Length	144
Sequence	LVASYQVISGSSQAGVGANVESFEGGCHCGRVRFRVTADLDRVTFCNCSLCSKKGFLHLIVPPEQFELLSGKDDLTTYQFNTKVAKHTFCKHCGVHPFYVPRSDPDKIDVNARCLDGVDTGALPVKQFDGRNWERSMEKKVPWR

Samples

	Sample ID	Description	Type	Environment
1	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
2	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
3	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
4	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
5	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
6	3300000045	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere	Metagenome	Rhizosphere
7	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
8	3300001430	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5	Metagenome	Rhizosphere
9	3300001976	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7	Metagenome	Rhizosphere
10	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
11	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
12	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
13	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
14	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
15	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
16	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
17	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
18	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
19	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
20	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
21	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
22	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
23	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
24	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
25	3300003349	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM	Metagenome	Rhizosphere
26	3300003371	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM	Metagenome	Rhizosphere
27	3300005276	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1	Metagenome	Rhizosphere
28	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
29	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
30	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
31	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
32	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
33	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
34	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
35	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
36	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
37	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
38	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
39	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
40	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
41	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
42	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
43	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
44	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
45	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
46	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
47	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
48	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
49	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
50	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
51	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
52	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
53	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
54	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
55	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
56	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
57	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
58	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
59	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
60	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
61	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
62	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
63	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
64	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
65	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
66	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
67	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
68	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
69	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
70	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
71	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
72	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
73	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
74	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
75	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
76	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
77	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
78	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
79	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
80	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
81	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
82	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
83	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
84	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
85	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
86	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
87	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
88	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
89	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
90	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
91	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
92	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
93	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
94	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
95	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
96	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
97	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
98	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
99	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
100	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
101	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
102	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
103	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
104	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
105	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
106	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
107	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
108	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
109	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
110	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
111	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
112	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
113	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
114	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
115	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
116	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
117	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
118	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
119	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
120	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
121	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
122	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
123	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
124	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
125	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
126	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
127	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
128	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
129	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
130	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
131	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
132	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
133	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
134	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
135	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
136	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
137	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
138	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
139	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
140	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
141	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
142	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
143	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
144	3300012480	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610	Metagenome	Rhizosphere
145	3300012498	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410	Metagenome	Rhizosphere
146	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
147	3300012505	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610	Metagenome	Rhizosphere
148	3300012507	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610	Metagenome	Rhizosphere
149	3300012513	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510	Metagenome	Rhizosphere
150	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
151	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
152	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
153	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
154	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
155	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
156	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
157	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
158	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
159	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
160	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
161	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
162	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
163	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
164	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
165	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
166	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
167	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
168	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
170	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
184	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
188	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
189	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
190	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
191	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
192	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
193	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
194	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
195	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
196	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
197	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
199	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
200	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
201	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
202	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
203	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
204	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
205	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
206	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
207	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300027395	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
246	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
248	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
252	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
253	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
254	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
255	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
256	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
257	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
258	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
259	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
260	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
261	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
262	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
263	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
264	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
265	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
266	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
267	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
268	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
269	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
270	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
271	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
272	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
273	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
274	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
275	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
276	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
277	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
278	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
279	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
280	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
281	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
282	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
283	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
284	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
285	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
286	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
287	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
288	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
289	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
290	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
291	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
292	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
293	3300042001	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542	Metagenome	Rhizosphere
294	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
295	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
296	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
297	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
298	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
299	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
300	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
301	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
302	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
303	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
304	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
305	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
306	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
307	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
308	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
309	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
310	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
311	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
312	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
313	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
314	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
315	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
316	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
317	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
318	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
319	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
320	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
321	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
322	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
323	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
324	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
325	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
326	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
327	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
328	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
329	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
330	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
331	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
332	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
333	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
334	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
335	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
336	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
337	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
338	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
339	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
340	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
341	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
342	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
343	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
344	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
345	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
346	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
347	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
348	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
349	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
350	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
351	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
352	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
353	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
354	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
355	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
356	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
357	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
358	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
359	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
360	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
361	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
362	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
363	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
364	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
365	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
366	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
367	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
368	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
369	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
370	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
371	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
372	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
373	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
374	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
375	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
376	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
377	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
378	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
379	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
380	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
381	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
382	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
383	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
384	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
385	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
386	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
387	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
388	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
389	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.07
Nodule	0
Rhizoplane	4.55
Rhizosphere	92.01
Stem	0
Stem Tuber	0
Unclassified	4.27

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0501080_0590776	3300049742	Bacteria	986
2	2214683819	2209111006	Bacteria	4614
3	ARSoilYngRDRAFT_c00011	3300000042	Bacteria	28426
4	ARcpr5yngRDRAFT_c000021	3300000043	Bacteria	25699
5	ARSoilOldRDRAFT_c000046	3300000044	Bacteria	25757
6	ARCol0oldRDRAFT_c01353	3300000045	Bacteria	1657
7	ARCol0yngRDRAFT_1000010	3300000652	Bacteria	42356
8	JGI24032J14994_100006	3300001430	Bacteria	8492
9	JGI24752J21851_1005732	3300001976	Bacteria	1621
10	JGI24747J21853_1000409	3300001978	Bacteria	2594
11	JGI24740J21852_10039044	3300001979	Bacteria	1451
12	JGI24739J22299_10000131	3300001989	Bacteria	23785
13	JGI24737J22298_10000288	3300001990	Bacteria	16760
14	JGI24737J22298_10006893	3300001990	Bacteria	3856
15	JGI24743J22301_10041379	3300001991	Unclassified	926
16	JGI24743J22301_10074482	3300001991	Bacteria	711
17	JGI24735J21928_10024733	3300002067	Bacteria	1815
18	JGI24750J21931_1000152	3300002070	Bacteria	11423
19	JGI24750J21931_1009758	3300002070	Bacteria	1241
20	JGI24745J21846_1000077	3300002073	Bacteria	6926
21	JGI24748J21848_1001306	3300002074	Bacteria	2732
22	JGI24738J21930_10000152	3300002075	Bacteria	17263
23	JGI24749J21850_1000353	3300002076	Bacteria	6841
24	JGI24749J21850_1005738	3300002076	Bacteria	1732
25	JGI24744J21845_10000668	3300002077	Bacteria	6280
26	JGI24035J26624_1000012	3300002126	Bacteria	13221
27	JGI24034J26672_10011414	3300002239	Bacteria	1330
28	JGI24742J22300_10000244	3300002244	Bacteria	8123
29	JGI26129J50193_1010480	3300003349	Unclassified	675
30	JGI26145J50221_1026920	3300003371	Unclassified	576
31	Ga0065717_1003767	3300005276	Bacteria	1177
32	Ga0065704_10184276	3300005289	Bacteria	1210
33	Ga0065712_10000516	3300005290	Bacteria	15351
34	Ga0065712_10069877	3300005290	Bacteria	6585
35	Ga0065715_10000542	3300005293	Bacteria	14477
36	Ga0065715_10000847	3300005293	Bacteria	21445
37	Ga0065707_10228672	3300005295	Bacteria	1197
38	Ga0070676_10000008	3300005328	Bacteria	68426
39	Ga0070676_10057351	3300005328	Bacteria	2305
40	Ga0070683_100000442	3300005329	Bacteria	28808
41	Ga0070690_100000739	3300005330	Bacteria	16697
42	Ga0070690_100001812	3300005330	Bacteria	11319
43	Ga0070670_100004202	3300005331	Bacteria	12052
44	Ga0070670_101962094	3300005331	Bacteria	539
45	Ga0070677_10000100	3300005333	Bacteria	28234
46	Ga0068869_100000008	3300005334	Bacteria	78682
47	Ga0070666_10019908	3300005335	Bacteria	4335
48	Ga0070680_100001115	3300005336	Bacteria	19301
49	Ga0070680_100003408	3300005336	Bacteria	11866
50	Ga0070682_100000217	3300005337	Bacteria	42442
51	Ga0070682_100050281	3300005337	Bacteria	2602
52	Ga0068868_100037034	3300005338	Bacteria	3780
53	Ga0070660_100000387	3300005339	Bacteria	29405
54	Ga0070660_100005048	3300005339	Bacteria	9118
55	Ga0070689_100000092	3300005340	Bacteria	52157
56	Ga0070689_100003596	3300005340	Bacteria	10333
57	Ga0070691_10000232	3300005341	Bacteria	18942
58	Ga0070687_100000320	3300005343	Bacteria	16250
59	Ga0070687_100032950	3300005343	Bacteria	2553
60	Ga0070661_100001156	3300005344	Bacteria	18590
61	Ga0070692_10000324	3300005345	Bacteria	13746
62	Ga0070692_10221928	3300005345	Bacteria	1118
63	Ga0070668_100000463	3300005347	Bacteria	26870
64	Ga0070668_100016358	3300005347	Bacteria	5547
65	Ga0070668_100865584	3300005347	Unclassified	806
66	Ga0070669_100000191	3300005353	Bacteria	53889
67	Ga0070669_100006422	3300005353	Bacteria	8461
68	Ga0070669_101292183	3300005353	Unclassified	632
69	Ga0070675_100000032	3300005354	Bacteria	97014
70	Ga0070675_100018382	3300005354	Bacteria	5563
71	Ga0070671_100000450	3300005355	Bacteria	28586
72	Ga0070674_100000070	3300005356	Bacteria	47062
73	Ga0070674_100400917	3300005356	Bacteria	1121
74	Ga0070674_101459595	3300005356	Bacteria	614
75	Ga0070673_100000024	3300005364	Bacteria	75170
76	Ga0070673_100017284	3300005364	Bacteria	5123
77	Ga0070673_100267525	3300005364	Bacteria	1495
78	Ga0070688_100000062	3300005365	Bacteria	52780
79	Ga0070688_100002546	3300005365	Bacteria	9229
80	Ga0070688_100068300	3300005365	Bacteria	2266
81	Ga0070659_100000343	3300005366	Bacteria	35802
82	Ga0070659_100001717	3300005366	Bacteria	15761
83	Ga0070667_100004301	3300005367	Bacteria	12024
84	Ga0070667_100494501	3300005367	Bacteria	1121
85	Ga0070703_10003738	3300005406	Bacteria	4307
86	Ga0070709_10001399	3300005434	Bacteria	13105
87	Ga0070709_10028368	3300005434	Bacteria	3337
88	Ga0070709_10140862	3300005434	Bacteria	1657
89	Ga0070709_10911050	3300005434	Bacteria	696
90	Ga0070714_100093331	3300005435	Bacteria	2639
91	Ga0070713_100001220	3300005436	Bacteria	16438
92	Ga0070713_100050811	3300005436	Bacteria	3426
93	Ga0070713_100099104	3300005436	Bacteria	2521
94	Ga0070710_10002863	3300005437	Bacteria	8219
95	Ga0070710_10045573	3300005437	Bacteria	2438
96	Ga0070710_11107003	3300005437	Bacteria	582
97	Ga0070701_10000030	3300005438	Bacteria	35788
98	Ga0070701_10002689	3300005438	Bacteria	6894
99	Ga0070711_100001946	3300005439	Bacteria	11576
100	Ga0070711_100217062	3300005439	Bacteria	1484
101	Ga0070711_101056355	3300005439	Bacteria	698
102	Ga0070711_101153073	3300005439	Bacteria	669
103	Ga0070705_100000327	3300005440	Bacteria	28148
104	Ga0070700_100001549	3300005441	Bacteria	11466
105	Ga0070700_100003759	3300005441	Bacteria	7857
106	Ga0070694_100014504	3300005444	Bacteria	4934
107	Ga0070708_100348356	3300005445	Bacteria	1396
108	Ga0070708_100841211	3300005445	Unclassified	862
109	Ga0070663_100001713	3300005455	Bacteria	12173
110	Ga0070678_100000054	3300005456	Bacteria	40372
111	Ga0070678_100208429	3300005456	Bacteria	1618
112	Ga0070662_100001574	3300005457	Bacteria	14103
113	Ga0070662_100013085	3300005457	Bacteria	5515
114	Ga0070681_10000284	3300005458	Bacteria	40778
115	Ga0070681_10062883	3300005458	Bacteria	3684
116	Ga0070681_10267198	3300005458	Bacteria	1622
117	Ga0070681_10278196	3300005458	Bacteria	1585
118	Ga0068867_100000073	3300005459	Bacteria	61471
119	Ga0068867_100035815	3300005459	Bacteria	3601
120	Ga0068867_100475061	3300005459	Bacteria	1070
121	Ga0070685_10001515	3300005466	Bacteria	12244
122	Ga0070706_100101939	3300005467	Bacteria	2668
123	Ga0070707_100065939	3300005468	Bacteria	3479
124	Ga0070698_100003592	3300005471	Bacteria	17049
125	Ga0070698_100142460	3300005471	Bacteria	2347
126	Ga0070698_101248673	3300005471	Bacteria	693
127	Ga0070679_100004666	3300005530	Bacteria	12647
128	Ga0070679_100010251	3300005530	Bacteria	8885
129	Ga0070679_100015976	3300005530	Bacteria	7229
130	Ga0070684_100000022	3300005535	Bacteria	128353
131	Ga0070684_100104589	3300005535	Bacteria	2533
132	Ga0070697_100241326	3300005536	Bacteria	1543
133	Ga0068853_100004041	3300005539	Bacteria	11291
134	Ga0068853_100026665	3300005539	Bacteria	4853
135	Ga0070672_100000012	3300005543	Bacteria	78125
136	Ga0070672_100052977	3300005543	Bacteria	3171
137	Ga0070672_100273225	3300005543	Bacteria	1427
138	Ga0070686_100000087	3300005544	Bacteria	64591
139	Ga0070686_100001741	3300005544	Bacteria	12172
140	Ga0070686_100182320	3300005544	Bacteria	1493
141	Ga0070695_100000422	3300005545	Bacteria	21858
142	Ga0070695_100002973	3300005545	Bacteria	9878
143	Ga0070696_100038654	3300005546	Bacteria	3294
144	Ga0070696_100194668	3300005546	Bacteria	1510
145	Ga0070696_100992046	3300005546	Bacteria	701
146	Ga0070693_100000230	3300005547	Bacteria	26095
147	Ga0070665_100026209	3300005548	Bacteria	5871
148	Ga0070665_100029671	3300005548	Bacteria	5503
149	Ga0070704_100000913	3300005549	Bacteria	14843
150	Ga0070704_100019013	3300005549	Bacteria	4406
151	Ga0068855_100008251	3300005563	Bacteria	12590
152	Ga0068855_100104673	3300005563	Bacteria	3255
153	Ga0068855_100898799	3300005563	Bacteria	936
154	Ga0070664_100000102	3300005564	Bacteria	54873
155	Ga0070664_100206451	3300005564	Bacteria	1755
156	Ga0070664_100460320	3300005564	Bacteria	1169
157	Ga0068857_100000069	3300005577	Bacteria	58801
158	Ga0068857_100487380	3300005577	Bacteria	1156
159	Ga0068854_100000215	3300005578	Bacteria	38919
160	Ga0068856_100000214	3300005614	Bacteria	62372
161	Ga0068856_100142990	3300005614	Bacteria	2399
162	Ga0070702_100000013	3300005615	Bacteria	53762
163	Ga0068852_100000269	3300005616	Bacteria	34734
164	Ga0068859_100003427	3300005617	Bacteria	16125
165	Ga0068859_100006411	3300005617	Bacteria	11941
166	Ga0068859_100502129	3300005617	Bacteria	1308
167	Ga0068859_102530889	3300005617	Unclassified	565
168	Ga0068864_100001591	3300005618	Bacteria	18696
169	Ga0068866_10000150	3300005718	Bacteria	31741
170	Ga0068861_100002686	3300005719	Bacteria	11647
171	Ga0068861_100006045	3300005719	Bacteria	8233
172	Ga0068851_10838672	3300005834	Bacteria	573
173	Ga0068870_10000001	3300005840	Bacteria	97513
174	Ga0068863_100000313	3300005841	Bacteria	49176
175	Ga0068863_101071056	3300005841	Bacteria	810
176	Ga0068858_100001238	3300005842	Bacteria	26382
177	Ga0068858_100910470	3300005842	Bacteria	860
178	Ga0068860_100003970	3300005843	Bacteria	15193
179	Ga0068860_100011520	3300005843	Bacteria	8717
180	Ga0068860_100224637	3300005843	Bacteria	1824
181	Ga0068860_102556056	3300005843	Bacteria	530
182	Ga0068862_100000304	3300005844	Bacteria	53990
183	Ga0068862_100014450	3300005844	Bacteria	6551
184	Ga0068862_100110082	3300005844	Unclassified	2417
185	Ga0081455_10062330	3300005937	Bacteria	3135
186	Ga0081540_1019444	3300005983	Bacteria	4125
187	Ga0070717_10002973	3300006028	Bacteria	12058
188	Ga0070717_10007538	3300006028	Bacteria	8085
189	Ga0070717_10098581	3300006028	Bacteria	2478
190	Ga0075368_10193214	3300006042	Bacteria	860
191	Ga0075364_10233947	3300006051	Bacteria	1248
192	Ga0075432_10076819	3300006058	Bacteria	1206
193	Ga0070715_10004480	3300006163	Bacteria	4589
194	Ga0070715_10614780	3300006163	Bacteria	639
195	Ga0070716_100400465	3300006173	Bacteria	987
196	Ga0070716_101181139	3300006173	Unclassified	614
197	Ga0070712_100007322	3300006175	Bacteria	6888
198	Ga0070712_100100864	3300006175	Bacteria	2134
199	Ga0070712_100269264	3300006175	Bacteria	1368
200	Ga0070712_100274323	3300006175	Bacteria	1356
201	Ga0070712_100856104	3300006175	Bacteria	782
202	Ga0075362_10082214	3300006177	Bacteria	1486
203	Ga0075367_10230465	3300006178	Bacteria	1160
204	Ga0075367_10935555	3300006178	Bacteria	553
205	Ga0075366_10176414	3300006195	Bacteria	1297
206	Ga0097621_100001871	3300006237	Bacteria	14412
207	Ga0068871_100000007	3300006358	Bacteria	115829
208	Ga0075428_100149033	3300006844	Bacteria	2542
209	Ga0075428_100405025	3300006844	Bacteria	1462
210	Ga0075428_100465382	3300006844	Unclassified	1354
211	Ga0075428_101425515	3300006844	Bacteria	727
212	Ga0075430_100587124	3300006846	Bacteria	919
213	Ga0075433_10009337	3300006852	Bacteria	7841
214	Ga0075433_10550080	3300006852	Bacteria	1015
215	Ga0075433_10974714	3300006852	Bacteria	739
216	Ga0075434_100006646	3300006871	Bacteria	10610
217	Ga0075434_100071592	3300006871	Bacteria	3458
218	Ga0075429_100737195	3300006880	Bacteria	863
219	Ga0068865_100000261	3300006881	Bacteria	29136
220	Ga0068865_100056267	3300006881	Bacteria	2740
221	Ga0075436_100137511	3300006914	Bacteria	1716
222	Ga0075436_100290115	3300006914	Bacteria	1171
223	Ga0097620_100003427	3300006931	Bacteria	16125
224	Ga0097620_100006411	3300006931	Bacteria	11941
225	Ga0097620_100502128	3300006931	Bacteria	1308
226	Ga0097620_102531353	3300006931	Unclassified	565
227	Ga0075435_100119560	3300007076	Bacteria	2197
228	Ga0105244_10177570	3300009036	Bacteria	1011
229	Ga0105250_10033651	3300009092	Bacteria	2058
230	Ga0105240_10017006	3300009093	Bacteria	9825
231	Ga0111539_10000241	3300009094	Bacteria	65476
232	Ga0111539_10005362	3300009094	Bacteria	16581
233	Ga0111539_10051255	3300009094	Bacteria	4916
234	Ga0111539_10192512	3300009094	Bacteria	2379
235	Ga0111539_11145885	3300009094	Bacteria	904
236	Ga0111539_11437048	3300009094	Bacteria	800
237	Ga0105245_10000903	3300009098	Bacteria	27011
238	Ga0105247_10004868	3300009101	Bacteria	8543
239	Ga0105247_10035547	3300009101	Bacteria	3037
240	Ga0105243_10001125	3300009148	Bacteria	24260
241	Ga0105243_10668213	3300009148	Bacteria	1009
242	Ga0105241_10005269	3300009174	Bacteria	9552
243	Ga0105242_10001026	3300009176	Bacteria	21975
244	Ga0105248_10001294	3300009177	Bacteria	27861
245	Ga0105248_10201089	3300009177	Bacteria	2245
246	Ga0105248_11465386	3300009177	Bacteria	773
247	Ga0105237_10005843	3300009545	Bacteria	13807
248	Ga0105237_10298738	3300009545	Bacteria	1613
249	Ga0105237_11635540	3300009545	Unclassified	651
250	Ga0105238_10011438	3300009551	Bacteria	8938
251	Ga0105238_11038583	3300009551	Bacteria	841
252	Ga0105238_12030534	3300009551	Bacteria	609
253	Ga0105249_10000318	3300009553	Bacteria	48726
254	Ga0105249_10001696	3300009553	Bacteria	19290
255	Ga0099796_10011646	3300010159	Bacteria	2460
256	Ga0105239_10003109	3300010375	Bacteria	20588
257	Ga0105239_10023495	3300010375	Bacteria	6790
258	Ga0105239_10072925	3300010375	Bacteria	3775
259	Ga0105246_10000018	3300011119	Bacteria	64620
260	Ga0105246_10056678	3300011119	Bacteria	2709
261	Ga0105246_11400284	3300011119	Bacteria	652
262	Ga0157346_1013777	3300012480	Unclassified	629
263	Ga0157345_1035295	3300012498	Bacteria	579
264	Ga0157314_1008321	3300012500	Bacteria	855
265	Ga0157339_1010049	3300012505	Bacteria	848
266	Ga0157342_1001468	3300012507	Bacteria	1755
267	Ga0157326_1003961	3300012513	Bacteria	1556
268	Ga0157371_10004559	3300013102	Bacteria	12060
269	Ga0157371_11453154	3300013102	Bacteria	534
270	Ga0157370_10333733	3300013104	Bacteria	1398
271	Ga0157370_10858138	3300013104	Bacteria	825
272	Ga0157374_10001432	3300013296	Bacteria	20167
273	Ga0157378_10013548	3300013297	Bacteria	7132
274	Ga0157378_11660951	3300013297	Bacteria	685
275	Ga0163162_10000416	3300013306	Bacteria	39159
276	Ga0163162_10078383	3300013306	Bacteria	3369
277	Ga0157372_10006826	3300013307	Bacteria	12138
278	Ga0157375_10000571	3300013308	Bacteria	32965
279	Ga0157375_10311852	3300013308	Bacteria	1737
280	Ga0157375_10986654	3300013308	Bacteria	983
281	Ga0157375_12893971	3300013308	Bacteria	574
282	Ga0163163_10038592	3300014325	Bacteria	4656
283	Ga0163163_10042851	3300014325	Bacteria	4435
284	Ga0163163_10491191	3300014325	Bacteria	1289
285	Ga0163163_11229415	3300014325	Bacteria	812
286	Ga0163163_11367733	3300014325	Bacteria	770
287	Ga0157380_10000115	3300014326	Bacteria	44247
288	Ga0157380_10167895	3300014326	Bacteria	1914
289	Ga0157380_10191271	3300014326	Bacteria	1807
290	Ga0157380_11517910	3300014326	Unclassified	723
291	Ga0157377_10000086	3300014745	Bacteria	69604
292	Ga0157379_10000624	3300014968	Bacteria	28612
293	Ga0157379_10002731	3300014968	Bacteria	14883
294	Ga0157379_10088683	3300014968	Bacteria	2774
295	Ga0157379_10149732	3300014968	Bacteria	2105
296	Ga0157376_10000253	3300014969	Bacteria	36981
297	Ga0157376_10235447	3300014969	Bacteria	1703
298	Ga0163161_10550493	3300017792	Bacteria	945
299	Ga0213876_10209479	3300021384	Bacteria	1036
300	Ga0213875_10020066	3300021388	Bacteria	3207
301	Ga0213871_10037022	3300021441	Bacteria	1297
302	Ga0224572_1019404	3300024225	Bacteria	1307
303	Ga0228598_1002417	3300024227	Bacteria	4078
304	Ga0207666_1000007	3300025271	Bacteria	49628
305	Ga0207666_1000530	3300025271	Bacteria	4654
306	Ga0207673_1000049	3300025290	Bacteria	9795
307	Ga0207697_10000083	3300025315	Bacteria	41914
308	Ga0207697_10073516	3300025315	Bacteria	1435
309	Ga0207655_1147930	3300025728	Bacteria	746
310	Ga0207653_10003987	3300025885	Bacteria	4644
311	Ga0207653_10059394	3300025885	Bacteria	1287
312	Ga0207682_10000002	3300025893	Bacteria	132580
313	Ga0207692_10001210	3300025898	Bacteria	9574
314	Ga0207642_10000226	3300025899	Bacteria	16695
315	Ga0207642_10228619	3300025899	Bacteria	1044
316	Ga0207710_10009185	3300025900	Bacteria	4159
317	Ga0207710_10018507	3300025900	Bacteria	2963
318	Ga0207688_10000102	3300025901	Bacteria	33857
319	Ga0207688_10204309	3300025901	Bacteria	1185
320	Ga0207680_10014698	3300025903	Bacteria	4062
321	Ga0207680_10249170	3300025903	Bacteria	1226
322	Ga0207647_10003484	3300025904	Bacteria	11799
323	Ga0207647_10007797	3300025904	Bacteria	7707
324	Ga0207685_10008174	3300025905	Bacteria	2963
325	Ga0207685_10087952	3300025905	Bacteria	1301
326	Ga0207699_10008737	3300025906	Bacteria	5013
327	Ga0207699_10050228	3300025906	Bacteria	2458
328	Ga0207699_11021742	3300025906	Bacteria	611
329	Ga0207645_10000026	3300025907	Bacteria	97025
330	Ga0207645_10142411	3300025907	Bacteria	1562
331	Ga0207643_10000003	3300025908	Bacteria	207506
332	Ga0207705_10146477	3300025909	Bacteria	1767
333	Ga0207684_10194275	3300025910	Bacteria	1750
334	Ga0207654_10011432	3300025911	Bacteria	4530
335	Ga0207654_11421519	3300025911	Bacteria	506
336	Ga0207707_10000915	3300025912	Bacteria	28718
337	Ga0207707_10132031	3300025912	Bacteria	2184
338	Ga0207707_10318273	3300025912	Bacteria	1344
339	Ga0207695_10085629	3300025913	Bacteria	3180
340	Ga0207695_10205989	3300025913	Bacteria	1880
341	Ga0207695_10667065	3300025913	Bacteria	921
342	Ga0207671_10007831	3300025914	Bacteria	9186
343	Ga0207671_10200119	3300025914	Bacteria	1560
344	Ga0207693_10000731	3300025915	Bacteria	29597
345	Ga0207693_10011090	3300025915	Bacteria	7302
346	Ga0207693_10025783	3300025915	Bacteria	4658
347	Ga0207693_10039882	3300025915	Bacteria	3698
348	Ga0207693_10303843	3300025915	Bacteria	1250
349	Ga0207693_10429772	3300025915	Bacteria	1032
350	Ga0207663_10001769	3300025916	Bacteria	10183
351	Ga0207663_10016954	3300025916	Bacteria	4050
352	Ga0207663_10143475	3300025916	Bacteria	1666
353	Ga0207663_10752531	3300025916	Bacteria	774
354	Ga0207663_10885240	3300025916	Unclassified	713
355	Ga0207663_11016603	3300025916	Bacteria	665
356	Ga0207663_11154866	3300025916	Bacteria	623
357	Ga0207660_10000070	3300025917	Bacteria	53365
358	Ga0207660_10004645	3300025917	Bacteria	8949
359	Ga0207660_10006298	3300025917	Bacteria	7698
360	Ga0207660_10636885	3300025917	Bacteria	869
361	Ga0207662_10000430	3300025918	Bacteria	18582
362	Ga0207662_10024780	3300025918	Bacteria	3453
363	Ga0207657_10000840	3300025919	Bacteria	32484
364	Ga0207657_10054337	3300025919	Bacteria	3464
365	Ga0207649_10000054	3300025920	Bacteria	103258
366	Ga0207652_10000059	3300025921	Bacteria	113599
367	Ga0207652_10041816	3300025921	Bacteria	3899
368	Ga0207652_10257759	3300025921	Bacteria	1573
369	Ga0207646_10105891	3300025922	Bacteria	2522
370	Ga0207646_11480121	3300025922	Unclassified	589
371	Ga0207681_10000118	3300025923	Bacteria	66554
372	Ga0207681_10065012	3300025923	Bacteria	2520
373	Ga0207681_10076842	3300025923	Bacteria	2346
374	Ga0207694_10045918	3300025924	Bacteria	3375
375	Ga0207694_10886717	3300025924	Bacteria	754
376	Ga0207650_10007512	3300025925	Bacteria	7432
377	Ga0207650_11415884	3300025925	Bacteria	591
378	Ga0207659_10000015	3300025926	Bacteria	168475
379	Ga0207659_10014925	3300025926	Bacteria	5023
380	Ga0207659_10028601	3300025926	Bacteria	3790
381	Ga0207687_10000050	3300025927	Bacteria	93290
382	Ga0207700_10001050	3300025928	Bacteria	15887
383	Ga0207700_10432041	3300025928	Bacteria	1158
384	Ga0207700_10441718	3300025928	Bacteria	1145
385	Ga0207664_10039591	3300025929	Bacteria	3660
386	Ga0207664_10055274	3300025929	Bacteria	3150
387	Ga0207664_11603741	3300025929	Bacteria	573
388	Ga0207690_10000146	3300025932	Bacteria	56554
389	Ga0207690_10067876	3300025932	Bacteria	2447
390	Ga0207706_10001506	3300025933	Bacteria	23119
391	Ga0207706_10005492	3300025933	Bacteria	11820
392	Ga0207686_10000256	3300025934	Bacteria	40403
393	Ga0207709_10000081	3300025935	Bacteria	164427
394	Ga0207670_10000056	3300025936	Bacteria	84496
395	Ga0207670_10007448	3300025936	Bacteria	6107
396	Ga0207670_11060018	3300025936	Bacteria	683
397	Ga0207669_10000008	3300025937	Bacteria	168213
398	Ga0207669_10453999	3300025937	Bacteria	1016
399	Ga0207704_10000031	3300025938	Bacteria	111710
400	Ga0207704_10078437	3300025938	Bacteria	2124
401	Ga0207665_10004894	3300025939	Bacteria	8925
402	Ga0207665_10220023	3300025939	Bacteria	1391
403	Ga0207691_10000251	3300025940	Bacteria	53184
404	Ga0207691_10065168	3300025940	Bacteria	3299
405	Ga0207691_10088688	3300025940	Bacteria	2774
406	Ga0207711_10000478	3300025941	Bacteria	41339
407	Ga0207711_10082185	3300025941	Bacteria	2815
408	Ga0207689_10000040	3300025942	Bacteria	93271
409	Ga0207661_10000141	3300025944	Bacteria	45776
410	Ga0207661_10521269	3300025944	Bacteria	1087
411	Ga0207679_10000014	3300025945	Bacteria	275841
412	Ga0207679_10045131	3300025945	Bacteria	3185
413	Ga0207679_10314519	3300025945	Bacteria	1354
414	Ga0207667_10004815	3300025949	Bacteria	16509
415	Ga0207667_10282441	3300025949	Bacteria	1696
416	Ga0207667_10989043	3300025949	Bacteria	829
417	Ga0207651_10000050	3300025960	Bacteria	54654
418	Ga0207651_10023811	3300025960	Bacteria	3775
419	Ga0207651_11282392	3300025960	Bacteria	658
420	Ga0207712_10000777	3300025961	Bacteria	23783
421	Ga0207712_10022382	3300025961	Bacteria	4160
422	Ga0207668_10000037	3300025972	Bacteria	115995
423	Ga0207668_10006945	3300025972	Bacteria	6718
424	Ga0207640_10000444	3300025981	Bacteria	25172
425	Ga0207640_10607259	3300025981	Bacteria	927
426	Ga0207658_10000554	3300025986	Bacteria	33932
427	Ga0207658_10262929	3300025986	Bacteria	1471
428	Ga0207658_10461287	3300025986	Bacteria	1126
429	Ga0207677_10011033	3300026023	Bacteria	5135
430	Ga0207703_10000623	3300026035	Bacteria	35772
431	Ga0207703_10634978	3300026035	Bacteria	1012
432	Ga0207703_10670702	3300026035	Bacteria	985
433	Ga0207703_11853283	3300026035	Unclassified	579
434	Ga0207639_10003070	3300026041	Bacteria	11234
435	Ga0207639_10269675	3300026041	Bacteria	1492
436	Ga0207678_10000733	3300026067	Bacteria	30024
437	Ga0207708_10000368	3300026075	Bacteria	35276
438	Ga0207708_10007166	3300026075	Bacteria	8239
439	Ga0207702_10001043	3300026078	Bacteria	28373
440	Ga0207702_10343288	3300026078	Bacteria	1427
441	Ga0207702_10354835	3300026078	Bacteria	1404
442	Ga0207641_10000272	3300026088	Bacteria	65806
443	Ga0207648_10000516	3300026089	Bacteria	43204
444	Ga0207648_10063271	3300026089	Bacteria	3225
445	Ga0207648_11172250	3300026089	Bacteria	721
446	Ga0207676_10000208	3300026095	Bacteria	50795
447	Ga0207674_10002381	3300026116	Bacteria	23770
448	Ga0207674_10965954	3300026116	Bacteria	821
449	Ga0207675_100000404	3300026118	Bacteria	41500
450	Ga0207675_100005803	3300026118	Bacteria	11802
451	Ga0207675_100869431	3300026118	Unclassified	917
452	Ga0207683_10000002	3300026121	Bacteria	258441
453	Ga0207683_10954898	3300026121	Bacteria	796
454	Ga0207698_10000161	3300026142	Bacteria	43014
455	Ga0207698_10061303	3300026142	Bacteria	2931
456	Ga0209996_1013312	3300027395	Bacteria	1110
457	Ga0209179_1021548	3300027512	Bacteria	1259
458	Ga0209982_1039710	3300027552	Bacteria	750
459	Ga0209970_1032063	3300027614	Bacteria	915
460	Ga0210002_1000254	3300027617	Bacteria	7637
461	Ga0209971_1038659	3300027682	Bacteria	1149
462	Ga0209966_1000648	3300027695	Bacteria	7796
463	Ga0209998_10000658	3300027717	Bacteria	9246
464	Ga0209998_10001308	3300027717	Bacteria	6082
465	Ga0209998_10068607	3300027717	Unclassified	845
466	Ga0209813_10493840	3300027866	Bacteria	507
467	Ga0209974_10008476	3300027876	Bacteria	3515
468	Ga0209974_10011119	3300027876	Bacteria	3028
469	Ga0209974_10029836	3300027876	Bacteria	1807
470	Ga0207428_10000011	3300027907	Bacteria	354388
471	Ga0207428_10000046	3300027907	Bacteria	191032
472	Ga0207428_10000528	3300027907	Bacteria	45643
473	Ga0268266_10015808	3300028379	Bacteria	6462
474	Ga0268266_10082079	3300028379	Bacteria	2811
475	Ga0268266_11745226	3300028379	Unclassified	597
476	Ga0268265_10000476	3300028380	Bacteria	42108
477	Ga0268265_10090079	3300028380	Bacteria	2449
478	Ga0268265_10092225	3300028380	Unclassified	2424
479	Ga0268264_10001381	3300028381	Bacteria	22737
480	Ga0268264_10016539	3300028381	Bacteria	6039
481	Ga0268264_10348493	3300028381	Bacteria	1409
482	Ga0268264_12425330	3300028381	Bacteria	530
483	Ga0265332_10037849	3300031238	Bacteria	2092
484	Ga0265325_10000254	3300031241	Bacteria	38034
485	Ga0316579_10172999	3300031691	Bacteria	1044
486	Ga0373930_0001709	3300034816	Bacteria	3329
487	Ga0373948_0000223	3300034817	Bacteria	6689
488	Ga0373948_0003360	3300034817	Bacteria	2454
489	Ga0373958_0000051	3300034819	Bacteria	11334
490	Ga0373958_0126809	3300034819	Bacteria	621
491	Ga0373959_0048273	3300034820	Bacteria	912
492	Ga0373938_0000082	3300034957	Bacteria	12812
493	Ga0373938_0003576	3300034957	Bacteria	2556
494	Ga0373926_0024417	3300035083	Bacteria	2105
495	Ga0373928_0000130	3300035084	Bacteria	14312
496	Ga0373929_0001883	3300035085	Bacteria	3932
497	Ga0373949_0000533	3300035090	Bacteria	12541
498	Ga0373949_0000842	3300035090	Bacteria	9788
499	Ga0373951_0000415	3300035091	Bacteria	12515
500	Ga0373951_0003573	3300035091	Bacteria	3751
501	Ga0373952_0000016	3300035092	Bacteria	21410
502	Ga0373952_0000749	3300035092	Bacteria	5833
503	Ga0373923_0045430	3300035111	Bacteria	1824
504	Ga0373923_0204799	3300035111	Bacteria	913
505	Ga0373923_0213675	3300035111	Bacteria	895
506	Ga0373932_0000752	3300035112	Bacteria	9657
507	Ga0373932_0000762	3300035112	Bacteria	9567
508	Ga0373939_0000298	3300035114	Bacteria	12914
509	Ga0373939_0003991	3300035114	Bacteria	3475
510	Ga0373941_0000180	3300035115	Bacteria	11834
511	Ga0373941_0000320	3300035115	Bacteria	9352
512	Ga0373941_0282200	3300035115	Bacteria	657
513	Ga0373941_0484755	3300035115	Bacteria	524
514	Ga0373954_0026893	3300035118	Bacteria	2639
515	Ga0373956_0345952	3300035119	Unclassified	709
516	Ga0373956_0497152	3300035119	Bacteria	582
517	Ga0373960_0000816	3300035121	Bacteria	6546
518	Ga0373960_0005260	3300035121	Bacteria	2990
519	Ga0373943_0087471	3300035170	Unclassified	1608
520	Ga0373943_0253614	3300035170	Bacteria	989
521	Ga0373946_0083716	3300035171	Bacteria	1401
522	Ga0373946_0224554	3300035171	Archaea	908
523	Ga0373955_0421847	3300035172	Unclassified	811
524	Ga0373942_0000890	3300035207	Bacteria	8188
525	Ga0373942_0001484	3300035207	Bacteria	6036
526	Ga0373961_0002338	3300035241	Bacteria	4950
527	Ga0373961_0003604	3300035241	Bacteria	3811
528	Ga0373962_0000349	3300035242	Bacteria	10128
529	Ga0373962_0000695	3300035242	Bacteria	7603
530	Ga0373931_0000081	3300035691	Bacteria	44696
531	Ga0373931_0007190	3300035691	Bacteria	5238
532	Ga0373935_0072211	3300035692	Bacteria	2228
533	Ga0373935_0156942	3300035692	Bacteria	1548
534	Ga0373935_0187790	3300035692	Bacteria	1422
535	Ga0373927_0212668	3300035695	Bacteria	1270
536	Ga0373933_0010899	3300035724	Bacteria	4992
537	Ga0373933_0016208	3300035724	Bacteria	4164
538	Ga0373947_0019622	3300035725	Bacteria	3899
539	Ga0373947_0070949	3300035725	Bacteria	2136
540	Ga0373947_0112641	3300035725	Bacteria	1721
541	Ga0373947_0285845	3300035725	Bacteria	1097
542	Ga0373947_0682009	3300035725	Bacteria	701
543	Ga0373947_0938721	3300035725	Archaea	590
544	Ga0373937_0001006	3300036401	Bacteria	23860
545	Ga0373937_0097381	3300036401	Bacteria	2728
546	Ga0373937_0407043	3300036401	Bacteria	1291
547	Ga0373925_0146605	3300037068	Bacteria	1851
548	Ga0373925_0283238	3300037068	Bacteria	1335
549	Ga0373925_1165754	3300037068	Bacteria	633
550	Ga0373925_1481545	3300037068	Bacteria	555
551	Ga0436364_0700023	3300037853	Bacteria	5000
552	Ga0436364_0869397	3300037853	Unclassified	683
553	Ga0436364_1289131	3300037853	Bacteria	1787
554	Ga0436364_1520677	3300037853	Bacteria	72551
555	Ga0242420_014710	3300038996	Bacteria	1346
556	Ga0436365_1623283	3300039437	Bacteria	1016
557	Ga0436360_0531869	3300039438	Bacteria	795
558	Ga0436360_1110187	3300039438	Bacteria	1414
559	Ga0436361_0287432	3300039447	Bacteria	2458
560	Ga0436361_0683034	3300039447	Bacteria	1206
561	Ga0436361_1120569	3300039447	Bacteria	776
562	Ga0436363_0158331	3300039450	Bacteria	2210
563	Ga0436363_0473030	3300039450	Bacteria	3539
564	Ga0436362_0694217	3300039453	Bacteria	942
565	Ga0439453_0004366	3300041408	Bacteria	2099
566	Ga0439441_048540	3300042001	Bacteria	869
567	Ga0439450_011248	3300042008	Bacteria	1749
568	Ga0439455_0004312	3300042012	Bacteria	2810
569	Ga0439455_0045855	3300042012	Bacteria	1131
570	Ga0439463_022089	3300042016	Bacteria	1591
571	Ga0439458_0226682	3300042157	Bacteria	516
572	Ga0439464_0169080	3300042439	Bacteria	689
573	Ga0439440_0203766	3300042993	Bacteria	587
574	Ga0453683_0373566	3300044673	Bacteria	917
575	Ga0453684_0587603	3300044712	Bacteria	1222
576	Ga0466960_0862601	3300044901	Bacteria	551
577	Ga0451576_0014126	3300045051	Bacteria	8898
578	Ga0495592_0014480	3300046454	Bacteria	5985
579	Ga0495592_0045243	3300046454	Bacteria	3285
580	Ga0495603_0364361	3300046455	Bacteria	829
581	Ga0495629_0005451	3300046459	Bacteria	9488
582	Ga0495651_0000869	3300046462	Bacteria	23491
583	Ga0495651_0066865	3300046462	Bacteria	2742
584	Ga0495653_0001147	3300046463	Bacteria	20380
585	Ga0495653_0087816	3300046463	Bacteria	2283
586	Ga0495580_0006001	3300046472	Bacteria	9944
587	Ga0495580_0465916	3300046472	Bacteria	847
588	Ga0495582_0014612	3300046473	Bacteria	4313
589	Ga0495639_0170248	3300046475	Bacteria	1057
590	Ga0495639_0677340	3300046475	Unclassified	532
591	Ga0495662_0052253	3300046476	Bacteria	1973
592	Ga0495662_0199648	3300046476	Bacteria	986
593	Ga0495664_0056060	3300046477	Bacteria	2344
594	Ga0495664_0340722	3300046477	Bacteria	903
595	Ga0495584_0274808	3300046491	Bacteria	856
596	Ga0495584_0572715	3300046491	Unclassified	576
597	Ga0495608_0007783	3300046511	Bacteria	7543
598	Ga0495608_0260377	3300046511	Bacteria	1080
599	Ga0495618_0550943	3300046514	Bacteria	690
600	Ga0495628_0011831	3300046516	Bacteria	7363
601	Ga0495628_0289639	3300046516	Bacteria	1214
602	Ga0495628_0478148	3300046516	Bacteria	902
603	Ga0495630_0147087	3300046517	Bacteria	1792
604	Ga0495630_0288410	3300046517	Archaea	1254
605	Ga0495637_0109155	3300046520	Bacteria	1074
606	Ga0495652_0054151	3300046529	Bacteria	3417
607	Ga0495665_0138660	3300046531	Bacteria	1272
608	Ga0495640_0003298	3300046533	Bacteria	12983
609	Ga0495640_0183633	3300046533	Bacteria	1332
610	Ga0495586_0484364	3300046535	Bacteria	714
611	Ga0495587_0000874	3300046536	Bacteria	19892
612	Ga0495587_0067515	3300046536	Bacteria	2084
613	Ga0495621_0326654	3300046539	Unclassified	640
614	Ga0495645_0088552	3300046543	Bacteria	2214
615	Ga0495667_0000503	3300046559	Bacteria	24956
616	Ga0495667_0969269	3300046559	Bacteria	519
617	Ga0495634_0020553	3300046642	Bacteria	4680
618	Ga0495635_0000751	3300046663	Bacteria	21026
619	Ga0495635_0046812	3300046663	Bacteria	2983
620	Ga0495657_0022054	3300046675	Bacteria	4566
621	Ga0495599_0039038	3300046678	Bacteria	2983
622	Ga0495599_0043787	3300046678	Bacteria	2809
623	Ga0495623_0005165	3300046679	Bacteria	8566
624	Ga0495623_0018857	3300046679	Bacteria	4455
625	Ga0495646_0007591	3300046680	Bacteria	6891
626	Ga0495646_0217590	3300046680	Bacteria	1034
627	Ga0495647_0366595	3300046681	Bacteria	658
628	Ga0495669_0058966	3300046684	Bacteria	1733
629	Ga0495613_0239368	3300046689	Unclassified	1269
630	Ga0495613_0547402	3300046689	Bacteria	775
631	Ga0495600_0001202	3300046809	Bacteria	14179
632	Ga0495600_0016564	3300046809	Bacteria	4681
633	Ga0495604_0002841	3300047317	Bacteria	13902
634	Ga0495604_0103024	3300047317	Bacteria	2094
635	Ga0495674_0005184	3300047319	Bacteria	12516
636	Ga0495674_0169459	3300047319	Bacteria	1823
637	Ga0495680_0001269	3300047322	Bacteria	27526
638	Ga0495680_0159549	3300047322	Bacteria	1638
639	Ga0495675_0032956	3300047444	Bacteria	3305
640	Ga0495675_0084974	3300047444	Bacteria	1990
641	Ga0495684_0001945	3300047471	Bacteria	16575
642	Ga0495602_0001935	3300048088	Bacteria	20758
643	Ga0495602_0494301	3300048088	Bacteria	856
644	Ga0495602_0543120	3300048088	Bacteria	806
645	Ga0496100_0000297	3300048903	Bacteria	24690
646	Ga0496100_0149938	3300048903	Bacteria	1662
647	Ga0496101_0000061	3300048904	Bacteria	127480
648	Ga0496102_0004775	3300048905	Bacteria	11465
649	Ga0496102_0410930	3300048905	Bacteria	1271
650	Ga0496102_0589395	3300048905	Bacteria	1035
651	Ga0496102_1550921	3300048905	Bacteria	581
652	Ga0496103_0000824	3300048906	Bacteria	22751
653	Ga0496104_0217832	3300048907	Bacteria	1821
654	Ga0496105_0143186	3300048908	Bacteria	1967
655	Ga0496106_0000690	3300048909	Bacteria	24224
656	Ga0496106_0002672	3300048909	Bacteria	13263
657	Ga0496106_0993145	3300048909	Bacteria	660
658	Ga0496107_0000164	3300048910	Bacteria	34099
659	Ga0496108_0014887	3300048911	Bacteria	6346
660	Ga0496108_0058510	3300048911	Bacteria	3240
661	Ga0496108_0096881	3300048911	Bacteria	2513
662	Ga0496109_0002095	3300048912	Bacteria	16581
663	Ga0496109_0020795	3300048912	Bacteria	5798
664	Ga0496109_0036601	3300048912	Bacteria	4430
665	Ga0496109_0366585	3300048912	Bacteria	1361
666	Ga0496110_0068355	3300048913	Bacteria	3144
667	Ga0496110_0589963	3300048913	Bacteria	1008
668	Ga0496110_0777295	3300048913	Bacteria	861
669	Ga0496111_0007137	3300048914	Bacteria	7299
670	Ga0496111_0087327	3300048914	Bacteria	2283
671	Ga0496112_0328834	3300048915	Bacteria	1472
672	Ga0496112_0711527	3300048915	Unclassified	932
673	Ga0496113_0006921	3300048916	Bacteria	7241
674	Ga0496113_0082554	3300048916	Bacteria	2465
675	Ga0496113_0896223	3300048916	Bacteria	702
676	Ga0496114_0004873	3300048917	Bacteria	10450
677	Ga0496115_0006859	3300048918	Bacteria	8362
678	Ga0496126_0519282	3300048929	Bacteria	949
679	Ga0501073_0578225	3300049589	Bacteria	776
680	Ga0501073_1071664	3300049589	Bacteria	554
681	Ga0501076_0385452	3300049592	Bacteria	1152
682	Ga0501077_0046962	3300049593	Bacteria	2743
683	Ga0501079_0094810	3300049741	Bacteria	2313
684	Ga0501080_0736069	3300049742	Bacteria	868
685	Ga0501080_1688207	3300049742	Bacteria	535
686	Ga0501081_0321338	3300049743	Bacteria	1138
687	Ga0501081_0822787	3300049743	Bacteria	699
688	Ga0501083_0071200	3300049744	Bacteria	2312
689	Ga0501045_0540458	3300049824	Bacteria	865
690	nmdc:mga03n38_302131_c1	3300050490	Bacteria	860
691	nmdc:mga00v17_61716_c1	3300050491	Bacteria	2304
692	nmdc:mga0k408_194948_c1	3300050493	Bacteria	1209
693	nmdc:mga06z11_456780_c1	3300050494	Bacteria	772
694	nmdc:mga06z11_862287_c1	3300050494	Bacteria	552
695	nmdc:mga04h51_528830_c1	3300050495	Bacteria	506
696	nmdc:mga05p37_1081707_c1	3300050507	Bacteria	842
697	nmdc:mga09592_1046294_c1	3300050508	Bacteria	680
698	nmdc:mga09592_734653_c1	3300050508	Bacteria	838
699	nmdc:mga08y16_102446_c1	3300050511	Bacteria	2980
700	nmdc:mga08y16_1037595_c1	3300050511	Bacteria	798
701	nmdc:mga08y16_1392420_c1	3300050511	Bacteria	665
702	nmdc:mga08y16_1572_c1	3300050511	Bacteria	23057
703	nmdc:mga08y16_78286_c1	3300050511	Bacteria	3447
704	nmdc:mga0n895_26598_c1	3300050512	Bacteria	5483
705	nmdc:mga0n895_628897_c1	3300050512	Bacteria	1074
706	nmdc:mga0n895_689455_c1	3300050512	Unclassified	1018
707	nmdc:mga0rr50_487781_c1	3300050513	Bacteria	1047
708	nmdc:mga08x19_123793_c1	3300050514	Bacteria	1735
709	nmdc:mga0a205_2840_c1	3300050515	Bacteria	15319
710	nmdc:mga0a205_295832_c2	3300050515	Bacteria	985
711	Ga0495601_0017137	3300053077	Bacteria	4397
712	Ga0495601_0018891	3300053077	Bacteria	4199
713	Ga0495601_0350799	3300053077	Bacteria	959
714	Ga0495612_0001436	3300053078	Bacteria	9803
715	Ga0495612_0188334	3300053078	Bacteria	908
716	Ga0495595_0003159	3300053084	Bacteria	6533
717	Ga0495595_0187369	3300053084	Bacteria	1027
718	Ga0495619_0003167	3300053085	Bacteria	10660
719	Ga0495619_0296828	3300053085	Bacteria	1119
720	Ga0500647_0021540	3300053091	Bacteria	3008
721	Ga0500595_018464	3300053119	Bacteria	2549
722	Ga0501084_0469782	3300054114	Bacteria	1063
723	Ga0501084_0584650	3300054114	Bacteria	944
724	Ga0590071_012105	3300059421	Bacteria	2022
725	Ga0501082_0700139	3300060353	Bacteria	887
726	Ga0530510_0560546	3300061734	Bacteria	868
727	Ga0501080_0590776
728	2214683819
729	ARSoilYngRDRAFT_c00011
730	ARcpr5yngRDRAFT_c000021
731	ARSoilOldRDRAFT_c000046
732	ARCol0oldRDRAFT_c01353
733	ARCol0yngRDRAFT_1000010
734	JGI24032J14994_100006
735	JGI24752J21851_1005732
736	JGI24747J21853_1000409
737	JGI24740J21852_10039044
738	JGI24739J22299_10000131
739	JGI24737J22298_10000288
740	JGI24737J22298_10006893
741	JGI24743J22301_10041379
742	JGI24743J22301_10074482
743	JGI24735J21928_10024733
744	JGI24750J21931_1000152
745	JGI24750J21931_1009758
746	JGI24745J21846_1000077
747	JGI24748J21848_1001306
748	JGI24738J21930_10000152
749	JGI24749J21850_1000353
750	JGI24749J21850_1005738
751	JGI24744J21845_10000668
752	JGI24035J26624_1000012
753	JGI24034J26672_10011414
754	JGI24742J22300_10000244
755	JGI26129J50193_1010480
756	JGI26145J50221_1026920
757	Ga0065717_1003767
758	Ga0065704_10184276
759	Ga0065712_10000516
760	Ga0065712_10069877
761	Ga0065715_10000542
762	Ga0065715_10000847
763	Ga0065707_10228672
764	Ga0070676_10000008
765	Ga0070676_10057351
766	Ga0070683_100000442
767	Ga0070690_100000739
768	Ga0070690_100001812
769	Ga0070670_100004202
770	Ga0070670_101962094
771	Ga0070677_10000100
772	Ga0068869_100000008
773	Ga0070666_10019908
774	Ga0070680_100001115
775	Ga0070680_100003408
776	Ga0070682_100000217
777	Ga0070682_100050281
778	Ga0068868_100037034
779	Ga0070660_100000387
780	Ga0070660_100005048
781	Ga0070689_100000092
782	Ga0070689_100003596
783	Ga0070691_10000232
784	Ga0070687_100000320
785	Ga0070687_100032950
786	Ga0070661_100001156
787	Ga0070692_10000324
788	Ga0070692_10221928
789	Ga0070668_100000463
790	Ga0070668_100016358
791	Ga0070668_100865584
792	Ga0070669_100000191
793	Ga0070669_100006422
794	Ga0070669_101292183
795	Ga0070675_100000032
796	Ga0070675_100018382
797	Ga0070671_100000450
798	Ga0070674_100000070
799	Ga0070674_100400917
800	Ga0070674_101459595
801	Ga0070673_100000024
802	Ga0070673_100017284
803	Ga0070673_100267525
804	Ga0070688_100000062
805	Ga0070688_100002546
806	Ga0070688_100068300
807	Ga0070659_100000343
808	Ga0070659_100001717
809	Ga0070667_100004301
810	Ga0070667_100494501
811	Ga0070703_10003738
812	Ga0070709_10001399
813	Ga0070709_10028368
814	Ga0070709_10140862
815	Ga0070709_10911050
816	Ga0070714_100093331
817	Ga0070713_100001220
818	Ga0070713_100050811
819	Ga0070713_100099104
820	Ga0070710_10002863
821	Ga0070710_10045573
822	Ga0070710_11107003
823	Ga0070701_10000030
824	Ga0070701_10002689
825	Ga0070711_100001946
826	Ga0070711_100217062
827	Ga0070711_101056355
828	Ga0070711_101153073
829	Ga0070705_100000327
830	Ga0070700_100001549
831	Ga0070700_100003759
832	Ga0070694_100014504
833	Ga0070708_100348356
834	Ga0070708_100841211
835	Ga0070663_100001713
836	Ga0070678_100000054
837	Ga0070678_100208429
838	Ga0070662_100001574
839	Ga0070662_100013085
840	Ga0070681_10000284
841	Ga0070681_10062883
842	Ga0070681_10267198
843	Ga0070681_10278196
844	Ga0068867_100000073
845	Ga0068867_100035815
846	Ga0068867_100475061
847	Ga0070685_10001515
848	Ga0070706_100101939
849	Ga0070707_100065939
850	Ga0070698_100003592
851	Ga0070698_100142460
852	Ga0070698_101248673
853	Ga0070679_100004666
854	Ga0070679_100010251
855	Ga0070679_100015976
856	Ga0070684_100000022
857	Ga0070684_100104589
858	Ga0070697_100241326
859	Ga0068853_100004041
860	Ga0068853_100026665
861	Ga0070672_100000012
862	Ga0070672_100052977
863	Ga0070672_100273225
864	Ga0070686_100000087
865	Ga0070686_100001741
866	Ga0070686_100182320
867	Ga0070695_100000422
868	Ga0070695_100002973
869	Ga0070696_100038654
870	Ga0070696_100194668
871	Ga0070696_100992046
872	Ga0070693_100000230
873	Ga0070665_100026209
874	Ga0070665_100029671
875	Ga0070704_100000913
876	Ga0070704_100019013
877	Ga0068855_100008251
878	Ga0068855_100104673
879	Ga0068855_100898799
880	Ga0070664_100000102
881	Ga0070664_100206451
882	Ga0070664_100460320
883	Ga0068857_100000069
884	Ga0068857_100487380
885	Ga0068854_100000215
886	Ga0068856_100000214
887	Ga0068856_100142990
888	Ga0070702_100000013
889	Ga0068852_100000269
890	Ga0068859_100003427
891	Ga0068859_100006411
892	Ga0068859_100502129
893	Ga0068859_102530889
894	Ga0068864_100001591
895	Ga0068866_10000150
896	Ga0068861_100002686
897	Ga0068861_100006045
898	Ga0068851_10838672
899	Ga0068870_10000001
900	Ga0068863_100000313
901	Ga0068863_101071056
902	Ga0068858_100001238
903	Ga0068858_100910470
904	Ga0068860_100003970
905	Ga0068860_100011520
906	Ga0068860_100224637
907	Ga0068860_102556056
908	Ga0068862_100000304
909	Ga0068862_100014450
910	Ga0068862_100110082
911	Ga0081455_10062330
912	Ga0081540_1019444
913	Ga0070717_10002973
914	Ga0070717_10007538
915	Ga0070717_10098581
916	Ga0075368_10193214
917	Ga0075364_10233947
918	Ga0075432_10076819
919	Ga0070715_10004480
920	Ga0070715_10614780
921	Ga0070716_100400465
922	Ga0070716_101181139
923	Ga0070712_100007322
924	Ga0070712_100100864
925	Ga0070712_100269264
926	Ga0070712_100274323
927	Ga0070712_100856104
928	Ga0075362_10082214
929	Ga0075367_10230465
930	Ga0075367_10935555
931	Ga0075366_10176414
932	Ga0097621_100001871
933	Ga0068871_100000007
934	Ga0075428_100149033
935	Ga0075428_100405025
936	Ga0075428_100465382
937	Ga0075428_101425515
938	Ga0075430_100587124
939	Ga0075433_10009337
940	Ga0075433_10550080
941	Ga0075433_10974714
942	Ga0075434_100006646
943	Ga0075434_100071592
944	Ga0075429_100737195
945	Ga0068865_100000261
946	Ga0068865_100056267
947	Ga0075436_100137511
948	Ga0075436_100290115
949	Ga0097620_100003427
950	Ga0097620_100006411
951	Ga0097620_100502128
952	Ga0097620_102531353
953	Ga0075435_100119560
954	Ga0105244_10177570
955	Ga0105250_10033651
956	Ga0105240_10017006
957	Ga0111539_10000241
958	Ga0111539_10005362
959	Ga0111539_10051255
960	Ga0111539_10192512
961	Ga0111539_11145885
962	Ga0111539_11437048
963	Ga0105245_10000903
964	Ga0105247_10004868
965	Ga0105247_10035547
966	Ga0105243_10001125
967	Ga0105243_10668213
968	Ga0105241_10005269
969	Ga0105242_10001026
970	Ga0105248_10001294
971	Ga0105248_10201089
972	Ga0105248_11465386
973	Ga0105237_10005843
974	Ga0105237_10298738
975	Ga0105237_11635540
976	Ga0105238_10011438
977	Ga0105238_11038583
978	Ga0105238_12030534
979	Ga0105249_10000318
980	Ga0105249_10001696
981	Ga0099796_10011646
982	Ga0105239_10003109
983	Ga0105239_10023495
984	Ga0105239_10072925
985	Ga0105246_10000018
986	Ga0105246_10056678
987	Ga0105246_11400284
988	Ga0157346_1013777
989	Ga0157345_1035295
990	Ga0157314_1008321
991	Ga0157339_1010049
992	Ga0157342_1001468
993	Ga0157326_1003961
994	Ga0157371_10004559
995	Ga0157371_11453154
996	Ga0157370_10333733
997	Ga0157370_10858138
998	Ga0157374_10001432
999	Ga0157378_10013548
1000	Ga0157378_11660951
1001	Ga0163162_10000416
1002	Ga0163162_10078383
1003	Ga0157372_10006826
1004	Ga0157375_10000571
1005	Ga0157375_10311852
1006	Ga0157375_10986654
1007	Ga0157375_12893971
1008	Ga0163163_10038592
1009	Ga0163163_10042851
1010	Ga0163163_10491191
1011	Ga0163163_11229415
1012	Ga0163163_11367733
1013	Ga0157380_10000115
1014	Ga0157380_10167895
1015	Ga0157380_10191271
1016	Ga0157380_11517910
1017	Ga0157377_10000086
1018	Ga0157379_10000624
1019	Ga0157379_10002731
1020	Ga0157379_10088683
1021	Ga0157379_10149732
1022	Ga0157376_10000253
1023	Ga0157376_10235447
1024	Ga0163161_10550493
1025	Ga0213876_10209479
1026	Ga0213875_10020066
1027	Ga0213871_10037022
1028	Ga0224572_1019404
1029	Ga0228598_1002417
1030	Ga0207666_1000007
1031	Ga0207666_1000530
1032	Ga0207673_1000049
1033	Ga0207697_10000083
1034	Ga0207697_10073516
1035	Ga0207655_1147930
1036	Ga0207653_10003987
1037	Ga0207653_10059394
1038	Ga0207682_10000002
1039	Ga0207692_10001210
1040	Ga0207642_10000226
1041	Ga0207642_10228619
1042	Ga0207710_10009185
1043	Ga0207710_10018507
1044	Ga0207688_10000102
1045	Ga0207688_10204309
1046	Ga0207680_10014698
1047	Ga0207680_10249170
1048	Ga0207647_10003484
1049	Ga0207647_10007797
1050	Ga0207685_10008174
1051	Ga0207685_10087952
1052	Ga0207699_10008737
1053	Ga0207699_10050228
1054	Ga0207699_11021742
1055	Ga0207645_10000026
1056	Ga0207645_10142411
1057	Ga0207643_10000003
1058	Ga0207705_10146477
1059	Ga0207684_10194275
1060	Ga0207654_10011432
1061	Ga0207654_11421519
1062	Ga0207707_10000915
1063	Ga0207707_10132031
1064	Ga0207707_10318273
1065	Ga0207695_10085629
1066	Ga0207695_10205989
1067	Ga0207695_10667065
1068	Ga0207671_10007831
1069	Ga0207671_10200119
1070	Ga0207693_10000731
1071	Ga0207693_10011090
1072	Ga0207693_10025783
1073	Ga0207693_10039882
1074	Ga0207693_10303843
1075	Ga0207693_10429772
1076	Ga0207663_10001769
1077	Ga0207663_10016954
1078	Ga0207663_10143475
1079	Ga0207663_10752531
1080	Ga0207663_10885240
1081	Ga0207663_11016603
1082	Ga0207663_11154866
1083	Ga0207660_10000070
1084	Ga0207660_10004645
1085	Ga0207660_10006298
1086	Ga0207660_10636885
1087	Ga0207662_10000430
1088	Ga0207662_10024780
1089	Ga0207657_10000840
1090	Ga0207657_10054337
1091	Ga0207649_10000054
1092	Ga0207652_10000059
1093	Ga0207652_10041816
1094	Ga0207652_10257759
1095	Ga0207646_10105891
1096	Ga0207646_11480121
1097	Ga0207681_10000118
1098	Ga0207681_10065012
1099	Ga0207681_10076842
1100	Ga0207694_10045918
1101	Ga0207694_10886717
1102	Ga0207650_10007512
1103	Ga0207650_11415884
1104	Ga0207659_10000015
1105	Ga0207659_10014925
1106	Ga0207659_10028601
1107	Ga0207687_10000050
1108	Ga0207700_10001050
1109	Ga0207700_10432041
1110	Ga0207700_10441718
1111	Ga0207664_10039591
1112	Ga0207664_10055274
1113	Ga0207664_11603741
1114	Ga0207690_10000146
1115	Ga0207690_10067876
1116	Ga0207706_10001506
1117	Ga0207706_10005492
1118	Ga0207686_10000256
1119	Ga0207709_10000081
1120	Ga0207670_10000056
1121	Ga0207670_10007448
1122	Ga0207670_11060018
1123	Ga0207669_10000008
1124	Ga0207669_10453999
1125	Ga0207704_10000031
1126	Ga0207704_10078437
1127	Ga0207665_10004894
1128	Ga0207665_10220023
1129	Ga0207691_10000251
1130	Ga0207691_10065168
1131	Ga0207691_10088688
1132	Ga0207711_10000478
1133	Ga0207711_10082185
1134	Ga0207689_10000040
1135	Ga0207661_10000141
1136	Ga0207661_10521269
1137	Ga0207679_10000014
1138	Ga0207679_10045131
1139	Ga0207679_10314519
1140	Ga0207667_10004815
1141	Ga0207667_10282441
1142	Ga0207667_10989043
1143	Ga0207651_10000050
1144	Ga0207651_10023811
1145	Ga0207651_11282392
1146	Ga0207712_10000777
1147	Ga0207712_10022382
1148	Ga0207668_10000037
1149	Ga0207668_10006945
1150	Ga0207640_10000444
1151	Ga0207640_10607259
1152	Ga0207658_10000554
1153	Ga0207658_10262929
1154	Ga0207658_10461287
1155	Ga0207677_10011033
1156	Ga0207703_10000623
1157	Ga0207703_10634978
1158	Ga0207703_10670702
1159	Ga0207703_11853283
1160	Ga0207639_10003070
1161	Ga0207639_10269675
1162	Ga0207678_10000733
1163	Ga0207708_10000368
1164	Ga0207708_10007166
1165	Ga0207702_10001043
1166	Ga0207702_10343288
1167	Ga0207702_10354835
1168	Ga0207641_10000272
1169	Ga0207648_10000516
1170	Ga0207648_10063271
1171	Ga0207648_11172250
1172	Ga0207676_10000208
1173	Ga0207674_10002381
1174	Ga0207674_10965954
1175	Ga0207675_100000404
1176	Ga0207675_100005803
1177	Ga0207675_100869431
1178	Ga0207683_10000002
1179	Ga0207683_10954898
1180	Ga0207698_10000161
1181	Ga0207698_10061303
1182	Ga0209996_1013312
1183	Ga0209179_1021548
1184	Ga0209982_1039710
1185	Ga0209970_1032063
1186	Ga0210002_1000254
1187	Ga0209971_1038659
1188	Ga0209966_1000648
1189	Ga0209998_10000658
1190	Ga0209998_10001308
1191	Ga0209998_10068607
1192	Ga0209813_10493840
1193	Ga0209974_10008476
1194	Ga0209974_10011119
1195	Ga0209974_10029836
1196	Ga0207428_10000011
1197	Ga0207428_10000046
1198	Ga0207428_10000528
1199	Ga0268266_10015808
1200	Ga0268266_10082079
1201	Ga0268266_11745226
1202	Ga0268265_10000476
1203	Ga0268265_10090079
1204	Ga0268265_10092225
1205	Ga0268264_10001381
1206	Ga0268264_10016539
1207	Ga0268264_10348493
1208	Ga0268264_12425330
1209	Ga0265332_10037849
1210	Ga0265325_10000254
1211	Ga0316579_10172999
1212	Ga0373930_0001709
1213	Ga0373948_0000223
1214	Ga0373948_0003360
1215	Ga0373958_0000051
1216	Ga0373958_0126809
1217	Ga0373959_0048273
1218	Ga0373938_0000082
1219	Ga0373938_0003576
1220	Ga0373926_0024417
1221	Ga0373928_0000130
1222	Ga0373929_0001883
1223	Ga0373949_0000533
1224	Ga0373949_0000842
1225	Ga0373951_0000415
1226	Ga0373951_0003573
1227	Ga0373952_0000016
1228	Ga0373952_0000749
1229	Ga0373923_0045430
1230	Ga0373923_0204799
1231	Ga0373923_0213675
1232	Ga0373932_0000752
1233	Ga0373932_0000762
1234	Ga0373939_0000298
1235	Ga0373939_0003991
1236	Ga0373941_0000180
1237	Ga0373941_0000320
1238	Ga0373941_0282200
1239	Ga0373941_0484755
1240	Ga0373954_0026893
1241	Ga0373956_0345952
1242	Ga0373956_0497152
1243	Ga0373960_0000816
1244	Ga0373960_0005260
1245	Ga0373943_0087471
1246	Ga0373943_0253614
1247	Ga0373946_0083716
1248	Ga0373946_0224554
1249	Ga0373955_0421847
1250	Ga0373942_0000890
1251	Ga0373942_0001484
1252	Ga0373961_0002338
1253	Ga0373961_0003604
1254	Ga0373962_0000349
1255	Ga0373962_0000695
1256	Ga0373931_0000081
1257	Ga0373931_0007190
1258	Ga0373935_0072211
1259	Ga0373935_0156942
1260	Ga0373935_0187790
1261	Ga0373927_0212668
1262	Ga0373933_0010899
1263	Ga0373933_0016208
1264	Ga0373947_0019622
1265	Ga0373947_0070949
1266	Ga0373947_0112641
1267	Ga0373947_0285845
1268	Ga0373947_0682009
1269	Ga0373947_0938721
1270	Ga0373937_0001006
1271	Ga0373937_0097381
1272	Ga0373937_0407043
1273	Ga0373925_0146605
1274	Ga0373925_0283238
1275	Ga0373925_1165754
1276	Ga0373925_1481545
1277	Ga0436364_0700023
1278	Ga0436364_0869397
1279	Ga0436364_1289131
1280	Ga0436364_1520677
1281	Ga0242420_014710
1282	Ga0436365_1623283
1283	Ga0436360_0531869
1284	Ga0436360_1110187
1285	Ga0436361_0287432
1286	Ga0436361_0683034
1287	Ga0436361_1120569
1288	Ga0436363_0158331
1289	Ga0436363_0473030
1290	Ga0436362_0694217
1291	Ga0439453_0004366
1292	Ga0439441_048540
1293	Ga0439450_011248
1294	Ga0439455_0004312
1295	Ga0439455_0045855
1296	Ga0439463_022089
1297	Ga0439458_0226682
1298	Ga0439464_0169080
1299	Ga0439440_0203766
1300	Ga0453683_0373566
1301	Ga0453684_0587603
1302	Ga0466960_0862601
1303	Ga0451576_0014126
1304	Ga0495592_0014480
1305	Ga0495592_0045243
1306	Ga0495603_0364361
1307	Ga0495629_0005451
1308	Ga0495651_0000869
1309	Ga0495651_0066865
1310	Ga0495653_0001147
1311	Ga0495653_0087816
1312	Ga0495580_0006001
1313	Ga0495580_0465916
1314	Ga0495582_0014612
1315	Ga0495639_0170248
1316	Ga0495639_0677340
1317	Ga0495662_0052253
1318	Ga0495662_0199648
1319	Ga0495664_0056060
1320	Ga0495664_0340722
1321	Ga0495584_0274808
1322	Ga0495584_0572715
1323	Ga0495608_0007783
1324	Ga0495608_0260377
1325	Ga0495618_0550943
1326	Ga0495628_0011831
1327	Ga0495628_0289639
1328	Ga0495628_0478148
1329	Ga0495630_0147087
1330	Ga0495630_0288410
1331	Ga0495637_0109155
1332	Ga0495652_0054151
1333	Ga0495665_0138660
1334	Ga0495640_0003298
1335	Ga0495640_0183633
1336	Ga0495586_0484364
1337	Ga0495587_0000874
1338	Ga0495587_0067515
1339	Ga0495621_0326654
1340	Ga0495645_0088552
1341	Ga0495667_0000503
1342	Ga0495667_0969269
1343	Ga0495634_0020553
1344	Ga0495635_0000751
1345	Ga0495635_0046812
1346	Ga0495657_0022054
1347	Ga0495599_0039038
1348	Ga0495599_0043787
1349	Ga0495623_0005165
1350	Ga0495623_0018857
1351	Ga0495646_0007591
1352	Ga0495646_0217590
1353	Ga0495647_0366595
1354	Ga0495669_0058966
1355	Ga0495613_0239368
1356	Ga0495613_0547402
1357	Ga0495600_0001202
1358	Ga0495600_0016564
1359	Ga0495604_0002841
1360	Ga0495604_0103024
1361	Ga0495674_0005184
1362	Ga0495674_0169459
1363	Ga0495680_0001269
1364	Ga0495680_0159549
1365	Ga0495675_0032956
1366	Ga0495675_0084974
1367	Ga0495684_0001945
1368	Ga0495602_0001935
1369	Ga0495602_0494301
1370	Ga0495602_0543120
1371	Ga0496100_0000297
1372	Ga0496100_0149938
1373	Ga0496101_0000061
1374	Ga0496102_0004775
1375	Ga0496102_0410930
1376	Ga0496102_0589395
1377	Ga0496102_1550921
1378	Ga0496103_0000824
1379	Ga0496104_0217832
1380	Ga0496105_0143186
1381	Ga0496106_0000690
1382	Ga0496106_0002672
1383	Ga0496106_0993145
1384	Ga0496107_0000164
1385	Ga0496108_0014887
1386	Ga0496108_0058510
1387	Ga0496108_0096881
1388	Ga0496109_0002095
1389	Ga0496109_0020795
1390	Ga0496109_0036601
1391	Ga0496109_0366585
1392	Ga0496110_0068355
1393	Ga0496110_0589963
1394	Ga0496110_0777295
1395	Ga0496111_0007137
1396	Ga0496111_0087327
1397	Ga0496112_0328834
1398	Ga0496112_0711527
1399	Ga0496113_0006921
1400	Ga0496113_0082554
1401	Ga0496113_0896223
1402	Ga0496114_0004873
1403	Ga0496115_0006859
1404	Ga0496126_0519282
1405	Ga0501073_0578225
1406	Ga0501073_1071664
1407	Ga0501076_0385452
1408	Ga0501077_0046962
1409	Ga0501079_0094810
1410	Ga0501080_0736069
1411	Ga0501080_1688207
1412	Ga0501081_0321338
1413	Ga0501081_0822787
1414	Ga0501083_0071200
1415	Ga0501045_0540458
1416	nmdc:mga03n38_302131_c1
1417	nmdc:mga00v17_61716_c1
1418	nmdc:mga0k408_194948_c1
1419	nmdc:mga06z11_456780_c1
1420	nmdc:mga06z11_862287_c1
1421	nmdc:mga04h51_528830_c1
1422	nmdc:mga05p37_1081707_c1
1423	nmdc:mga09592_1046294_c1
1424	nmdc:mga09592_734653_c1
1425	nmdc:mga08y16_102446_c1
1426	nmdc:mga08y16_1037595_c1
1427	nmdc:mga08y16_1392420_c1
1428	nmdc:mga08y16_1572_c1
1429	nmdc:mga08y16_78286_c1
1430	nmdc:mga0n895_26598_c1
1431	nmdc:mga0n895_628897_c1
1432	nmdc:mga0n895_689455_c1
1433	nmdc:mga0rr50_487781_c1
1434	nmdc:mga08x19_123793_c1
1435	nmdc:mga0a205_2840_c1
1436	nmdc:mga0a205_295832_c2
1437	Ga0495601_0017137
1438	Ga0495601_0018891
1439	Ga0495601_0350799
1440	Ga0495612_0001436
1441	Ga0495612_0188334
1442	Ga0495595_0003159
1443	Ga0495595_0187369
1444	Ga0495619_0003167
1445	Ga0495619_0296828
1446	Ga0500647_0021540
1447	Ga0500595_018464
1448	Ga0501084_0469782
1449	Ga0501084_0584650
1450	Ga0590071_012105
1451	Ga0501082_0700139
1452	Ga0530510_0560546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

44

131

0.88 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3fac-assembly8.cif.gz_H	crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83.	0.8847	8	113
3fac-assembly8.cif.gz_H	crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83.	0.8626	8	113
8ajq-assembly3.cif.gz_E	crystal structure of pa2722 from pseudomonas aeruginosa pao1	0.7881	3	105
1ybx-assembly1.cif.gz_A	conserved hypothetical protein cth-383 from clostridium thermocellum	0.6794	6	22
1xa8-assembly1.cif.gz_A	crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa)	0.6619	2	106

ID	Description	Score	Start	End	Superfamily
af_K7MPT9_9_124_2.170.150.70	Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;	0.8924	10	121	2.170.150.70
af_A0A1D6EPM0_14_114_2.170.150.70	Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;	0.8897	9	105	2.170.150.70
3facD00	Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;	0.8826	8	112	2.170.150.70
af_Q54VC9_11_133_2.170.150.70	Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;	0.8658	10	115	2.170.150.70
af_K7MPT9_9_124_2.170.150.70	Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;	0.8569	10	121	2.170.150.70

ID	Description	Score	Start	End	GO Terms
AF-A0A537UB09-F1-model_v4	Holliday junction branch migration complex subunit RuvB (EC 3.6.4.-)	0.9823	16	123	GO:0000400 GO:0003689 GO:0005524 GO:0005737 GO:0006281 GO:0006310 GO:0009378 GO:0016846 GO:0016887 GO:0036121 GO:0046872 GO:0048476 GO:0061749 GO:0061775 GO:0140584 GO:0140665 GO:0140849 GO:1990518
AF-A0A534ZEJ2-F1-model_v4	GFA family protein	0.9682	5	123	GO:0016846 GO:0046872
AF-A0A4Y6PQF8-F1-model_v4	GFA family protein	0.9614	4	123	GO:0016846 GO:0046872
AF-A0A534R6C7-F1-model_v4	GFA family protein	0.9575	5	118	GO:0016846 GO:0046872
AF-A0A535A7A9-F1-model_v4	GFA family protein	0.9558	5	125	GO:0016846 GO:0046872

F477709

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

44

131

0.88

Structural Annotation

Top 5 Hits

Map