F477763

General Info

Members Datasets Scaffolds Average Seq Length
727 295 727 219

Family's Representative Sequence

Representative Sequence 3300048088|Ga0495602_0204919|Ga0495602_0204919_564_1253
Length 229
Sequence MTKDLGVWTADDCALVLIDYQKEMFEVIRSETSADLVEMNVRLLAKTAKAFDMPIVLSTVGVGAGFNGPTLPSILSELDGIEPIDRTSMNAFEDEAFSEAVKATGRKTGRRRLIIGGLHTEICLTFASVQALKNGYDVMYVADAVGGRSQAAHRTGIERLAHAGAVPTTALAVTTELFRDWAGPLAGPALDTIYWYFREIPKLTNEVGVADAEKGAAAAYAEQAAGAAH

Samples

Sample ID Description Type Environment
1 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
176 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
177 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
181 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
202 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
214 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
218 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
233 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
246 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
252 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
282 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
283 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
288 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
289 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
290 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
291 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
292 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
293 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
294 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.06
Nodule 0
Rhizoplane 14.31
Rhizosphere 83.08
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1011099 3300001978 Bacteria 908
2 JGI24744J21845_10002897 3300002077 Bacteria 3509
3 Ga0070676_10152643 3300005328 Unclassified 1480
4 Ga0070683_100045356 3300005329 Bacteria 4057
5 Ga0070683_100585434 3300005329 Bacteria 1067
6 Ga0070690_100047336 3300005330 Bacteria 2736
7 Ga0068869_100128600 3300005334 Bacteria 1945
8 Ga0068869_100139105 3300005334 Bacteria 1873
9 Ga0068869_100149733 3300005334 Bacteria 1809
10 Ga0070680_100017805 3300005336 Bacteria 5604
11 Ga0070680_100184222 3300005336 Bacteria 1759
12 Ga0070680_100263589 3300005336 Unclassified 1458
13 Ga0070682_100002394 3300005337 Bacteria 10393
14 Ga0070682_100022994 3300005337 Bacteria 3699
15 Ga0068868_100015516 3300005338 Bacteria 5636
16 Ga0068868_100091883 3300005338 Bacteria 2446
17 Ga0068868_100143253 3300005338 Bacteria 1963
18 Ga0070660_100015317 3300005339 Bacteria 5534
19 Ga0070691_10029496 3300005341 Bacteria 2566
20 Ga0070691_10051628 3300005341 Bacteria 1964
21 Ga0070687_100304868 3300005343 Bacteria 1012
22 Ga0070687_100307732 3300005343 Bacteria 1008
23 Ga0070687_100450535 3300005343 Bacteria 856
24 Ga0070692_10095438 3300005345 Bacteria 1623
25 Ga0070692_10262601 3300005345 Bacteria 1039
26 Ga0070668_100023578 3300005347 Bacteria 4656
27 Ga0070668_100248735 3300005347 Bacteria 1475
28 Ga0070669_100120066 3300005353 Bacteria 2004
29 Ga0070669_100184736 3300005353 Bacteria 1633
30 Ga0070675_100546685 3300005354 Bacteria 1047
31 Ga0070671_100048211 3300005355 Bacteria 3542
32 Ga0070674_100064498 3300005356 Bacteria 2567
33 Ga0070674_100646178 3300005356 Bacteria 899
34 Ga0070673_100049553 3300005364 Bacteria 3280
35 Ga0070673_100111277 3300005364 Bacteria 2272
36 Ga0070688_100000841 3300005365 Bacteria 15211
37 Ga0070659_100006905 3300005366 Bacteria 8219
38 Ga0070659_100079438 3300005366 Bacteria 2618
39 Ga0070667_100192770 3300005367 Bacteria 1806
40 Ga0070709_10053899 3300005434 Bacteria 2533
41 Ga0070709_10211278 3300005434 Unclassified 1379
42 Ga0070714_100062419 3300005435 Bacteria 3203
43 Ga0070714_100088687 3300005435 Bacteria 2707
44 Ga0070714_100204689 3300005435 Unclassified 1807
45 Ga0070714_100234252 3300005435 Unclassified 1692
46 Ga0070714_100691230 3300005435 Bacteria 984
47 Ga0070713_100631798 3300005436 Bacteria 1019
48 Ga0070710_10014642 3300005437 Bacteria 3951
49 Ga0070710_10242488 3300005437 Unclassified 1155
50 Ga0070701_10012209 3300005438 Bacteria 3866
51 Ga0070711_100047894 3300005439 Bacteria 2920
52 Ga0070711_100053464 3300005439 Bacteria 2783
53 Ga0070711_100093198 3300005439 Bacteria 2175
54 Ga0070711_100094408 3300005439 Bacteria 2162
55 Ga0070711_100179877 3300005439 Bacteria 1619
56 Ga0070711_100455449 3300005439 Bacteria 1048
57 Ga0070705_100022110 3300005440 Bacteria 3393
58 Ga0070705_100114078 3300005440 Bacteria 1732
59 Ga0070705_100397250 3300005440 Bacteria 1020
60 Ga0070700_100001535 3300005441 Bacteria 11511
61 Ga0070700_100034748 3300005441 Bacteria 3046
62 Ga0070694_100172697 3300005444 Bacteria 1593
63 Ga0070694_100223748 3300005444 Bacteria 1413
64 Ga0070694_100322016 3300005444 Bacteria 1190
65 Ga0070708_100066025 3300005445 Bacteria 3246
66 Ga0070708_100075392 3300005445 Bacteria 3044
67 Ga0070708_100657175 3300005445 Unclassified 988
68 Ga0070663_100407715 3300005455 Bacteria 1112
69 Ga0070678_100032322 3300005456 Bacteria 3621
70 Ga0070678_100359491 3300005456 Bacteria 1254
71 Ga0070662_100112084 3300005457 Bacteria 2079
72 Ga0070662_100378597 3300005457 Bacteria 1165
73 Ga0070681_10804985 3300005458 Bacteria 857
74 Ga0068867_100001471 3300005459 Bacteria 16324
75 Ga0068867_100046414 3300005459 Bacteria 3191
76 Ga0070685_10014278 3300005466 Bacteria 4204
77 Ga0070706_100068874 3300005467 Bacteria 3273
78 Ga0070706_100107639 3300005467 Bacteria 2593
79 Ga0070706_100202669 3300005467 Bacteria 1853
80 Ga0070706_100960396 3300005467 Unclassified 789
81 Ga0070707_100000511 3300005468 Bacteria 38643
82 Ga0070707_100010774 3300005468 Bacteria 8515
83 Ga0070707_100036478 3300005468 Bacteria 4691
84 Ga0070707_100727335 3300005468 Bacteria 955
85 Ga0070698_100055634 3300005471 Bacteria 4010
86 Ga0070698_100079781 3300005471 Bacteria 3269
87 Ga0070698_100110822 3300005471 Bacteria 2709
88 Ga0070698_100177267 3300005471 Bacteria 2070
89 Ga0070698_100472753 3300005471 Bacteria 1190
90 Ga0070698_100520805 3300005471 Bacteria 1127
91 Ga0070698_100625718 3300005471 Bacteria 1017
92 Ga0070698_100840861 3300005471 Unclassified 863
93 Ga0070699_100117274 3300005518 Bacteria 2340
94 Ga0070679_100220661 3300005530 Bacteria 1857
95 Ga0070684_100487010 3300005535 Unclassified 1142
96 Ga0068853_100015572 3300005539 Bacteria 6247
97 Ga0070672_100087676 3300005543 Bacteria 2505
98 Ga0070672_100175644 3300005543 Bacteria 1783
99 Ga0070686_100040736 3300005544 Bacteria 2899
100 Ga0070686_100062901 3300005544 Bacteria 2402
101 Ga0070686_100126938 3300005544 Bacteria 1759
102 Ga0070686_100516901 3300005544 Bacteria 929
103 Ga0070695_100093783 3300005545 Bacteria 2009
104 Ga0070695_100099097 3300005545 Bacteria 1959
105 Ga0070695_100165560 3300005545 Bacteria 1556
106 Ga0070696_100006869 3300005546 Bacteria 7595
107 Ga0070696_100122627 3300005546 Bacteria 1882
108 Ga0070696_100174785 3300005546 Bacteria 1590
109 Ga0070696_100211759 3300005546 Bacteria 1451
110 Ga0070696_100391987 3300005546 Bacteria 1084
111 Ga0070693_100001834 3300005547 Bacteria 9700
112 Ga0070693_100005402 3300005547 Bacteria 6130
113 Ga0070693_100170598 3300005547 Unclassified 1393
114 Ga0070693_100480409 3300005547 Unclassified 878
115 Ga0070665_100095068 3300005548 Bacteria 2984
116 Ga0070704_100014179 3300005549 Bacteria 4972
117 Ga0070704_100086782 3300005549 Bacteria 2320
118 Ga0070704_100318175 3300005549 Bacteria 1303
119 Ga0068855_100156311 3300005563 Bacteria 2590
120 Ga0070664_100502036 3300005564 Bacteria 1118
121 Ga0068854_100391247 3300005578 Bacteria 1148
122 Ga0068854_100437271 3300005578 Bacteria 1090
123 Ga0068854_100663004 3300005578 Bacteria 897
124 Ga0068856_100002969 3300005614 Bacteria 17381
125 Ga0068856_100021597 3300005614 Bacteria 6256
126 Ga0068856_100321475 3300005614 Bacteria 1564
127 Ga0068856_100415054 3300005614 Bacteria 1366
128 Ga0070702_100000676 3300005615 Bacteria 12792
129 Ga0070702_100026855 3300005615 Bacteria 3099
130 Ga0070702_100259934 3300005615 Bacteria 1181
131 Ga0068852_100054409 3300005616 Bacteria 3450
132 Ga0068864_100410839 3300005618 Bacteria 1288
133 Ga0068864_100778555 3300005618 Bacteria 939
134 Ga0068866_10000624 3300005718 Bacteria 16096
135 Ga0068866_10006504 3300005718 Bacteria 4870
136 Ga0068866_10235318 3300005718 Bacteria 1113
137 Ga0068866_10428718 3300005718 Bacteria 859
138 Ga0068861_100030702 3300005719 Bacteria 3941
139 Ga0068861_100065512 3300005719 Bacteria 2799
140 Ga0068863_100135083 3300005841 Bacteria 2356
141 Ga0068858_100276448 3300005842 Bacteria 1599
142 Ga0068858_100592589 3300005842 Bacteria 1075
143 Ga0068862_100128195 3300005844 Bacteria 2242
144 Ga0068862_100217476 3300005844 Bacteria 1729
145 Ga0068862_100268120 3300005844 Bacteria 1561
146 Ga0068862_100333842 3300005844 Bacteria 1402
147 Ga0081455_10101542 3300005937 Bacteria 2308
148 Ga0070717_10067652 3300006028 Bacteria 2972
149 Ga0070717_10162570 3300006028 Archaea 1937
150 Ga0070717_10228285 3300006028 Bacteria 1638
151 Ga0070717_10385834 3300006028 Bacteria 1257
152 Ga0075365_10058973 3300006038 Bacteria 2557
153 Ga0075365_10438967 3300006038 Unclassified 922
154 Ga0075364_10023067 3300006051 Bacteria 3938
155 Ga0070715_10000737 3300006163 Bacteria 8827
156 Ga0070715_10008584 3300006163 Bacteria 3565
157 Ga0070715_10096148 3300006163 Bacteria 1373
158 Ga0070716_100144365 3300006173 Bacteria 1522
159 Ga0070716_100166006 3300006173 Bacteria 1436
160 Ga0070716_100231052 3300006173 Unclassified 1249
161 Ga0070716_100282711 3300006173 Bacteria 1146
162 Ga0070712_100042581 3300006175 Bacteria 3123
163 Ga0070712_100141993 3300006175 Bacteria 1834
164 Ga0070712_100211879 3300006175 Bacteria 1528
165 Ga0070712_100612711 3300006175 Archaea 922
166 Ga0075362_10079471 3300006177 Bacteria 1510
167 Ga0075369_10166176 3300006186 Unclassified 1012
168 Ga0097621_100004541 3300006237 Bacteria 9680
169 Ga0097621_100016827 3300006237 Bacteria 5540
170 Ga0097621_100586079 3300006237 Bacteria 1018
171 Ga0068871_100127102 3300006358 Bacteria 2158
172 Ga0068871_100643936 3300006358 Bacteria 967
173 Ga0075428_100006760 3300006844 Bacteria 12759
174 Ga0075428_100367704 3300006844 Archaea 1542
175 Ga0075428_100373574 3300006844 Unclassified 1529
176 Ga0075430_100558903 3300006846 Bacteria 944
177 Ga0075431_100003951 3300006847 Bacteria 14441
178 Ga0075431_100066582 3300006847 Bacteria 3719
179 Ga0075431_100956357 3300006847 Bacteria 825
180 Ga0075433_10002301 3300006852 Bacteria 14554
181 Ga0075433_10280987 3300006852 Bacteria 1475
182 Ga0075433_10339193 3300006852 Unclassified 1328
183 Ga0075433_10374880 3300006852 Bacteria 1256
184 Ga0075433_10529448 3300006852 Unclassified 1037
185 Ga0075433_10535015 3300006852 Bacteria 1030
186 Ga0075433_10553039 3300006852 Unclassified 1012
187 Ga0075433_10620596 3300006852 Unclassified 948
188 Ga0075434_100001735 3300006871 Bacteria 18707
189 Ga0075434_100002903 3300006871 Bacteria 15214
190 Ga0075434_100005482 3300006871 Bacteria 11557
191 Ga0075434_100035540 3300006871 Bacteria 4926
192 Ga0075434_100046968 3300006871 Bacteria 4285
193 Ga0075434_100070137 3300006871 Unclassified 3495
194 Ga0075434_100224654 3300006871 Bacteria 1897
195 Ga0075434_100467377 3300006871 Bacteria 1283
196 Ga0075429_100183696 3300006880 Bacteria 1832
197 Ga0068865_100001271 3300006881 Bacteria 14687
198 Ga0068865_100156395 3300006881 Bacteria 1734
199 Ga0075436_100003584 3300006914 Bacteria 10635
200 Ga0075436_100058845 3300006914 Bacteria 2654
201 Ga0075436_100115273 3300006914 Bacteria 1877
202 Ga0075436_100277829 3300006914 Unclassified 1197
203 Ga0075436_100314915 3300006914 Bacteria 1123
204 Ga0097620_100942440 3300006931 Bacteria 947
205 Ga0075435_100000284 3300007076 Bacteria 31543
206 Ga0075435_100001809 3300007076 Bacteria 13908
207 Ga0075435_100226689 3300007076 Bacteria 1587
208 Ga0105250_10077542 3300009092 Bacteria 1345
209 Ga0105240_10826936 3300009093 Unclassified 1001
210 Ga0111539_10073102 3300009094 Bacteria 4043
211 Ga0111539_10117237 3300009094 Bacteria 3121
212 Ga0111539_10641969 3300009094 Bacteria 1236
213 Ga0111539_11380715 3300009094 Bacteria 817
214 Ga0105245_10002220 3300009098 Bacteria 17580
215 Ga0105245_10012223 3300009098 Bacteria 7469
216 Ga0105245_10016423 3300009098 Bacteria 6457
217 Ga0105245_10016536 3300009098 Bacteria 6437
218 Ga0105245_10023158 3300009098 Bacteria 5450
219 Ga0105245_10055949 3300009098 Bacteria 3545
220 Ga0105245_10086114 3300009098 Bacteria 2881
221 Ga0105245_10185932 3300009098 Bacteria 1988
222 Ga0105245_10205405 3300009098 Bacteria 1893
223 Ga0105245_10410868 3300009098 Bacteria 1355
224 Ga0105245_10528407 3300009098 Bacteria 1199
225 Ga0105245_11112498 3300009098 Bacteria 836
226 Ga0105247_10009237 3300009101 Bacteria 5992
227 Ga0105247_10135380 3300009101 Bacteria 1609
228 Ga0105247_10295955 3300009101 Bacteria 1121
229 Ga0114129_10028492 3300009147 Bacteria 7914
230 Ga0114129_10048033 3300009147 Bacteria 5997
231 Ga0114129_10206852 3300009147 Bacteria 2655
232 Ga0114129_10336450 3300009147 Bacteria 2003
233 Ga0114129_10339024 3300009147 Bacteria 1994
234 Ga0114129_11032202 3300009147 Bacteria 1033
235 Ga0105243_10002337 3300009148 Bacteria 15873
236 Ga0105243_10082229 3300009148 Bacteria 2632
237 Ga0105243_10245984 3300009148 Bacteria 1594
238 Ga0105243_10324090 3300009148 Bacteria 1405
239 Ga0105241_10032280 3300009174 Bacteria 3924
240 Ga0105241_10035308 3300009174 Bacteria 3760
241 Ga0105241_10961496 3300009174 Bacteria 797
242 Ga0105242_10000857 3300009176 Bacteria 23571
243 Ga0105242_10063325 3300009176 Bacteria 3045
244 Ga0105242_10160149 3300009176 Bacteria 1969
245 Ga0105242_10241727 3300009176 Bacteria 1623
246 Ga0105242_10542559 3300009176 Bacteria 1113
247 Ga0105242_10602054 3300009176 Bacteria 1062
248 Ga0105242_10756665 3300009176 Bacteria 957
249 Ga0105248_10016269 3300009177 Bacteria 8188
250 Ga0105248_10028019 3300009177 Bacteria 6274
251 Ga0105248_10757073 3300009177 Unclassified 1096
252 Ga0105237_10532120 3300009545 Bacteria 1182
253 Ga0105249_10005899 3300009553 Bacteria 10602
254 Ga0105249_10010239 3300009553 Bacteria 8235
255 Ga0105249_10118624 3300009553 Bacteria 2511
256 Ga0105249_10165713 3300009553 Bacteria 2139
257 Ga0105239_10016348 3300010375 Bacteria 8205
258 Ga0105239_10068167 3300010375 Bacteria 3910
259 Ga0105239_10221523 3300010375 Bacteria 2122
260 Ga0105239_10274783 3300010375 Bacteria 1896
261 Ga0105239_10365628 3300010375 Bacteria 1630
262 Ga0105239_10448867 3300010375 Bacteria 1463
263 Ga0105239_10483589 3300010375 Bacteria 1407
264 Ga0105239_11296706 3300010375 Unclassified 840
265 Ga0105246_10014865 3300011119 Bacteria 4903
266 Ga0105246_10048970 3300011119 Bacteria 2891
267 Ga0105246_10097548 3300011119 Bacteria 2133
268 Ga0105246_10695907 3300011119 Unclassified 890
269 Ga0157326_1003426 3300012513 Bacteria 1669
270 Ga0157373_10035036 3300013100 Bacteria 3605
271 Ga0157371_10382498 3300013102 Archaea 1028
272 Ga0157370_10727876 3300013104 Bacteria 905
273 Ga0157374_10027019 3300013296 Bacteria 5170
274 Ga0157374_10755389 3300013296 Bacteria 987
275 Ga0157374_11282337 3300013296 Archaea 754
276 Ga0157378_10003292 3300013297 Bacteria 14378
277 Ga0157378_10313731 3300013297 Bacteria 1521
278 Ga0157378_10392079 3300013297 Bacteria 1366
279 Ga0157378_10668191 3300013297 Bacteria 1056
280 Ga0157378_11109492 3300013297 Archaea 828
281 Ga0163162_10021368 3300013306 Bacteria 6372
282 Ga0163162_10147406 3300013306 Bacteria 2470
283 Ga0163162_10512157 3300013306 Bacteria 1330
284 Ga0157372_10136991 3300013307 Bacteria 2820
285 Ga0157372_10825895 3300013307 Bacteria 1076
286 Ga0157372_11256138 3300013307 Archaea 855
287 Ga0157375_10297863 3300013308 Bacteria 1776
288 Ga0157375_10320764 3300013308 Bacteria 1714
289 Ga0157375_11602502 3300013308 Unclassified 770
290 Ga0163163_10933068 3300014325 Bacteria 931
291 Ga0157380_10249533 3300014326 Bacteria 1606
292 Ga0157380_10266617 3300014326 Bacteria 1559
293 Ga0157380_10443939 3300014326 Bacteria 1244
294 Ga0157377_10005732 3300014745 Bacteria 5859
295 Ga0157377_10223984 3300014745 Bacteria 1206
296 Ga0157377_10273523 3300014745 Archaea 1104
297 Ga0157379_10466959 3300014968 Bacteria 1167
298 Ga0157379_11060156 3300014968 Bacteria 775
299 Ga0157376_10003946 3300014969 Bacteria 10263
300 Ga0157376_10220390 3300014969 Bacteria 1757
301 Ga0157376_10249571 3300014969 Bacteria 1657
302 Ga0163161_10261123 3300017792 Bacteria 1353
303 Ga0163161_10641014 3300017792 Bacteria 879
304 Ga0163161_10666384 3300017792 Unclassified 863
305 Ga0163161_10750433 3300017792 Bacteria 816
306 Ga0207653_10003551 3300025885 Bacteria 4909
307 Ga0207692_10008001 3300025898 Bacteria 4361
308 Ga0207692_10013934 3300025898 Bacteria 3501
309 Ga0207692_10265080 3300025898 Bacteria 1034
310 Ga0207692_10377971 3300025898 Bacteria 879
311 Ga0207642_10210609 3300025899 Bacteria 1080
312 Ga0207710_10066670 3300025900 Bacteria 1643
313 Ga0207710_10198273 3300025900 Bacteria 991
314 Ga0207688_10014915 3300025901 Bacteria 4216
315 Ga0207688_10089866 3300025901 Bacteria 1763
316 Ga0207680_10066300 3300025903 Bacteria 2220
317 Ga0207680_10234876 3300025903 Bacteria 1261
318 Ga0207647_10063868 3300025904 Bacteria 2238
319 Ga0207685_10008451 3300025905 Bacteria 2932
320 Ga0207699_10012576 3300025906 Bacteria 4308
321 Ga0207699_10491786 3300025906 Bacteria 885
322 Ga0207643_10204730 3300025908 Bacteria 1203
323 Ga0207684_10185627 3300025910 Unclassified 1793
324 Ga0207684_10272202 3300025910 Unclassified 1461
325 Ga0207684_10337454 3300025910 Unclassified 1298
326 Ga0207684_10350354 3300025910 Bacteria 1271
327 Ga0207684_10586701 3300025910 Bacteria 952
328 Ga0207707_10567686 3300025912 Bacteria 963
329 Ga0207671_10205883 3300025914 Bacteria 1538
330 Ga0207693_10001284 3300025915 Bacteria 22326
331 Ga0207693_10006504 3300025915 Bacteria 9674
332 Ga0207693_10032035 3300025915 Bacteria 4151
333 Ga0207693_10037393 3300025915 Bacteria 3826
334 Ga0207693_10052145 3300025915 Bacteria 3209
335 Ga0207693_10060055 3300025915 Unclassified 2979
336 Ga0207693_10121881 3300025915 Bacteria 2048
337 Ga0207693_10140687 3300025915 Bacteria 1898
338 Ga0207693_10157315 3300025915 Bacteria 1787
339 Ga0207693_10221563 3300025915 Bacteria 1486
340 Ga0207663_10025979 3300025916 Bacteria 3393
341 Ga0207663_10028628 3300025916 Bacteria 3263
342 Ga0207663_10090891 3300025916 Bacteria 2025
343 Ga0207663_10405656 3300025916 Unclassified 1043
344 Ga0207663_10405703 3300025916 Bacteria 1043
345 Ga0207663_10482980 3300025916 Bacteria 960
346 Ga0207660_10005533 3300025917 Bacteria 8206
347 Ga0207660_10050742 3300025917 Bacteria 2947
348 Ga0207660_10311713 3300025917 Bacteria 1255
349 Ga0207662_10072910 3300025918 Bacteria 2082
350 Ga0207662_10226124 3300025918 Bacteria 1220
351 Ga0207662_10277881 3300025918 Bacteria 1107
352 Ga0207657_10018059 3300025919 Bacteria 6748
353 Ga0207657_10138556 3300025919 Bacteria 1989
354 Ga0207657_10217456 3300025919 Bacteria 1532
355 Ga0207646_10008723 3300025922 Bacteria 10116
356 Ga0207646_10073582 3300025922 Bacteria 3052
357 Ga0207646_10456857 3300025922 Bacteria 1152
358 Ga0207646_10509993 3300025922 Unclassified 1083
359 Ga0207681_10062821 3300025923 Bacteria 2559
360 Ga0207681_10272223 3300025923 Bacteria 1330
361 Ga0207694_10052561 3300025924 Bacteria 3158
362 Ga0207659_10062826 3300025926 Bacteria 2682
363 Ga0207687_10008519 3300025927 Bacteria 6705
364 Ga0207687_10020128 3300025927 Bacteria 4425
365 Ga0207687_10020967 3300025927 Bacteria 4338
366 Ga0207687_10069743 3300025927 Bacteria 2508
367 Ga0207687_10094293 3300025927 Bacteria 2190
368 Ga0207687_10121722 3300025927 Bacteria 1952
369 Ga0207687_10176832 3300025927 Bacteria 1650
370 Ga0207687_10320074 3300025927 Bacteria 1255
371 Ga0207687_10348014 3300025927 Bacteria 1207
372 Ga0207700_10241177 3300025928 Bacteria 1541
373 Ga0207700_10496238 3300025928 Bacteria 1080
374 Ga0207664_10024650 3300025929 Bacteria 4522
375 Ga0207664_10044801 3300025929 Bacteria 3466
376 Ga0207664_10091945 3300025929 Bacteria 2489
377 Ga0207664_10146942 3300025929 Bacteria 2000
378 Ga0207664_10281634 3300025929 Unclassified 1459
379 Ga0207664_10554080 3300025929 Bacteria 1032
380 Ga0207644_10057090 3300025931 Bacteria 2818
381 Ga0207690_10016283 3300025932 Bacteria 4520
382 Ga0207706_10071647 3300025933 Bacteria 3048
383 Ga0207686_10001206 3300025934 Bacteria 14994
384 Ga0207709_10003931 3300025935 Bacteria 8678
385 Ga0207709_10027468 3300025935 Bacteria 3279
386 Ga0207709_10298851 3300025935 Bacteria 1196
387 Ga0207709_10314913 3300025935 Bacteria 1169
388 Ga0207709_10364676 3300025935 Unclassified 1095
389 Ga0207709_10417379 3300025935 Bacteria 1030
390 Ga0207670_10248063 3300025936 Bacteria 1375
391 Ga0207670_10299454 3300025936 Bacteria 1259
392 Ga0207669_10002666 3300025937 Bacteria 7642
393 Ga0207669_10366272 3300025937 Bacteria 1119
394 Ga0207669_10573678 3300025937 Bacteria 913
395 Ga0207704_10009850 3300025938 Bacteria 4631
396 Ga0207665_10005836 3300025939 Bacteria 8191
397 Ga0207665_10006154 3300025939 Bacteria 7969
398 Ga0207691_10002281 3300025940 Bacteria 18781
399 Ga0207691_10137105 3300025940 Bacteria 2158
400 Ga0207711_10054269 3300025941 Bacteria 3439
401 Ga0207711_10058617 3300025941 Bacteria 3314
402 Ga0207711_10391085 3300025941 Bacteria 1291
403 Ga0207711_10539737 3300025941 Bacteria 1088
404 Ga0207689_10122390 3300025942 Unclassified 2140
405 Ga0207689_10397848 3300025942 Bacteria 1148
406 Ga0207661_10079431 3300025944 Bacteria 2704
407 Ga0207661_10875230 3300025944 Bacteria 827
408 Ga0207679_10211672 3300025945 Bacteria 1626
409 Ga0207667_10113528 3300025949 Bacteria 2793
410 Ga0207667_10251344 3300025949 Unclassified 1808
411 Ga0207651_10088119 3300025960 Bacteria 2262
412 Ga0207651_10470845 3300025960 Bacteria 1081
413 Ga0207712_10002308 3300025961 Bacteria 12387
414 Ga0207712_10003283 3300025961 Bacteria 10260
415 Ga0207712_10164844 3300025961 Bacteria 1726
416 Ga0207712_10221956 3300025961 Bacteria 1511
417 Ga0207668_10137283 3300025972 Bacteria 1875
418 Ga0207640_10128658 3300025981 Bacteria 1827
419 Ga0207640_10253849 3300025981 Bacteria 1366
420 Ga0207640_10380858 3300025981 Bacteria 1143
421 Ga0207640_10590376 3300025981 Bacteria 939
422 Ga0207640_10735027 3300025981 Unclassified 849
423 Ga0207658_10155201 3300025986 Bacteria 1870
424 Ga0207677_10059489 3300026023 Bacteria 2635
425 Ga0207677_10273528 3300026023 Bacteria 1383
426 Ga0207703_10152178 3300026035 Bacteria 2018
427 Ga0207703_10241664 3300026035 Unclassified 1624
428 Ga0207703_10543577 3300026035 Bacteria 1095
429 Ga0207678_10050160 3300026067 Bacteria 3606
430 Ga0207678_10105012 3300026067 Bacteria 2410
431 Ga0207708_10000370 3300026075 Bacteria 35189
432 Ga0207708_10004615 3300026075 Bacteria 10141
433 Ga0207708_10056212 3300026075 Bacteria 3002
434 Ga0207702_10002526 3300026078 Bacteria 17233
435 Ga0207702_10039342 3300026078 Bacteria 3961
436 Ga0207702_10699333 3300026078 Bacteria 999
437 Ga0207702_11175542 3300026078 Bacteria 761
438 Ga0207648_10001656 3300026089 Bacteria 24400
439 Ga0207648_10097415 3300026089 Bacteria 2574
440 Ga0207648_10171342 3300026089 Bacteria 1919
441 Ga0207674_10076445 3300026116 Bacteria 3356
442 Ga0207675_100001023 3300026118 Bacteria 27745
443 Ga0207675_100022607 3300026118 Bacteria 5854
444 Ga0207675_100060576 3300026118 Bacteria 3534
445 Ga0207675_100226238 3300026118 Unclassified 1804
446 Ga0207675_100563333 3300026118 Unclassified 1140
447 Ga0207683_10000703 3300026121 Bacteria 30509
448 Ga0207683_10009220 3300026121 Bacteria 8410
449 Ga0207683_10126376 3300026121 Bacteria 2298
450 Ga0207683_10143997 3300026121 Bacteria 2148
451 Ga0207683_10466671 3300026121 Bacteria 1164
452 Ga0207698_10038122 3300026142 Bacteria 3548
453 Ga0207698_10122567 3300026142 Bacteria 2203
454 Ga0207698_10892497 3300026142 Bacteria 896
455 Ga0209588_1011697 3300027671 Bacteria 2655
456 Ga0207428_10040067 3300027907 Bacteria 3802
457 Ga0207428_10272174 3300027907 Bacteria 1259
458 Ga0207428_10394461 3300027907 Unclassified 1014
459 Ga0268266_10213335 3300028379 Bacteria 1771
460 Ga0268265_10143944 3300028380 Bacteria 2000
461 Ga0268265_10145349 3300028380 Bacteria 1992
462 Ga0268264_10055989 3300028381 Bacteria 3295
463 Ga0268264_10292317 3300028381 Bacteria 1531
464 Ga0268264_10292745 3300028381 Bacteria 1530
465 Ga0307517_10054449 3300028786 Bacteria 3955
466 Ga0307515_10008048 3300028794 Bacteria 20659
467 Ga0307513_10608716 3300031456 Bacteria 801
468 Ga0373959_0010858 3300034820 Bacteria 1599
469 Ga0373938_0008959 3300034957 Bacteria 1800
470 Ga0373926_0020889 3300035083 Bacteria 2264
471 Ga0373940_0093157 3300035088 Bacteria 905
472 Ga0373944_0032996 3300035089 Unclassified 1567
473 Ga0373949_0007870 3300035090 Bacteria 2336
474 Ga0373951_0009558 3300035091 Bacteria 2182
475 Ga0373952_0007667 3300035092 Bacteria 2031
476 Ga0373932_0013893 3300035112 Bacteria 2014
477 Ga0373936_0110252 3300035113 Unclassified 1168
478 Ga0373941_0025398 3300035115 Bacteria 1711
479 Ga0373945_0043228 3300035116 Bacteria 1634
480 Ga0373960_0096175 3300035121 Bacteria 954
481 Ga0373943_0006763 3300035170 Bacteria 5145
482 Ga0373946_0116250 3300035171 Unclassified 1216
483 Ga0373961_0022069 3300035241 Bacteria 1700
484 Ga0373962_0065885 3300035242 Bacteria 1073
485 Ga0373931_0180667 3300035691 Bacteria 1249
486 Ga0373927_0121010 3300035695 Bacteria 1708
487 Ga0373947_0004379 3300035725 Bacteria 8282
488 Ga0373937_0759326 3300036401 Bacteria 917
489 Ga0373925_0007097 3300037068 Bacteria 8188
490 Ga0373925_0548947 3300037068 Unclassified 950
491 Ga0451576_1166587 3300045051 Bacteria 805
492 Ga0495617_104559 3300046452 Bacteria 919
493 Ga0495592_0031672 3300046454 Bacteria 3995
494 Ga0495603_0000598 3300046455 Bacteria 20275
495 Ga0495629_0006073 3300046459 Bacteria 8974
496 Ga0495629_0027320 3300046459 Unclassified 4051
497 Ga0495629_0215926 3300046459 Bacteria 1324
498 Ga0495641_0008494 3300046461 Bacteria 6248
499 Ga0495653_0103112 3300046463 Bacteria 2063
500 Ga0495580_0014040 3300046472 Bacteria 6092
501 Ga0495582_0001037 3300046473 Bacteria 15567
502 Ga0495639_0005017 3300046475 Bacteria 5680
503 Ga0495662_0001596 3300046476 Bacteria 11248
504 Ga0495584_0125112 3300046491 Bacteria 1303
505 Ga0495594_0000152 3300046499 Bacteria 32972
506 Ga0495594_0282436 3300046499 Bacteria 946
507 Ga0495607_0074576 3300046501 Bacteria 1883
508 Ga0495620_0009203 3300046515 Bacteria 5264
509 Ga0495628_0095857 3300046516 Unclassified 2292
510 Ga0495630_0040708 3300046517 Bacteria 3472
511 Ga0495630_0105465 3300046517 Bacteria 2134
512 Ga0495632_0022092 3300046519 Bacteria 3417
513 Ga0495637_0070353 3300046520 Bacteria 1414
514 Ga0495643_0005524 3300046522 Bacteria 8526
515 Ga0495644_0099882 3300046523 Unclassified 1097
516 Ga0495666_0005591 3300046526 Bacteria 6332
517 Ga0495666_0009431 3300046526 Bacteria 4882
518 Ga0495665_0006283 3300046531 Bacteria 6411
519 Ga0495640_0032279 3300046533 Bacteria 3730
520 Ga0495640_0266764 3300046533 Unclassified 1068
521 Ga0495586_0030816 3300046535 Unclassified 2870
522 Ga0495645_0258558 3300046543 Bacteria 1154
523 Ga0495622_0000291 3300046557 Bacteria 37888
524 Ga0495667_0071040 3300046559 Bacteria 2271
525 Ga0495656_0135992 3300046615 Bacteria 1174
526 Ga0495611_0109226 3300046648 Bacteria 1287
527 Ga0495659_0048643 3300046664 Unclassified 1537
528 Ga0495659_0106752 3300046664 Bacteria 1090
529 Ga0495599_0268590 3300046678 Bacteria 1035
530 Ga0495646_0175064 3300046680 Bacteria 1180
531 Ga0495647_0000716 3300046681 Bacteria 9820
532 Ga0495658_0004324 3300046683 Bacteria 6996
533 Ga0495658_0215409 3300046683 Bacteria 1201
534 Ga0495613_0004872 3300046689 Bacteria 10076
535 Ga0495624_0023521 3300046690 Bacteria 4063
536 Ga0495624_0046134 3300046690 Bacteria 2771
537 Ga0495670_0201537 3300046691 Unclassified 1054
538 Ga0495670_0283235 3300046691 Bacteria 887
539 Ga0495671_0217225 3300046692 Bacteria 926
540 Ga0495649_0130661 3300046694 Bacteria 1325
541 Ga0495589_0160956 3300046794 Bacteria 1069
542 Ga0495581_0008820 3300047315 Bacteria 5835
543 Ga0495674_0031944 3300047319 Bacteria 4778
544 Ga0495674_0060097 3300047319 Bacteria 3317
545 Ga0495674_0240599 3300047319 Unclassified 1491
546 Ga0495672_0267083 3300047320 Bacteria 823
547 Ga0495676_0000619 3300047321 Bacteria 29413
548 Ga0495676_0053837 3300047321 Bacteria 3203
549 Ga0495683_0022209 3300047323 Bacteria 3264
550 Ga0495687_004680 3300047443 Bacteria 9115
551 Ga0495677_0198028 3300047445 Bacteria 781
552 Ga0495681_0010923 3300047470 Bacteria 5456
553 Ga0495593_0007555 3300047673 Bacteria 6351
554 Ga0495602_0204919 3300048088 Bacteria 1502
555 Ga0495614_0000555 3300048089 Bacteria 15471
556 Ga0495614_0004055 3300048089 Bacteria 6583
557 Ga0495626_0092082 3300048091 Bacteria 1332
558 Ga0496100_0006109 3300048903 Bacteria 6545
559 Ga0496100_0015781 3300048903 Bacteria 4417
560 Ga0496100_0061036 3300048903 Bacteria 2483
561 Ga0496100_0144801 3300048903 Bacteria 1688
562 Ga0496100_0413172 3300048903 Unclassified 1029
563 Ga0496100_0622723 3300048903 Unclassified 839
564 Ga0496101_0001011 3300048904 Bacteria 16565
565 Ga0496101_0001309 3300048904 Bacteria 14880
566 Ga0496101_0012823 3300048904 Bacteria 5604
567 Ga0496101_0033450 3300048904 Bacteria 3626
568 Ga0496101_0054251 3300048904 Bacteria 2893
569 Ga0496101_0088467 3300048904 Bacteria 2300
570 Ga0496101_0170031 3300048904 Bacteria 1675
571 Ga0496101_0185972 3300048904 Bacteria 1601
572 Ga0496101_0229591 3300048904 Unclassified 1442
573 Ga0496102_0003745 3300048905 Bacteria 12854
574 Ga0496102_0006061 3300048905 Bacteria 10306
575 Ga0496102_0016789 3300048905 Bacteria 6402
576 Ga0496102_0022931 3300048905 Bacteria 5537
577 Ga0496102_0047488 3300048905 Bacteria 3902
578 Ga0496102_0188174 3300048905 Bacteria 1945
579 Ga0496102_0355082 3300048905 Unclassified 1380
580 Ga0496102_0738420 3300048905 Bacteria 907
581 Ga0496102_0851750 3300048905 Unclassified 834
582 Ga0496102_1214391 3300048905 Bacteria 673
583 Ga0496103_0003723 3300048906 Bacteria 9271
584 Ga0496103_0009427 3300048906 Bacteria 5785
585 Ga0496103_0051436 3300048906 Bacteria 2550
586 Ga0496103_0080589 3300048906 Bacteria 2047
587 Ga0496103_0166566 3300048906 Unclassified 1414
588 Ga0496104_0000504 3300048907 Bacteria 33646
589 Ga0496104_0004535 3300048907 Bacteria 12101
590 Ga0496104_0008804 3300048907 Bacteria 8971
591 Ga0496104_0032463 3300048907 Bacteria 4859
592 Ga0496104_0045978 3300048907 Bacteria 4107
593 Ga0496104_0098429 3300048907 Bacteria 2800
594 Ga0496104_0444360 3300048907 Bacteria 1209
595 Ga0496104_0903256 3300048907 Unclassified 788
596 Ga0496105_0052553 3300048908 Bacteria 3365
597 Ga0496105_0072489 3300048908 Bacteria 2846
598 Ga0496105_0085161 3300048908 Bacteria 2611
599 Ga0496106_0001207 3300048909 Bacteria 19306
600 Ga0496106_0005486 3300048909 Bacteria 9382
601 Ga0496106_0080320 3300048909 Bacteria 2504
602 Ga0496106_0119329 3300048909 Bacteria 2060
603 Ga0496106_0195850 3300048909 Bacteria 1607
604 Ga0496106_0206736 3300048909 Unclassified 1563
605 Ga0496106_0207534 3300048909 Bacteria 1560
606 Ga0496107_0001691 3300048910 Bacteria 13818
607 Ga0496107_0001719 3300048910 Bacteria 13741
608 Ga0496107_0007634 3300048910 Bacteria 7468
609 Ga0496107_0011965 3300048910 Bacteria 6056
610 Ga0496107_0015197 3300048910 Bacteria 5393
611 Ga0496107_0026101 3300048910 Bacteria 4140
612 Ga0496107_0063786 3300048910 Bacteria 2670
613 Ga0496107_0065556 3300048910 Bacteria 2633
614 Ga0496107_0114715 3300048910 Bacteria 1982
615 Ga0496107_0141067 3300048910 Bacteria 1781
616 Ga0496107_0179775 3300048910 Bacteria 1571
617 Ga0496107_0358768 3300048910 Bacteria 1084
618 Ga0496108_0011148 3300048911 Bacteria 7305
619 Ga0496108_0042143 3300048911 Bacteria 3811
620 Ga0496108_0048746 3300048911 Bacteria 3542
621 Ga0496108_0055349 3300048911 Bacteria 3331
622 Ga0496108_0171658 3300048911 Bacteria 1876
623 Ga0496108_0888307 3300048911 Bacteria 765
624 Ga0496109_0010571 3300048912 Bacteria 7893
625 Ga0496109_0012446 3300048912 Bacteria 7344
626 Ga0496109_0022799 3300048912 Bacteria 5548
627 Ga0496109_0109284 3300048912 Bacteria 2570
628 Ga0496109_0161813 3300048912 Unclassified 2097
629 Ga0496109_0580681 3300048912 Bacteria 1056
630 Ga0496109_0722084 3300048912 Bacteria 934
631 Ga0496110_0007496 3300048913 Bacteria 8721
632 Ga0496110_0281207 3300048913 Bacteria 1515
633 Ga0496111_0060985 3300048914 Bacteria 2734
634 Ga0496111_0122647 3300048914 Bacteria 1920
635 Ga0496111_0253520 3300048914 Bacteria 1306
636 Ga0496111_0551425 3300048914 Bacteria 846
637 Ga0496112_0076010 3300048915 Bacteria 3322
638 Ga0496112_0151700 3300048915 Bacteria 2284
639 Ga0496112_0229228 3300048915 Bacteria 1812
640 Ga0496112_0358341 3300048915 Bacteria 1401
641 Ga0496112_0569465 3300048915 Bacteria 1066
642 Ga0496113_0078498 3300048916 Bacteria 2526
643 Ga0496113_0578546 3300048916 Bacteria 900
644 Ga0496114_0001293 3300048917 Bacteria 18946
645 Ga0496114_0002456 3300048917 Bacteria 14155
646 Ga0496114_0005072 3300048917 Bacteria 10265
647 Ga0496114_0014102 3300048917 Bacteria 6407
648 Ga0496114_0057318 3300048917 Bacteria 3252
649 Ga0496114_0074261 3300048917 Bacteria 2862
650 Ga0496114_0208835 3300048917 Bacteria 1712
651 Ga0496114_0241185 3300048917 Bacteria 1589
652 Ga0496114_0798595 3300048917 Unclassified 822
653 Ga0496115_0000227 3300048918 Bacteria 51259
654 Ga0496115_0000867 3300048918 Bacteria 22015
655 Ga0496115_0005762 3300048918 Bacteria 9021
656 Ga0496115_0009699 3300048918 Bacteria 7168
657 Ga0496115_0045364 3300048918 Bacteria 3508
658 Ga0496115_0102836 3300048918 Bacteria 2343
659 Ga0496115_0113090 3300048918 Bacteria 2231
660 Ga0496115_0385457 3300048918 Bacteria 1139
661 Ga0496115_0493958 3300048918 Bacteria 984
662 Ga0496126_0082413 3300048929 Bacteria 2842
663 Ga0501067_0003444 3300049583 Bacteria 8702
664 Ga0501068_0136269 3300049584 Bacteria 1537
665 Ga0501069_0001535 3300049585 Bacteria 11419
666 nmdc:mga0yw44_207261_c1 3300050492 Bacteria 1296
667 nmdc:mga05p37_168613_c1 3300050507 Bacteria 2671
668 nmdc:mga05p37_24796_c1 3300050507 Bacteria 7291
669 nmdc:mga05p37_290016_c1 3300050507 Bacteria 1948
670 nmdc:mga05p37_356227_c1 3300050507 Bacteria 1722
671 nmdc:mga05p37_481826_c1 3300050507 Bacteria 1429
672 nmdc:mga05p37_5975_c1 3300050507 Bacteria 14326
673 nmdc:mga05p37_821736_c1 3300050507 Unclassified 1013
674 nmdc:mga09592_100092_c1 3300050508 Bacteria 2482
675 nmdc:mga09592_266179_c1 3300050508 Bacteria 1487
676 nmdc:mga09592_470914_c1 3300050508 Unclassified 1083
677 nmdc:mga09592_635705_c1 3300050508 Unclassified 912
678 nmdc:mga09592_69793_c1 3300050508 Bacteria 2981
679 nmdc:mga09592_99263_c1 3300050508 Bacteria 2493
680 nmdc:mga0qj67_649682_c1 3300050509 Unclassified 841
681 nmdc:mga06r32_33429_c1 3300050510 Bacteria 4843
682 nmdc:mga06r32_5648_c1 3300050510 Bacteria 11252
683 nmdc:mga08y16_188440_c1 3300050511 Bacteria 2140
684 nmdc:mga08y16_20726_c1 3300050511 Bacteria 6939
685 nmdc:mga08y16_304871_c1 3300050511 Unclassified 1641
686 nmdc:mga08y16_58431_c1 3300050511 Bacteria 4030
687 nmdc:mga08y16_914685_c1 3300050511 Bacteria 863
688 nmdc:mga0n895_157998_c1 3300050512 Bacteria 2298
689 nmdc:mga0n895_17713_c1 3300050512 Bacteria 6572
690 nmdc:mga0n895_2041_c1 3300050512 Bacteria 15531
691 nmdc:mga0n895_282700_c1 3300050512 Bacteria 1682
692 nmdc:mga0n895_360874_c1 3300050512 Bacteria 1471
693 nmdc:mga0n895_45110_c1 3300050512 Bacteria 4301
694 nmdc:mga0n895_466616_c1 3300050512 Unclassified 1274
695 nmdc:mga0n895_49212_c1 3300050512 Bacteria 4128
696 nmdc:mga0n895_71944_c1 3300050512 Bacteria 3430
697 nmdc:mga0rr50_112785_c1 3300050513 Bacteria 2154
698 nmdc:mga0rr50_138622_c1 3300050513 Bacteria 1955
699 nmdc:mga0rr50_18740_c1 3300050513 Bacteria 4657
700 nmdc:mga0rr50_325049_c1 3300050513 Bacteria 1290
701 nmdc:mga0rr50_570_c1 3300050513 Bacteria 19808
702 nmdc:mga0rr50_592128_c1 3300050513 Bacteria 945
703 nmdc:mga08x19_100460_c1 3300050514 Bacteria 1919
704 nmdc:mga08x19_126266_c1 3300050514 Bacteria 1718
705 nmdc:mga08x19_21664_c1 3300050514 Bacteria 3971
706 nmdc:mga08x19_9820_c1 3300050514 Bacteria 5734
707 nmdc:mga0a205_307063_c1 3300050515 Bacteria 1459
708 nmdc:mga0a205_325338_c1 3300050515 Unclassified 1408
709 nmdc:mga0a205_386812_c1 3300050515 Bacteria 1264
710 nmdc:mga0a205_426513_c1 3300050515 Bacteria 1188
711 nmdc:mga0a205_431322_c1 3300050515 Bacteria 1179
712 nmdc:mga0a205_462629_c1 3300050515 Unclassified 1128
713 nmdc:mga0a205_908162_c1 3300050515 Unclassified 727
714 nmdc:mga0sz30_18404_c2 3300050516 Bacteria 2446
715 Ga0495601_0310265 3300053077 Unclassified 1027
716 Ga0495612_0000648 3300053078 Bacteria 13983
717 Ga0495619_0022226 3300053085 Bacteria 4056
718 Ga0495619_0501298 3300053085 Unclassified 835
719 Ga0500578_0336132 3300053086 Unclassified 886
720 Ga0500646_0054699 3300053090 Bacteria 1160
721 Ga0500583_0206130 3300053092 Unclassified 977
722 Ga0500654_121595 3300053099 Bacteria 1024
723 Ga0500569_008074 3300053109 Bacteria 2394
724 Ga0500561_0014965 3300053137 Bacteria 1712
725 Ga0500616_0033134 3300053153 Bacteria 2820
726 Ga0500634_0015437 3300053161 Bacteria 4055
727 Ga0530510_0062545 3300061734 Bacteria 2694

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047445 Ga0495677_0198028 Ga0495677_0198028_178_741 172
2 3300046691 Ga0495670_0201537 Ga0495670_0201537_294_845 174
3 3300035116 Ga0373945_0043228 Ga0373945_0043228_1025_1621 187
4 3300048910 Ga0496107_0141067 Ga0496107_0141067_1171_1767 187
5 3300053085 Ga0495619_0501298 Ga0495619_0501298_223_819 187
6 3300026118 Ga0207675_100563333 Ga0207675_1005633331 193
7 3300009177 Ga0105248_10757073 Ga0105248_107570732 195
8 3300013100 Ga0157373_10035036 Ga0157373_100350363 195
9 3300035113 Ga0373936_0110252 Ga0373936_0110252_14_634 195
10 3300046459 Ga0495629_0215926 Ga0495629_0215926_226_846 195
11 3300046648 Ga0495611_0109226 Ga0495611_0109226_656_1270 195
12 3300048910 Ga0496107_0179775 Ga0496107_0179775_124_759 195
13 3300048917 Ga0496114_0798595 Ga0496114_0798595_24_659 195
14 3300009545 Ga0105237_10532120 Ga0105237_105321202 196
15 3300035088 Ga0373940_0093157 Ga0373940_0093157_10_642 196
16 3300050509 nmdc:mga0qj67_649682_c1 nmdc:mga0qj67_649682_c1_41_676 196
17 3300046516 Ga0495628_0095857 Ga0495628_0095857_477_1142 197
18 3300053078 Ga0495612_0000648 Ga0495612_0000648_5514_6179 197
19 3300046533 Ga0495640_0266764 Ga0495640_0266764_90_737 204
20 3300048905 Ga0496102_1214391 Ga0496102_1214391_14_658 204
21 3300028794 Ga0307515_10008048 Ga0307515_100080487 205
22 3300050511 nmdc:mga08y16_304871_c1 nmdc:mga08y16_304871_c1_515_1132 205
23 3300009093 Ga0105240_10826936 Ga0105240_108269362 206
24 3300005467 Ga0070706_100068874 Ga0070706_1000688742 207
25 3300005445 Ga0070708_100657175 Ga0070708_1006571751 208
26 3300005471 Ga0070698_100110822 Ga0070698_1001108222 208
27 3300006028 Ga0070717_10067652 Ga0070717_100676523 208
28 3300009098 Ga0105245_10086114 Ga0105245_100861143 209
29 3300013307 Ga0157372_11256138 Ga0157372_112561382 209
30 3300001978 JGI24747J21853_1011099 JGI24747J21853_10110991 210
31 3300002077 JGI24744J21845_10002897 JGI24744J21845_100028974 210
32 3300005328 Ga0070676_10152643 Ga0070676_101526432 210
33 3300005329 Ga0070683_100045356 Ga0070683_1000453563 210
34 3300005329 Ga0070683_100585434 Ga0070683_1005854341 210
35 3300005330 Ga0070690_100047336 Ga0070690_1000473362 210
36 3300005334 Ga0068869_100128600 Ga0068869_1001286002 210
37 3300005334 Ga0068869_100139105 Ga0068869_1001391053 210
38 3300005334 Ga0068869_100149733 Ga0068869_1001497332 210
39 3300005336 Ga0070680_100017805 Ga0070680_1000178052 210
40 3300005336 Ga0070680_100184222 Ga0070680_1001842223 210
41 3300005336 Ga0070680_100263589 Ga0070680_1002635892 210
42 3300005337 Ga0070682_100002394 Ga0070682_1000023943 210
43 3300005337 Ga0070682_100022994 Ga0070682_1000229945 210
44 3300005338 Ga0068868_100015516 Ga0068868_1000155163 210
45 3300005338 Ga0068868_100091883 Ga0068868_1000918832 210
46 3300005338 Ga0068868_100143253 Ga0068868_1001432532 210
47 3300005339 Ga0070660_100015317 Ga0070660_1000153173 210
48 3300005341 Ga0070691_10029496 Ga0070691_100294962 210
49 3300005341 Ga0070691_10051628 Ga0070691_100516282 210
50 3300005343 Ga0070687_100304868 Ga0070687_1003048682 210
51 3300005343 Ga0070687_100307732 Ga0070687_1003077322 210
52 3300005343 Ga0070687_100450535 Ga0070687_1004505351 210
53 3300005345 Ga0070692_10095438 Ga0070692_100954382 210
54 3300005345 Ga0070692_10262601 Ga0070692_102626012 210
55 3300005347 Ga0070668_100023578 Ga0070668_1000235785 210
56 3300005347 Ga0070668_100248735 Ga0070668_1002487352 210
57 3300005353 Ga0070669_100120066 Ga0070669_1001200662 210
58 3300005353 Ga0070669_100184736 Ga0070669_1001847362 210
59 3300005354 Ga0070675_100546685 Ga0070675_1005466852 210
60 3300005355 Ga0070671_100048211 Ga0070671_1000482114 210
61 3300005356 Ga0070674_100064498 Ga0070674_1000644982 210
62 3300005356 Ga0070674_100646178 Ga0070674_1006461782 210
63 3300005364 Ga0070673_100049553 Ga0070673_1000495532 210
64 3300005364 Ga0070673_100111277 Ga0070673_1001112772 210
65 3300005365 Ga0070688_100000841 Ga0070688_1000008417 210
66 3300005366 Ga0070659_100006905 Ga0070659_1000069053 210
67 3300005366 Ga0070659_100079438 Ga0070659_1000794382 210
68 3300005367 Ga0070667_100192770 Ga0070667_1001927702 210
69 3300005434 Ga0070709_10053899 Ga0070709_100538992 210
70 3300005434 Ga0070709_10211278 Ga0070709_102112782 210
71 3300005435 Ga0070714_100062419 Ga0070714_1000624192 210
72 3300005435 Ga0070714_100088687 Ga0070714_1000886873 210
73 3300005435 Ga0070714_100204689 Ga0070714_1002046892 210
74 3300005435 Ga0070714_100234252 Ga0070714_1002342521 210
75 3300005435 Ga0070714_100691230 Ga0070714_1006912302 210
76 3300005436 Ga0070713_100631798 Ga0070713_1006317982 210
77 3300005437 Ga0070710_10014642 Ga0070710_100146423 210
78 3300005437 Ga0070710_10242488 Ga0070710_102424881 210
79 3300005438 Ga0070701_10012209 Ga0070701_100122093 210
80 3300005439 Ga0070711_100047894 Ga0070711_1000478942 210
81 3300005439 Ga0070711_100053464 Ga0070711_1000534641 210
82 3300005439 Ga0070711_100093198 Ga0070711_1000931982 210
83 3300005439 Ga0070711_100094408 Ga0070711_1000944081 210
84 3300005439 Ga0070711_100179877 Ga0070711_1001798772 210
85 3300005439 Ga0070711_100455449 Ga0070711_1004554492 210
86 3300005440 Ga0070705_100022110 Ga0070705_1000221102 210
87 3300005440 Ga0070705_100114078 Ga0070705_1001140781 210
88 3300005440 Ga0070705_100397250 Ga0070705_1003972502 210
89 3300005441 Ga0070700_100001535 Ga0070700_1000015354 210
90 3300005441 Ga0070700_100034748 Ga0070700_1000347482 210
91 3300005444 Ga0070694_100172697 Ga0070694_1001726972 210
92 3300005444 Ga0070694_100223748 Ga0070694_1002237482 210
93 3300005444 Ga0070694_100322016 Ga0070694_1003220161 210
94 3300005445 Ga0070708_100066025 Ga0070708_1000660252 210
95 3300005445 Ga0070708_100075392 Ga0070708_1000753923 210
96 3300005455 Ga0070663_100407715 Ga0070663_1004077151 210
97 3300005456 Ga0070678_100032322 Ga0070678_1000323224 210
98 3300005456 Ga0070678_100359491 Ga0070678_1003594912 210
99 3300005457 Ga0070662_100112084 Ga0070662_1001120843 210
100 3300005457 Ga0070662_100378597 Ga0070662_1003785973 210
101 3300005458 Ga0070681_10804985 Ga0070681_108049851 210
102 3300005459 Ga0068867_100001471 Ga0068867_10000147112 210
103 3300005459 Ga0068867_100046414 Ga0068867_1000464142 210
104 3300005466 Ga0070685_10014278 Ga0070685_100142782 210
105 3300005467 Ga0070706_100107639 Ga0070706_1001076393 210
106 3300005467 Ga0070706_100202669 Ga0070706_1002026692 210
107 3300005467 Ga0070706_100960396 Ga0070706_1009603961 210
108 3300005468 Ga0070707_100000511 Ga0070707_10000051132 210
109 3300005468 Ga0070707_100010774 Ga0070707_1000107742 210
110 3300005468 Ga0070707_100036478 Ga0070707_1000364783 210
111 3300005468 Ga0070707_100727335 Ga0070707_1007273352 210
112 3300005471 Ga0070698_100055634 Ga0070698_1000556343 210
113 3300005471 Ga0070698_100079781 Ga0070698_1000797812 210
114 3300005471 Ga0070698_100177267 Ga0070698_1001772672 210
115 3300005471 Ga0070698_100472753 Ga0070698_1004727531 210
116 3300005471 Ga0070698_100520805 Ga0070698_1005208051 210
117 3300005471 Ga0070698_100625718 Ga0070698_1006257181 210
118 3300005471 Ga0070698_100840861 Ga0070698_1008408611 210
119 3300005518 Ga0070699_100117274 Ga0070699_1001172745 210
120 3300005530 Ga0070679_100220661 Ga0070679_1002206612 210
121 3300005535 Ga0070684_100487010 Ga0070684_1004870101 210
122 3300005539 Ga0068853_100015572 Ga0068853_1000155726 210
123 3300005543 Ga0070672_100087676 Ga0070672_1000876763 210
124 3300005543 Ga0070672_100175644 Ga0070672_1001756442 210
125 3300005544 Ga0070686_100040736 Ga0070686_1000407362 210
126 3300005544 Ga0070686_100062901 Ga0070686_1000629012 210
127 3300005544 Ga0070686_100126938 Ga0070686_1001269382 210
128 3300005544 Ga0070686_100516901 Ga0070686_1005169012 210
129 3300005545 Ga0070695_100093783 Ga0070695_1000937832 210
130 3300005545 Ga0070695_100099097 Ga0070695_1000990973 210
131 3300005545 Ga0070695_100165560 Ga0070695_1001655601 210
132 3300005546 Ga0070696_100006869 Ga0070696_1000068695 210
133 3300005546 Ga0070696_100122627 Ga0070696_1001226273 210
134 3300005546 Ga0070696_100174785 Ga0070696_1001747851 210
135 3300005546 Ga0070696_100211759 Ga0070696_1002117592 210
136 3300005546 Ga0070696_100391987 Ga0070696_1003919872 210
137 3300005547 Ga0070693_100001834 Ga0070693_1000018342 210
138 3300005547 Ga0070693_100005402 Ga0070693_1000054022 210
139 3300005547 Ga0070693_100170598 Ga0070693_1001705982 210
140 3300005547 Ga0070693_100480409 Ga0070693_1004804091 210
141 3300005548 Ga0070665_100095068 Ga0070665_1000950683 210
142 3300005549 Ga0070704_100014179 Ga0070704_1000141795 210
143 3300005549 Ga0070704_100086782 Ga0070704_1000867822 210
144 3300005549 Ga0070704_100318175 Ga0070704_1003181752 210
145 3300005563 Ga0068855_100156311 Ga0068855_1001563112 210
146 3300005564 Ga0070664_100502036 Ga0070664_1005020362 210
147 3300005578 Ga0068854_100391247 Ga0068854_1003912472 210
148 3300005578 Ga0068854_100437271 Ga0068854_1004372712 210
149 3300005578 Ga0068854_100663004 Ga0068854_1006630041 210
150 3300005614 Ga0068856_100002969 Ga0068856_10000296910 210
151 3300005614 Ga0068856_100021597 Ga0068856_1000215973 210
152 3300005614 Ga0068856_100321475 Ga0068856_1003214751 210
153 3300005614 Ga0068856_100415054 Ga0068856_1004150542 210
154 3300005615 Ga0070702_100000676 Ga0070702_10000067611 210
155 3300005615 Ga0070702_100026855 Ga0070702_1000268554 210
156 3300005615 Ga0070702_100259934 Ga0070702_1002599341 210
157 3300005616 Ga0068852_100054409 Ga0068852_1000544094 210
158 3300005618 Ga0068864_100410839 Ga0068864_1004108392 210
159 3300005618 Ga0068864_100778555 Ga0068864_1007785551 210
160 3300005718 Ga0068866_10000624 Ga0068866_1000062412 210
161 3300005718 Ga0068866_10006504 Ga0068866_100065045 210
162 3300005718 Ga0068866_10235318 Ga0068866_102353182 210
163 3300005718 Ga0068866_10428718 Ga0068866_104287182 210
164 3300005719 Ga0068861_100030702 Ga0068861_1000307023 210
165 3300005719 Ga0068861_100065512 Ga0068861_1000655123 210
166 3300005841 Ga0068863_100135083 Ga0068863_1001350832 210
167 3300005842 Ga0068858_100276448 Ga0068858_1002764482 210
168 3300005842 Ga0068858_100592589 Ga0068858_1005925892 210
169 3300005844 Ga0068862_100128195 Ga0068862_1001281952 210
170 3300005844 Ga0068862_100217476 Ga0068862_1002174762 210
171 3300005844 Ga0068862_100268120 Ga0068862_1002681201 210
172 3300005844 Ga0068862_100333842 Ga0068862_1003338422 210
173 3300005937 Ga0081455_10101542 Ga0081455_101015423 210
174 3300006028 Ga0070717_10162570 Ga0070717_101625702 210
175 3300006028 Ga0070717_10228285 Ga0070717_102282852 210
176 3300006028 Ga0070717_10385834 Ga0070717_103858341 210
177 3300006038 Ga0075365_10058973 Ga0075365_100589733 210
178 3300006038 Ga0075365_10438967 Ga0075365_104389671 210
179 3300006051 Ga0075364_10023067 Ga0075364_100230675 210
180 3300006163 Ga0070715_10000737 Ga0070715_100007378 210
181 3300006163 Ga0070715_10008584 Ga0070715_100085842 210
182 3300006163 Ga0070715_10096148 Ga0070715_100961482 210
183 3300006173 Ga0070716_100144365 Ga0070716_1001443653 210
184 3300006173 Ga0070716_100166006 Ga0070716_1001660062 210
185 3300006173 Ga0070716_100231052 Ga0070716_1002310522 210
186 3300006173 Ga0070716_100282711 Ga0070716_1002827112 210
187 3300006175 Ga0070712_100042581 Ga0070712_1000425814 210
188 3300006175 Ga0070712_100141993 Ga0070712_1001419932 210
189 3300006175 Ga0070712_100211879 Ga0070712_1002118792 210
190 3300006175 Ga0070712_100612711 Ga0070712_1006127112 210
191 3300006177 Ga0075362_10079471 Ga0075362_100794712 210
192 3300006186 Ga0075369_10166176 Ga0075369_101661762 210
193 3300006237 Ga0097621_100004541 Ga0097621_1000045418 210
194 3300006237 Ga0097621_100016827 Ga0097621_1000168273 210
195 3300006237 Ga0097621_100586079 Ga0097621_1005860791 210
196 3300006358 Ga0068871_100127102 Ga0068871_1001271022 210
197 3300006358 Ga0068871_100643936 Ga0068871_1006439362 210
198 3300006844 Ga0075428_100006760 Ga0075428_1000067606 210
199 3300006844 Ga0075428_100367704 Ga0075428_1003677042 210
200 3300006844 Ga0075428_100373574 Ga0075428_1003735742 210
201 3300006846 Ga0075430_100558903 Ga0075430_1005589032 210
202 3300006847 Ga0075431_100003951 Ga0075431_1000039517 210
203 3300006847 Ga0075431_100066582 Ga0075431_1000665823 210
204 3300006847 Ga0075431_100956357 Ga0075431_1009563571 210
205 3300006852 Ga0075433_10002301 Ga0075433_100023014 210
206 3300006852 Ga0075433_10280987 Ga0075433_102809871 210
207 3300006852 Ga0075433_10339193 Ga0075433_103391932 210
208 3300006852 Ga0075433_10374880 Ga0075433_103748802 210
209 3300006852 Ga0075433_10529448 Ga0075433_105294482 210
210 3300006852 Ga0075433_10535015 Ga0075433_105350152 210
211 3300006852 Ga0075433_10553039 Ga0075433_105530392 210
212 3300006852 Ga0075433_10620596 Ga0075433_106205962 210
213 3300006871 Ga0075434_100001735 Ga0075434_1000017353 210
214 3300006871 Ga0075434_100002903 Ga0075434_1000029035 210
215 3300006871 Ga0075434_100005482 Ga0075434_1000054829 210
216 3300006871 Ga0075434_100035540 Ga0075434_1000355403 210
217 3300006871 Ga0075434_100046968 Ga0075434_1000469682 210
218 3300006871 Ga0075434_100070137 Ga0075434_1000701372 210
219 3300006871 Ga0075434_100224654 Ga0075434_1002246541 210
220 3300006871 Ga0075434_100467377 Ga0075434_1004673772 210
221 3300006880 Ga0075429_100183696 Ga0075429_1001836962 210
222 3300006881 Ga0068865_100001271 Ga0068865_1000012712 210
223 3300006881 Ga0068865_100156395 Ga0068865_1001563952 210
224 3300006914 Ga0075436_100003584 Ga0075436_1000035843 210
225 3300006914 Ga0075436_100058845 Ga0075436_1000588452 210
226 3300006914 Ga0075436_100115273 Ga0075436_1001152732 210
227 3300006914 Ga0075436_100277829 Ga0075436_1002778292 210
228 3300006914 Ga0075436_100314915 Ga0075436_1003149152 210
229 3300006931 Ga0097620_100942440 Ga0097620_1009424401 210
230 3300007076 Ga0075435_100000284 Ga0075435_10000028416 210
231 3300007076 Ga0075435_100001809 Ga0075435_10000180914 210
232 3300007076 Ga0075435_100226689 Ga0075435_1002266892 210
233 3300009092 Ga0105250_10077542 Ga0105250_100775422 210
234 3300009094 Ga0111539_10073102 Ga0111539_100731024 210
235 3300009094 Ga0111539_10117237 Ga0111539_101172375 210
236 3300009094 Ga0111539_10641969 Ga0111539_106419693 210
237 3300009094 Ga0111539_11380715 Ga0111539_113807151 210
238 3300009098 Ga0105245_10002220 Ga0105245_100022203 210
239 3300009098 Ga0105245_10012223 Ga0105245_100122238 210
240 3300009098 Ga0105245_10016423 Ga0105245_100164234 210
241 3300009098 Ga0105245_10016536 Ga0105245_100165367 210
242 3300009098 Ga0105245_10023158 Ga0105245_100231585 210
243 3300009098 Ga0105245_10055949 Ga0105245_100559492 210
244 3300009098 Ga0105245_10185932 Ga0105245_101859322 210
245 3300009098 Ga0105245_10205405 Ga0105245_102054052 210
246 3300009098 Ga0105245_10410868 Ga0105245_104108682 210
247 3300009098 Ga0105245_10528407 Ga0105245_105284071 210
248 3300009098 Ga0105245_11112498 Ga0105245_111124982 210
249 3300009101 Ga0105247_10009237 Ga0105247_100092372 210
250 3300009101 Ga0105247_10135380 Ga0105247_101353802 210
251 3300009101 Ga0105247_10295955 Ga0105247_102959552 210
252 3300009147 Ga0114129_10028492 Ga0114129_100284926 210
253 3300009147 Ga0114129_10048033 Ga0114129_100480332 210
254 3300009147 Ga0114129_10206852 Ga0114129_102068522 210
255 3300009147 Ga0114129_10336450 Ga0114129_103364502 210
256 3300009147 Ga0114129_10339024 Ga0114129_103390242 210
257 3300009147 Ga0114129_11032202 Ga0114129_110322021 210
258 3300009148 Ga0105243_10002337 Ga0105243_100023377 210
259 3300009148 Ga0105243_10082229 Ga0105243_100822294 210
260 3300009148 Ga0105243_10245984 Ga0105243_102459842 210
261 3300009148 Ga0105243_10324090 Ga0105243_103240902 210
262 3300009174 Ga0105241_10032280 Ga0105241_100322804 210
263 3300009174 Ga0105241_10035308 Ga0105241_100353082 210
264 3300009174 Ga0105241_10961496 Ga0105241_109614961 210
265 3300009176 Ga0105242_10000857 Ga0105242_1000085712 210
266 3300009176 Ga0105242_10063325 Ga0105242_100633254 210
267 3300009176 Ga0105242_10160149 Ga0105242_101601492 210
268 3300009176 Ga0105242_10241727 Ga0105242_102417272 210
269 3300009176 Ga0105242_10542559 Ga0105242_105425592 210
270 3300009176 Ga0105242_10602054 Ga0105242_106020542 210
271 3300009176 Ga0105242_10756665 Ga0105242_107566651 210
272 3300009177 Ga0105248_10016269 Ga0105248_100162693 210
273 3300009177 Ga0105248_10028019 Ga0105248_100280193 210
274 3300009553 Ga0105249_10005899 Ga0105249_1000589910 210
275 3300009553 Ga0105249_10010239 Ga0105249_100102395 210
276 3300009553 Ga0105249_10118624 Ga0105249_101186242 210
277 3300009553 Ga0105249_10165713 Ga0105249_101657132 210
278 3300010375 Ga0105239_10016348 Ga0105239_100163483 210
279 3300010375 Ga0105239_10068167 Ga0105239_100681672 210
280 3300010375 Ga0105239_10221523 Ga0105239_102215233 210
281 3300010375 Ga0105239_10274783 Ga0105239_102747833 210
282 3300010375 Ga0105239_10365628 Ga0105239_103656282 210
283 3300010375 Ga0105239_10448867 Ga0105239_104488672 210
284 3300010375 Ga0105239_10483589 Ga0105239_104835892 210
285 3300010375 Ga0105239_11296706 Ga0105239_112967062 210
286 3300011119 Ga0105246_10014865 Ga0105246_100148651 210
287 3300011119 Ga0105246_10048970 Ga0105246_100489704 210
288 3300011119 Ga0105246_10097548 Ga0105246_100975483 210
289 3300011119 Ga0105246_10695907 Ga0105246_106959072 210
290 3300012513 Ga0157326_1003426 Ga0157326_10034262 210
291 3300013102 Ga0157371_10382498 Ga0157371_103824982 210
292 3300013104 Ga0157370_10727876 Ga0157370_107278762 210
293 3300013296 Ga0157374_10027019 Ga0157374_100270196 210
294 3300013296 Ga0157374_10755389 Ga0157374_107553891 210
295 3300013296 Ga0157374_11282337 Ga0157374_112823371 210
296 3300013297 Ga0157378_10003292 Ga0157378_100032922 210
297 3300013297 Ga0157378_10313731 Ga0157378_103137312 210
298 3300013297 Ga0157378_10392079 Ga0157378_103920793 210
299 3300013297 Ga0157378_10668191 Ga0157378_106681912 210
300 3300013297 Ga0157378_11109492 Ga0157378_111094922 210
301 3300013306 Ga0163162_10021368 Ga0163162_100213684 210
302 3300013306 Ga0163162_10147406 Ga0163162_101474063 210
303 3300013306 Ga0163162_10512157 Ga0163162_105121571 210
304 3300013307 Ga0157372_10136991 Ga0157372_101369912 210
305 3300013307 Ga0157372_10825895 Ga0157372_108258952 210
306 3300013308 Ga0157375_10297863 Ga0157375_102978631 210
307 3300013308 Ga0157375_10320764 Ga0157375_103207642 210
308 3300013308 Ga0157375_11602502 Ga0157375_116025021 210
309 3300014325 Ga0163163_10933068 Ga0163163_109330681 210
310 3300014326 Ga0157380_10249533 Ga0157380_102495332 210
311 3300014326 Ga0157380_10266617 Ga0157380_102666172 210
312 3300014326 Ga0157380_10443939 Ga0157380_104439392 210
313 3300014745 Ga0157377_10005732 Ga0157377_100057324 210
314 3300014745 Ga0157377_10223984 Ga0157377_102239842 210
315 3300014745 Ga0157377_10273523 Ga0157377_102735232 210
316 3300014968 Ga0157379_10466959 Ga0157379_104669592 210
317 3300014968 Ga0157379_11060156 Ga0157379_110601561 210
318 3300014969 Ga0157376_10003946 Ga0157376_100039463 210
319 3300014969 Ga0157376_10220390 Ga0157376_102203902 210
320 3300014969 Ga0157376_10249571 Ga0157376_102495712 210
321 3300017792 Ga0163161_10261123 Ga0163161_102611232 210
322 3300017792 Ga0163161_10641014 Ga0163161_106410142 210
323 3300017792 Ga0163161_10666384 Ga0163161_106663842 210
324 3300017792 Ga0163161_10750433 Ga0163161_107504331 210
325 3300025885 Ga0207653_10003551 Ga0207653_100035512 210
326 3300025898 Ga0207692_10008001 Ga0207692_100080013 210
327 3300025898 Ga0207692_10013934 Ga0207692_100139342 210
328 3300025898 Ga0207692_10265080 Ga0207692_102650801 210
329 3300025898 Ga0207692_10377971 Ga0207692_103779712 210
330 3300025899 Ga0207642_10210609 Ga0207642_102106092 210
331 3300025900 Ga0207710_10066670 Ga0207710_100666702 210
332 3300025900 Ga0207710_10198273 Ga0207710_101982732 210
333 3300025901 Ga0207688_10014915 Ga0207688_100149153 210
334 3300025901 Ga0207688_10089866 Ga0207688_100898663 210
335 3300025903 Ga0207680_10066300 Ga0207680_100663002 210
336 3300025903 Ga0207680_10234876 Ga0207680_102348762 210
337 3300025904 Ga0207647_10063868 Ga0207647_100638682 210
338 3300025905 Ga0207685_10008451 Ga0207685_100084513 210
339 3300025906 Ga0207699_10012576 Ga0207699_100125762 210
340 3300025906 Ga0207699_10491786 Ga0207699_104917862 210
341 3300025908 Ga0207643_10204730 Ga0207643_102047302 210
342 3300025910 Ga0207684_10185627 Ga0207684_101856272 210
343 3300025910 Ga0207684_10272202 Ga0207684_102722021 210
344 3300025910 Ga0207684_10337454 Ga0207684_103374542 210
345 3300025910 Ga0207684_10350354 Ga0207684_103503542 210
346 3300025910 Ga0207684_10586701 Ga0207684_105867012 210
347 3300025912 Ga0207707_10567686 Ga0207707_105676862 210
348 3300025914 Ga0207671_10205883 Ga0207671_102058832 210
349 3300025915 Ga0207693_10001284 Ga0207693_100012846 210
350 3300025915 Ga0207693_10006504 Ga0207693_100065045 210
351 3300025915 Ga0207693_10032035 Ga0207693_100320352 210
352 3300025915 Ga0207693_10037393 Ga0207693_100373933 210
353 3300025915 Ga0207693_10052145 Ga0207693_100521452 210
354 3300025915 Ga0207693_10060055 Ga0207693_100600553 210
355 3300025915 Ga0207693_10121881 Ga0207693_101218813 210
356 3300025915 Ga0207693_10140687 Ga0207693_101406872 210
357 3300025915 Ga0207693_10157315 Ga0207693_101573152 210
358 3300025915 Ga0207693_10221563 Ga0207693_102215632 210
359 3300025916 Ga0207663_10025979 Ga0207663_100259794 210
360 3300025916 Ga0207663_10028628 Ga0207663_100286282 210
361 3300025916 Ga0207663_10090891 Ga0207663_100908912 210
362 3300025916 Ga0207663_10405656 Ga0207663_104056561 210
363 3300025916 Ga0207663_10405703 Ga0207663_104057031 210
364 3300025916 Ga0207663_10482980 Ga0207663_104829802 210
365 3300025917 Ga0207660_10005533 Ga0207660_100055334 210
366 3300025917 Ga0207660_10050742 Ga0207660_100507422 210
367 3300025917 Ga0207660_10311713 Ga0207660_103117132 210
368 3300025918 Ga0207662_10072910 Ga0207662_100729102 210
369 3300025918 Ga0207662_10226124 Ga0207662_102261242 210
370 3300025918 Ga0207662_10277881 Ga0207662_102778812 210
371 3300025919 Ga0207657_10018059 Ga0207657_100180593 210
372 3300025919 Ga0207657_10138556 Ga0207657_101385561 210
373 3300025919 Ga0207657_10217456 Ga0207657_102174561 210
374 3300025922 Ga0207646_10008723 Ga0207646_100087239 210
375 3300025922 Ga0207646_10073582 Ga0207646_100735822 210
376 3300025922 Ga0207646_10456857 Ga0207646_104568572 210
377 3300025922 Ga0207646_10509993 Ga0207646_105099932 210
378 3300025923 Ga0207681_10062821 Ga0207681_100628212 210
379 3300025923 Ga0207681_10272223 Ga0207681_102722231 210
380 3300025924 Ga0207694_10052561 Ga0207694_100525613 210
381 3300025926 Ga0207659_10062826 Ga0207659_100628262 210
382 3300025927 Ga0207687_10008519 Ga0207687_100085195 210
383 3300025927 Ga0207687_10020128 Ga0207687_100201285 210
384 3300025927 Ga0207687_10020967 Ga0207687_100209676 210
385 3300025927 Ga0207687_10069743 Ga0207687_100697432 210
386 3300025927 Ga0207687_10094293 Ga0207687_100942932 210
387 3300025927 Ga0207687_10121722 Ga0207687_101217222 210
388 3300025927 Ga0207687_10176832 Ga0207687_101768323 210
389 3300025927 Ga0207687_10320074 Ga0207687_103200742 210
390 3300025927 Ga0207687_10348014 Ga0207687_103480142 210
391 3300025928 Ga0207700_10241177 Ga0207700_102411771 210
392 3300025928 Ga0207700_10496238 Ga0207700_104962382 210
393 3300025929 Ga0207664_10024650 Ga0207664_100246503 210
394 3300025929 Ga0207664_10044801 Ga0207664_100448013 210
395 3300025929 Ga0207664_10091945 Ga0207664_100919452 210
396 3300025929 Ga0207664_10146942 Ga0207664_101469422 210
397 3300025929 Ga0207664_10281634 Ga0207664_102816342 210
398 3300025929 Ga0207664_10554080 Ga0207664_105540802 210
399 3300025931 Ga0207644_10057090 Ga0207644_100570902 210
400 3300025932 Ga0207690_10016283 Ga0207690_100162832 210
401 3300025933 Ga0207706_10071647 Ga0207706_100716473 210
402 3300025934 Ga0207686_10001206 Ga0207686_1000120612 210
403 3300025935 Ga0207709_10003931 Ga0207709_100039312 210
404 3300025935 Ga0207709_10027468 Ga0207709_100274683 210
405 3300025935 Ga0207709_10298851 Ga0207709_102988512 210
406 3300025935 Ga0207709_10314913 Ga0207709_103149132 210
407 3300025935 Ga0207709_10364676 Ga0207709_103646761 210
408 3300025935 Ga0207709_10417379 Ga0207709_104173792 210
409 3300025936 Ga0207670_10248063 Ga0207670_102480632 210
410 3300025936 Ga0207670_10299454 Ga0207670_102994542 210
411 3300025937 Ga0207669_10002666 Ga0207669_100026667 210
412 3300025937 Ga0207669_10366272 Ga0207669_103662722 210
413 3300025937 Ga0207669_10573678 Ga0207669_105736782 210
414 3300025938 Ga0207704_10009850 Ga0207704_100098505 210
415 3300025939 Ga0207665_10005836 Ga0207665_100058362 210
416 3300025939 Ga0207665_10006154 Ga0207665_100061545 210
417 3300025940 Ga0207691_10002281 Ga0207691_100022812 210
418 3300025940 Ga0207691_10137105 Ga0207691_101371052 210
419 3300025941 Ga0207711_10054269 Ga0207711_100542693 210
420 3300025941 Ga0207711_10058617 Ga0207711_100586172 210
421 3300025941 Ga0207711_10391085 Ga0207711_103910852 210
422 3300025941 Ga0207711_10539737 Ga0207711_105397372 210
423 3300025942 Ga0207689_10122390 Ga0207689_101223903 210
424 3300025942 Ga0207689_10397848 Ga0207689_103978482 210
425 3300025944 Ga0207661_10079431 Ga0207661_100794312 210
426 3300025944 Ga0207661_10875230 Ga0207661_108752301 210
427 3300025945 Ga0207679_10211672 Ga0207679_102116723 210
428 3300025949 Ga0207667_10113528 Ga0207667_101135283 210
429 3300025949 Ga0207667_10251344 Ga0207667_102513442 210
430 3300025960 Ga0207651_10088119 Ga0207651_100881192 210
431 3300025960 Ga0207651_10470845 Ga0207651_104708452 210
432 3300025961 Ga0207712_10002308 Ga0207712_100023084 210
433 3300025961 Ga0207712_10003283 Ga0207712_100032839 210
434 3300025961 Ga0207712_10164844 Ga0207712_101648441 210
435 3300025961 Ga0207712_10221956 Ga0207712_102219562 210
436 3300025972 Ga0207668_10137283 Ga0207668_101372832 210
437 3300025981 Ga0207640_10128658 Ga0207640_101286583 210
438 3300025981 Ga0207640_10253849 Ga0207640_102538492 210
439 3300025981 Ga0207640_10380858 Ga0207640_103808582 210
440 3300025981 Ga0207640_10590376 Ga0207640_105903761 210
441 3300025981 Ga0207640_10735027 Ga0207640_107350272 210
442 3300025986 Ga0207658_10155201 Ga0207658_101552012 210
443 3300026023 Ga0207677_10059489 Ga0207677_100594892 210
444 3300026023 Ga0207677_10273528 Ga0207677_102735282 210
445 3300026035 Ga0207703_10152178 Ga0207703_101521782 210
446 3300026035 Ga0207703_10241664 Ga0207703_102416642 210
447 3300026035 Ga0207703_10543577 Ga0207703_105435772 210
448 3300026067 Ga0207678_10050160 Ga0207678_100501602 210
449 3300026067 Ga0207678_10105012 Ga0207678_101050122 210
450 3300026075 Ga0207708_10000370 Ga0207708_100003703 210
451 3300026075 Ga0207708_10004615 Ga0207708_100046155 210
452 3300026075 Ga0207708_10056212 Ga0207708_100562123 210
453 3300026078 Ga0207702_10002526 Ga0207702_1000252610 210
454 3300026078 Ga0207702_10039342 Ga0207702_100393422 210
455 3300026078 Ga0207702_10699333 Ga0207702_106993332 210
456 3300026078 Ga0207702_11175542 Ga0207702_111755421 210
457 3300026089 Ga0207648_10001656 Ga0207648_1000165611 210
458 3300026089 Ga0207648_10097415 Ga0207648_100974152 210
459 3300026089 Ga0207648_10171342 Ga0207648_101713423 210
460 3300026116 Ga0207674_10076445 Ga0207674_100764454 210
461 3300026118 Ga0207675_100001023 Ga0207675_10000102320 210
462 3300026118 Ga0207675_100022607 Ga0207675_1000226073 210
463 3300026118 Ga0207675_100060576 Ga0207675_1000605762 210
464 3300026118 Ga0207675_100226238 Ga0207675_1002262382 210
465 3300026121 Ga0207683_10000703 Ga0207683_1000070315 210
466 3300026121 Ga0207683_10009220 Ga0207683_100092203 210
467 3300026121 Ga0207683_10126376 Ga0207683_101263761 210
468 3300026121 Ga0207683_10143997 Ga0207683_101439973 210
469 3300026121 Ga0207683_10466671 Ga0207683_104666712 210
470 3300026142 Ga0207698_10038122 Ga0207698_100381223 210
471 3300026142 Ga0207698_10122567 Ga0207698_101225672 210
472 3300026142 Ga0207698_10892497 Ga0207698_108924971 210
473 3300027671 Ga0209588_1011697 Ga0209588_10116973 210
474 3300027907 Ga0207428_10040067 Ga0207428_100400674 210
475 3300027907 Ga0207428_10272174 Ga0207428_102721742 210
476 3300027907 Ga0207428_10394461 Ga0207428_103944612 210
477 3300028379 Ga0268266_10213335 Ga0268266_102133352 210
478 3300028380 Ga0268265_10143944 Ga0268265_101439442 210
479 3300028380 Ga0268265_10145349 Ga0268265_101453492 210
480 3300028381 Ga0268264_10055989 Ga0268264_100559892 210
481 3300028381 Ga0268264_10292317 Ga0268264_102923172 210
482 3300028381 Ga0268264_10292745 Ga0268264_102927452 210
483 3300028786 Ga0307517_10054449 Ga0307517_100544492 210
484 3300031456 Ga0307513_10608716 Ga0307513_106087162 210
485 3300034820 Ga0373959_0010858 Ga0373959_0010858_705_1379 210
486 3300034957 Ga0373938_0008959 Ga0373938_0008959_485_1159 210
487 3300035083 Ga0373926_0020889 Ga0373926_0020889_1223_1888 210
488 3300035089 Ga0373944_0032996 Ga0373944_0032996_541_1206 210
489 3300035090 Ga0373949_0007870 Ga0373949_0007870_707_1381 210
490 3300035091 Ga0373951_0009558 Ga0373951_0009558_415_1089 210
491 3300035092 Ga0373952_0007667 Ga0373952_0007667_531_1205 210
492 3300035112 Ga0373932_0013893 Ga0373932_0013893_581_1255 210
493 3300035115 Ga0373941_0025398 Ga0373941_0025398_938_1612 210
494 3300035121 Ga0373960_0096175 Ga0373960_0096175_212_889 210
495 3300035170 Ga0373943_0006763 Ga0373943_0006763_1062_1727 210
496 3300035171 Ga0373946_0116250 Ga0373946_0116250_346_1011 210
497 3300035241 Ga0373961_0022069 Ga0373961_0022069_881_1555 210
498 3300035242 Ga0373962_0065885 Ga0373962_0065885_158_832 210
499 3300035691 Ga0373931_0180667 Ga0373931_0180667_165_824 210
500 3300035695 Ga0373927_0121010 Ga0373927_0121010_217_882 210
501 3300035725 Ga0373947_0004379 Ga0373947_0004379_6647_7312 210
502 3300036401 Ga0373937_0759326 Ga0373937_0759326_204_863 210
503 3300037068 Ga0373925_0007097 Ga0373925_0007097_2414_3079 210
504 3300037068 Ga0373925_0548947 Ga0373925_0548947_219_878 210
505 3300045051 Ga0451576_1166587 Ga0451576_1166587_47_724 210
506 3300046452 Ga0495617_104559 Ga0495617_104559_103_780 210
507 3300046454 Ga0495592_0031672 Ga0495592_0031672_2903_3568 210
508 3300046455 Ga0495603_0000598 Ga0495603_0000598_9601_10260 210
509 3300046459 Ga0495629_0006073 Ga0495629_0006073_3660_4319 210
510 3300046459 Ga0495629_0027320 Ga0495629_0027320_656_1321 210
511 3300046461 Ga0495641_0008494 Ga0495641_0008494_5258_5923 210
512 3300046463 Ga0495653_0103112 Ga0495653_0103112_86_751 210
513 3300046472 Ga0495580_0014040 Ga0495580_0014040_1826_2491 210
514 3300046473 Ga0495582_0001037 Ga0495582_0001037_12172_12837 210
515 3300046475 Ga0495639_0005017 Ga0495639_0005017_2240_2905 210
516 3300046476 Ga0495662_0001596 Ga0495662_0001596_8726_9391 210
517 3300046491 Ga0495584_0125112 Ga0495584_0125112_302_955 210
518 3300046499 Ga0495594_0000152 Ga0495594_0000152_10507_11166 210
519 3300046499 Ga0495594_0282436 Ga0495594_0282436_98_757 210
520 3300046501 Ga0495607_0074576 Ga0495607_0074576_486_1163 210
521 3300046515 Ga0495620_0009203 Ga0495620_0009203_386_1045 210
522 3300046517 Ga0495630_0040708 Ga0495630_0040708_77_742 210
523 3300046517 Ga0495630_0105465 Ga0495630_0105465_1146_1811 210
524 3300046519 Ga0495632_0022092 Ga0495632_0022092_1762_2421 210
525 3300046520 Ga0495637_0070353 Ga0495637_0070353_454_1113 210
526 3300046522 Ga0495643_0005524 Ga0495643_0005524_1124_1783 210
527 3300046523 Ga0495644_0099882 Ga0495644_0099882_279_959 210
528 3300046526 Ga0495666_0005591 Ga0495666_0005591_4410_5075 210
529 3300046526 Ga0495666_0009431 Ga0495666_0009431_3765_4424 210
530 3300046531 Ga0495665_0006283 Ga0495665_0006283_483_1148 210
531 3300046533 Ga0495640_0032279 Ga0495640_0032279_2585_3250 210
532 3300046535 Ga0495586_0030816 Ga0495586_0030816_1907_2572 210
533 3300046543 Ga0495645_0258558 Ga0495645_0258558_246_911 210
534 3300046557 Ga0495622_0000291 Ga0495622_0000291_21967_22626 210
535 3300046559 Ga0495667_0071040 Ga0495667_0071040_283_948 210
536 3300046615 Ga0495656_0135992 Ga0495656_0135992_70_735 210
537 3300046664 Ga0495659_0048643 Ga0495659_0048643_387_1064 210
538 3300046664 Ga0495659_0106752 Ga0495659_0106752_344_1009 210
539 3300046678 Ga0495599_0268590 Ga0495599_0268590_146_811 210
540 3300046680 Ga0495646_0175064 Ga0495646_0175064_236_901 210
541 3300046681 Ga0495647_0000716 Ga0495647_0000716_1763_2428 210
542 3300046683 Ga0495658_0004324 Ga0495658_0004324_482_1147 210
543 3300046683 Ga0495658_0215409 Ga0495658_0215409_48_713 210
544 3300046689 Ga0495613_0004872 Ga0495613_0004872_9243_9902 210
545 3300046690 Ga0495624_0023521 Ga0495624_0023521_2136_2795 210
546 3300046690 Ga0495624_0046134 Ga0495624_0046134_1857_2522 210
547 3300046691 Ga0495670_0283235 Ga0495670_0283235_63_740 210
548 3300046692 Ga0495671_0217225 Ga0495671_0217225_32_742 210
549 3300046694 Ga0495649_0130661 Ga0495649_0130661_505_1164 210
550 3300046794 Ga0495589_0160956 Ga0495589_0160956_89_748 210
551 3300047315 Ga0495581_0008820 Ga0495581_0008820_2982_3647 210
552 3300047319 Ga0495674_0031944 Ga0495674_0031944_2577_3242 210
553 3300047319 Ga0495674_0060097 Ga0495674_0060097_784_1449 210
554 3300047319 Ga0495674_0240599 Ga0495674_0240599_319_984 210
555 3300047320 Ga0495672_0267083 Ga0495672_0267083_54_713 210
556 3300047321 Ga0495676_0000619 Ga0495676_0000619_20889_21548 210
557 3300047321 Ga0495676_0053837 Ga0495676_0053837_1261_1926 210
558 3300047323 Ga0495683_0022209 Ga0495683_0022209_763_1422 210
559 3300047443 Ga0495687_004680 Ga0495687_004680_4462_5121 210
560 3300047470 Ga0495681_0010923 Ga0495681_0010923_1465_2124 210
561 3300047673 Ga0495593_0007555 Ga0495593_0007555_3780_4445 210
562 3300048088 Ga0495602_0204919 Ga0495602_0204919_564_1253 210
563 3300048089 Ga0495614_0000555 Ga0495614_0000555_1388_2047 210
564 3300048089 Ga0495614_0004055 Ga0495614_0004055_5445_6110 210
565 3300048091 Ga0495626_0092082 Ga0495626_0092082_652_1311 210
566 3300048903 Ga0496100_0006109 Ga0496100_0006109_5595_6278 210
567 3300048903 Ga0496100_0015781 Ga0496100_0015781_2659_3336 210
568 3300048903 Ga0496100_0061036 Ga0496100_0061036_712_1377 210
569 3300048903 Ga0496100_0144801 Ga0496100_0144801_163_837 210
570 3300048903 Ga0496100_0413172 Ga0496100_0413172_304_966 210
571 3300048903 Ga0496100_0622723 Ga0496100_0622723_53_718 210
572 3300048904 Ga0496101_0001011 Ga0496101_0001011_15702_16367 210
573 3300048904 Ga0496101_0001309 Ga0496101_0001309_7459_8136 210
574 3300048904 Ga0496101_0012823 Ga0496101_0012823_1618_2283 210
575 3300048904 Ga0496101_0033450 Ga0496101_0033450_735_1409 210
576 3300048904 Ga0496101_0054251 Ga0496101_0054251_2189_2851 210
577 3300048904 Ga0496101_0088467 Ga0496101_0088467_804_1478 210
578 3300048904 Ga0496101_0170031 Ga0496101_0170031_483_1160 210
579 3300048904 Ga0496101_0185972 Ga0496101_0185972_687_1370 210
580 3300048904 Ga0496101_0229591 Ga0496101_0229591_727_1392 210
581 3300048905 Ga0496102_0003745 Ga0496102_0003745_2774_3457 210
582 3300048905 Ga0496102_0006061 Ga0496102_0006061_4168_4833 210
583 3300048905 Ga0496102_0016789 Ga0496102_0016789_3147_3812 210
584 3300048905 Ga0496102_0022931 Ga0496102_0022931_213_887 210
585 3300048905 Ga0496102_0047488 Ga0496102_0047488_2083_2745 210
586 3300048905 Ga0496102_0188174 Ga0496102_0188174_101_778 210
587 3300048905 Ga0496102_0355082 Ga0496102_0355082_124_789 210
588 3300048905 Ga0496102_0738420 Ga0496102_0738420_167_832 210
589 3300048905 Ga0496102_0851750 Ga0496102_0851750_107_766 210
590 3300048906 Ga0496103_0003723 Ga0496103_0003723_6018_6701 210
591 3300048906 Ga0496103_0009427 Ga0496103_0009427_3431_4105 210
592 3300048906 Ga0496103_0051436 Ga0496103_0051436_1831_2508 210
593 3300048906 Ga0496103_0080589 Ga0496103_0080589_128_793 210
594 3300048906 Ga0496103_0166566 Ga0496103_0166566_169_831 210
595 3300048907 Ga0496104_0000504 Ga0496104_0000504_26663_27328 210
596 3300048907 Ga0496104_0004535 Ga0496104_0004535_8787_9449 210
597 3300048907 Ga0496104_0008804 Ga0496104_0008804_2419_3087 210
598 3300048907 Ga0496104_0032463 Ga0496104_0032463_457_1131 210
599 3300048907 Ga0496104_0045978 Ga0496104_0045978_1009_1683 210
600 3300048907 Ga0496104_0098429 Ga0496104_0098429_615_1280 210
601 3300048907 Ga0496104_0444360 Ga0496104_0444360_272_955 210
602 3300048907 Ga0496104_0903256 Ga0496104_0903256_32_712 210
603 3300048908 Ga0496105_0052553 Ga0496105_0052553_1283_1951 210
604 3300048908 Ga0496105_0072489 Ga0496105_0072489_774_1448 210
605 3300048908 Ga0496105_0085161 Ga0496105_0085161_448_1131 210
606 3300048909 Ga0496106_0001207 Ga0496106_0001207_9465_10148 210
607 3300048909 Ga0496106_0005486 Ga0496106_0005486_1753_2418 210
608 3300048909 Ga0496106_0080320 Ga0496106_0080320_787_1449 210
609 3300048909 Ga0496106_0119329 Ga0496106_0119329_1255_1932 210
610 3300048909 Ga0496106_0195850 Ga0496106_0195850_498_1166 210
611 3300048909 Ga0496106_0206736 Ga0496106_0206736_817_1482 210
612 3300048909 Ga0496106_0207534 Ga0496106_0207534_451_1110 210
613 3300048910 Ga0496107_0001691 Ga0496107_0001691_12811_13494 210
614 3300048910 Ga0496107_0001719 Ga0496107_0001719_317_985 210
615 3300048910 Ga0496107_0007634 Ga0496107_0007634_948_1610 210
616 3300048910 Ga0496107_0011965 Ga0496107_0011965_740_1402 210
617 3300048910 Ga0496107_0015197 Ga0496107_0015197_152_817 210
618 3300048910 Ga0496107_0026101 Ga0496107_0026101_738_1427 210
619 3300048910 Ga0496107_0063786 Ga0496107_0063786_145_822 210
620 3300048910 Ga0496107_0065556 Ga0496107_0065556_1244_1918 210
621 3300048910 Ga0496107_0114715 Ga0496107_0114715_528_1193 210
622 3300048910 Ga0496107_0358768 Ga0496107_0358768_255_929 210
623 3300048911 Ga0496108_0011148 Ga0496108_0011148_5653_6327 210
624 3300048911 Ga0496108_0042143 Ga0496108_0042143_2806_3474 210
625 3300048911 Ga0496108_0048746 Ga0496108_0048746_1708_2367 210
626 3300048911 Ga0496108_0055349 Ga0496108_0055349_1399_2064 210
627 3300048911 Ga0496108_0171658 Ga0496108_0171658_442_1107 210
628 3300048911 Ga0496108_0888307 Ga0496108_0888307_80_742 210
629 3300048912 Ga0496109_0010571 Ga0496109_0010571_1444_2109 210
630 3300048912 Ga0496109_0012446 Ga0496109_0012446_2120_2800 210
631 3300048912 Ga0496109_0022799 Ga0496109_0022799_2425_3093 210
632 3300048912 Ga0496109_0109284 Ga0496109_0109284_628_1302 210
633 3300048912 Ga0496109_0161813 Ga0496109_0161813_949_1626 210
634 3300048912 Ga0496109_0580681 Ga0496109_0580681_223_882 210
635 3300048912 Ga0496109_0722084 Ga0496109_0722084_89_751 210
636 3300048913 Ga0496110_0007496 Ga0496110_0007496_4483_5151 210
637 3300048913 Ga0496110_0281207 Ga0496110_0281207_446_1123 210
638 3300048914 Ga0496111_0060985 Ga0496111_0060985_1314_1988 210
639 3300048914 Ga0496111_0122647 Ga0496111_0122647_876_1556 210
640 3300048914 Ga0496111_0253520 Ga0496111_0253520_155_814 210
641 3300048914 Ga0496111_0551425 Ga0496111_0551425_14_691 210
642 3300048915 Ga0496112_0076010 Ga0496112_0076010_988_1653 210
643 3300048915 Ga0496112_0151700 Ga0496112_0151700_348_1031 210
644 3300048915 Ga0496112_0229228 Ga0496112_0229228_157_831 210
645 3300048915 Ga0496112_0358341 Ga0496112_0358341_483_1163 210
646 3300048915 Ga0496112_0569465 Ga0496112_0569465_180_857 210
647 3300048916 Ga0496113_0078498 Ga0496113_0078498_1729_2394 210
648 3300048916 Ga0496113_0578546 Ga0496113_0578546_41_706 210
649 3300048917 Ga0496114_0001293 Ga0496114_0001293_12669_13352 210
650 3300048917 Ga0496114_0002456 Ga0496114_0002456_9315_9983 210
651 3300048917 Ga0496114_0005072 Ga0496114_0005072_3089_3751 210
652 3300048917 Ga0496114_0014102 Ga0496114_0014102_2203_2868 210
653 3300048917 Ga0496114_0057318 Ga0496114_0057318_2247_2912 210
654 3300048917 Ga0496114_0074261 Ga0496114_0074261_1888_2562 210
655 3300048917 Ga0496114_0208835 Ga0496114_0208835_703_1368 210
656 3300048917 Ga0496114_0241185 Ga0496114_0241185_316_990 210
657 3300048918 Ga0496115_0000227 Ga0496115_0000227_27729_28391 210
658 3300048918 Ga0496115_0000867 Ga0496115_0000867_16005_16670 210
659 3300048918 Ga0496115_0005762 Ga0496115_0005762_201_884 210
660 3300048918 Ga0496115_0009699 Ga0496115_0009699_6073_6741 210
661 3300048918 Ga0496115_0045364 Ga0496115_0045364_1451_2116 210
662 3300048918 Ga0496115_0102836 Ga0496115_0102836_1274_1948 210
663 3300048918 Ga0496115_0113090 Ga0496115_0113090_246_923 210
664 3300048918 Ga0496115_0385457 Ga0496115_0385457_201_878 210
665 3300048918 Ga0496115_0493958 Ga0496115_0493958_88_765 210
666 3300048929 Ga0496126_0082413 Ga0496126_0082413_1162_1821 210
667 3300049583 Ga0501067_0003444 Ga0501067_0003444_3040_3708 210
668 3300049584 Ga0501068_0136269 Ga0501068_0136269_388_1056 210
669 3300049585 Ga0501069_0001535 Ga0501069_0001535_5515_6183 210
670 3300050492 nmdc:mga0yw44_207261_c1 nmdc:mga0yw44_207261_c1_236_934 210
671 3300050507 nmdc:mga05p37_168613_c1 nmdc:mga05p37_168613_c1_653_1330 210
672 3300050507 nmdc:mga05p37_24796_c1 nmdc:mga05p37_24796_c1_1667_2362 210
673 3300050507 nmdc:mga05p37_290016_c1 nmdc:mga05p37_290016_c1_605_1258 210
674 3300050507 nmdc:mga05p37_356227_c1 nmdc:mga05p37_356227_c1_971_1636 210
675 3300050507 nmdc:mga05p37_481826_c1 nmdc:mga05p37_481826_c1_514_1179 210
676 3300050507 nmdc:mga05p37_5975_c1 nmdc:mga05p37_5975_c1_5772_6449 210
677 3300050507 nmdc:mga05p37_821736_c1 nmdc:mga05p37_821736_c1_261_926 210
678 3300050508 nmdc:mga09592_100092_c1 nmdc:mga09592_100092_c1_1688_2341 210
679 3300050508 nmdc:mga09592_266179_c1 nmdc:mga09592_266179_c1_328_993 210
680 3300050508 nmdc:mga09592_470914_c1 nmdc:mga09592_470914_c1_310_975 210
681 3300050508 nmdc:mga09592_635705_c1 nmdc:mga09592_635705_c1_66_719 210
682 3300050508 nmdc:mga09592_69793_c1 nmdc:mga09592_69793_c1_2016_2693 210
683 3300050508 nmdc:mga09592_99263_c1 nmdc:mga09592_99263_c1_1293_1988 210
684 3300050510 nmdc:mga06r32_33429_c1 nmdc:mga06r32_33429_c1_3111_3806 210
685 3300050510 nmdc:mga06r32_5648_c1 nmdc:mga06r32_5648_c1_4838_5515 210
686 3300050511 nmdc:mga08y16_188440_c1 nmdc:mga08y16_188440_c1_1391_2068 210
687 3300050511 nmdc:mga08y16_20726_c1 nmdc:mga08y16_20726_c1_1391_2068 210
688 3300050511 nmdc:mga08y16_58431_c1 nmdc:mga08y16_58431_c1_2822_3487 210
689 3300050511 nmdc:mga08y16_914685_c1 nmdc:mga08y16_914685_c1_74_739 210
690 3300050512 nmdc:mga0n895_157998_c1 nmdc:mga0n895_157998_c1_906_1583 210
691 3300050512 nmdc:mga0n895_17713_c1 nmdc:mga0n895_17713_c1_1160_1840 210
692 3300050512 nmdc:mga0n895_2041_c1 nmdc:mga0n895_2041_c1_619_1284 210
693 3300050512 nmdc:mga0n895_282700_c1 nmdc:mga0n895_282700_c1_331_993 210
694 3300050512 nmdc:mga0n895_360874_c1 nmdc:mga0n895_360874_c1_793_1458 210
695 3300050512 nmdc:mga0n895_45110_c1 nmdc:mga0n895_45110_c1_983_1630 210
696 3300050512 nmdc:mga0n895_466616_c1 nmdc:mga0n895_466616_c1_214_876 210
697 3300050512 nmdc:mga0n895_49212_c1 nmdc:mga0n895_49212_c1_2822_3487 210
698 3300050512 nmdc:mga0n895_71944_c1 nmdc:mga0n895_71944_c1_829_1494 210
699 3300050513 nmdc:mga0rr50_112785_c1 nmdc:mga0rr50_112785_c1_169_834 210
700 3300050513 nmdc:mga0rr50_138622_c1 nmdc:mga0rr50_138622_c1_19_699 210
701 3300050513 nmdc:mga0rr50_18740_c1 nmdc:mga0rr50_18740_c1_108_773 210
702 3300050513 nmdc:mga0rr50_325049_c1 nmdc:mga0rr50_325049_c1_272_961 210
703 3300050513 nmdc:mga0rr50_570_c1 nmdc:mga0rr50_570_c1_10449_11114 210
704 3300050513 nmdc:mga0rr50_592128_c1 nmdc:mga0rr50_592128_c1_136_801 210
705 3300050514 nmdc:mga08x19_100460_c1 nmdc:mga08x19_100460_c1_845_1510 210
706 3300050514 nmdc:mga08x19_126266_c1 nmdc:mga08x19_126266_c1_299_952 210
707 3300050514 nmdc:mga08x19_21664_c1 nmdc:mga08x19_21664_c1_2200_2865 210
708 3300050514 nmdc:mga08x19_9820_c1 nmdc:mga08x19_9820_c1_3780_4445 210
709 3300050515 nmdc:mga0a205_307063_c1 nmdc:mga0a205_307063_c1_211_876 210
710 3300050515 nmdc:mga0a205_325338_c1 nmdc:mga0a205_325338_c1_593_1246 210
711 3300050515 nmdc:mga0a205_386812_c1 nmdc:mga0a205_386812_c1_39_704 210
712 3300050515 nmdc:mga0a205_426513_c1 nmdc:mga0a205_426513_c1_163_828 210
713 3300050515 nmdc:mga0a205_431322_c1 nmdc:mga0a205_431322_c1_165_842 210
714 3300050515 nmdc:mga0a205_462629_c1 nmdc:mga0a205_462629_c1_80_742 210
715 3300050515 nmdc:mga0a205_908162_c1 nmdc:mga0a205_908162_c1_56_709 210
716 3300050516 nmdc:mga0sz30_18404_c2 nmdc:mga0sz30_18404_c2_1661_2323 210
717 3300053077 Ga0495601_0310265 Ga0495601_0310265_254_919 210
718 3300053085 Ga0495619_0022226 Ga0495619_0022226_2239_2904 210
719 3300053086 Ga0500578_0336132 Ga0500578_0336132_182_841 210
720 3300053090 Ga0500646_0054699 Ga0500646_0054699_362_1021 210
721 3300053092 Ga0500583_0206130 Ga0500583_0206130_244_903 210
722 3300053099 Ga0500654_121595 Ga0500654_121595_286_945 210
723 3300053109 Ga0500569_008074 Ga0500569_008074_501_1160 210
724 3300053137 Ga0500561_0014965 Ga0500561_0014965_766_1425 210
725 3300053153 Ga0500616_0033134 Ga0500616_0033134_1557_2216 210
726 3300053161 Ga0500634_0015437 Ga0500634_0015437_288_947 210
727 3300061734 Ga0530510_0062545 Ga0530510_0062545_208_876 210

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

13

171

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b34-assembly1.cif.gz_A structure of mar1 ribonuclease from caenorhabditis elegans 0.9456 9 189
1j2r-assembly1.cif.gz_A crystal structure of escherichia coli gene product yecd at 1.3 a resolution 0.9201 7 173
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.9047 7 202
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.8948 7 205
1x9g-assembly1.cif.gz_A putative mar1 ribonuclease from leishmania donovani 0.8925 8 188
ID Description Score Start End Superfamily
af_A0JME6_2_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9443 5 188 3.40.50.850
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9194 7 189 3.40.50.850
1j2rB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9144 10 169 3.40.50.850
af_Q54NZ8_2_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9126 5 198 3.40.50.850
af_Q54RC7_3_195_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8933 7 192 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A2V9PAZ2-F1-model_v4 Hydrolase 0.9911 41 165 GO:0016787
AF-A0A4R2JXE4-F1-model_v4 Nicotinamidase-related amidase 0.99 7 198
AF-A0A5J6IBJ0-F1-model_v4 Isochorismatase family protein 0.9882 7 199
AF-A0A442FYR2-F1-model_v4 Isochorismatase family protein 0.9882 9 158
AF-A0A1I4AVV4-F1-model_v4 Nicotinamidase-related amidase 0.988 7 198

Feature Viewer

pLDDT pTM Quality
94.84 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map