F477763
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 727 | 295 | 727 | 219 |
Family's Representative Sequence
| Representative Sequence | 3300048088|Ga0495602_0204919|Ga0495602_0204919_564_1253 |
| Length | 229 |
| Sequence | MTKDLGVWTADDCALVLIDYQKEMFEVIRSETSADLVEMNVRLLAKTAKAFDMPIVLSTVGVGAGFNGPTLPSILSELDGIEPIDRTSMNAFEDEAFSEAVKATGRKTGRRRLIIGGLHTEICLTFASVQALKNGYDVMYVADAVGGRSQAAHRTGIERLAHAGAVPTTALAVTTELFRDWAGPLAGPALDTIYWYFREIPKLTNEVGVADAEKGAAAAYAEQAAGAAH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 76 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 77 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 80 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 172 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 176 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 177 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 178 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 179 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 180 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 181 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 197 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 198 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 256 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 257 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 258 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 259 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 264 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 265 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 270 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 288 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 289 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 290 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 291 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 292 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 293 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 294 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.06 |
| Nodule | 0 |
| Rhizoplane | 14.31 |
| Rhizosphere | 83.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1011099 | 3300001978 | Bacteria | 908 |
| 2 | JGI24744J21845_10002897 | 3300002077 | Bacteria | 3509 |
| 3 | Ga0070676_10152643 | 3300005328 | Unclassified | 1480 |
| 4 | Ga0070683_100045356 | 3300005329 | Bacteria | 4057 |
| 5 | Ga0070683_100585434 | 3300005329 | Bacteria | 1067 |
| 6 | Ga0070690_100047336 | 3300005330 | Bacteria | 2736 |
| 7 | Ga0068869_100128600 | 3300005334 | Bacteria | 1945 |
| 8 | Ga0068869_100139105 | 3300005334 | Bacteria | 1873 |
| 9 | Ga0068869_100149733 | 3300005334 | Bacteria | 1809 |
| 10 | Ga0070680_100017805 | 3300005336 | Bacteria | 5604 |
| 11 | Ga0070680_100184222 | 3300005336 | Bacteria | 1759 |
| 12 | Ga0070680_100263589 | 3300005336 | Unclassified | 1458 |
| 13 | Ga0070682_100002394 | 3300005337 | Bacteria | 10393 |
| 14 | Ga0070682_100022994 | 3300005337 | Bacteria | 3699 |
| 15 | Ga0068868_100015516 | 3300005338 | Bacteria | 5636 |
| 16 | Ga0068868_100091883 | 3300005338 | Bacteria | 2446 |
| 17 | Ga0068868_100143253 | 3300005338 | Bacteria | 1963 |
| 18 | Ga0070660_100015317 | 3300005339 | Bacteria | 5534 |
| 19 | Ga0070691_10029496 | 3300005341 | Bacteria | 2566 |
| 20 | Ga0070691_10051628 | 3300005341 | Bacteria | 1964 |
| 21 | Ga0070687_100304868 | 3300005343 | Bacteria | 1012 |
| 22 | Ga0070687_100307732 | 3300005343 | Bacteria | 1008 |
| 23 | Ga0070687_100450535 | 3300005343 | Bacteria | 856 |
| 24 | Ga0070692_10095438 | 3300005345 | Bacteria | 1623 |
| 25 | Ga0070692_10262601 | 3300005345 | Bacteria | 1039 |
| 26 | Ga0070668_100023578 | 3300005347 | Bacteria | 4656 |
| 27 | Ga0070668_100248735 | 3300005347 | Bacteria | 1475 |
| 28 | Ga0070669_100120066 | 3300005353 | Bacteria | 2004 |
| 29 | Ga0070669_100184736 | 3300005353 | Bacteria | 1633 |
| 30 | Ga0070675_100546685 | 3300005354 | Bacteria | 1047 |
| 31 | Ga0070671_100048211 | 3300005355 | Bacteria | 3542 |
| 32 | Ga0070674_100064498 | 3300005356 | Bacteria | 2567 |
| 33 | Ga0070674_100646178 | 3300005356 | Bacteria | 899 |
| 34 | Ga0070673_100049553 | 3300005364 | Bacteria | 3280 |
| 35 | Ga0070673_100111277 | 3300005364 | Bacteria | 2272 |
| 36 | Ga0070688_100000841 | 3300005365 | Bacteria | 15211 |
| 37 | Ga0070659_100006905 | 3300005366 | Bacteria | 8219 |
| 38 | Ga0070659_100079438 | 3300005366 | Bacteria | 2618 |
| 39 | Ga0070667_100192770 | 3300005367 | Bacteria | 1806 |
| 40 | Ga0070709_10053899 | 3300005434 | Bacteria | 2533 |
| 41 | Ga0070709_10211278 | 3300005434 | Unclassified | 1379 |
| 42 | Ga0070714_100062419 | 3300005435 | Bacteria | 3203 |
| 43 | Ga0070714_100088687 | 3300005435 | Bacteria | 2707 |
| 44 | Ga0070714_100204689 | 3300005435 | Unclassified | 1807 |
| 45 | Ga0070714_100234252 | 3300005435 | Unclassified | 1692 |
| 46 | Ga0070714_100691230 | 3300005435 | Bacteria | 984 |
| 47 | Ga0070713_100631798 | 3300005436 | Bacteria | 1019 |
| 48 | Ga0070710_10014642 | 3300005437 | Bacteria | 3951 |
| 49 | Ga0070710_10242488 | 3300005437 | Unclassified | 1155 |
| 50 | Ga0070701_10012209 | 3300005438 | Bacteria | 3866 |
| 51 | Ga0070711_100047894 | 3300005439 | Bacteria | 2920 |
| 52 | Ga0070711_100053464 | 3300005439 | Bacteria | 2783 |
| 53 | Ga0070711_100093198 | 3300005439 | Bacteria | 2175 |
| 54 | Ga0070711_100094408 | 3300005439 | Bacteria | 2162 |
| 55 | Ga0070711_100179877 | 3300005439 | Bacteria | 1619 |
| 56 | Ga0070711_100455449 | 3300005439 | Bacteria | 1048 |
| 57 | Ga0070705_100022110 | 3300005440 | Bacteria | 3393 |
| 58 | Ga0070705_100114078 | 3300005440 | Bacteria | 1732 |
| 59 | Ga0070705_100397250 | 3300005440 | Bacteria | 1020 |
| 60 | Ga0070700_100001535 | 3300005441 | Bacteria | 11511 |
| 61 | Ga0070700_100034748 | 3300005441 | Bacteria | 3046 |
| 62 | Ga0070694_100172697 | 3300005444 | Bacteria | 1593 |
| 63 | Ga0070694_100223748 | 3300005444 | Bacteria | 1413 |
| 64 | Ga0070694_100322016 | 3300005444 | Bacteria | 1190 |
| 65 | Ga0070708_100066025 | 3300005445 | Bacteria | 3246 |
| 66 | Ga0070708_100075392 | 3300005445 | Bacteria | 3044 |
| 67 | Ga0070708_100657175 | 3300005445 | Unclassified | 988 |
| 68 | Ga0070663_100407715 | 3300005455 | Bacteria | 1112 |
| 69 | Ga0070678_100032322 | 3300005456 | Bacteria | 3621 |
| 70 | Ga0070678_100359491 | 3300005456 | Bacteria | 1254 |
| 71 | Ga0070662_100112084 | 3300005457 | Bacteria | 2079 |
| 72 | Ga0070662_100378597 | 3300005457 | Bacteria | 1165 |
| 73 | Ga0070681_10804985 | 3300005458 | Bacteria | 857 |
| 74 | Ga0068867_100001471 | 3300005459 | Bacteria | 16324 |
| 75 | Ga0068867_100046414 | 3300005459 | Bacteria | 3191 |
| 76 | Ga0070685_10014278 | 3300005466 | Bacteria | 4204 |
| 77 | Ga0070706_100068874 | 3300005467 | Bacteria | 3273 |
| 78 | Ga0070706_100107639 | 3300005467 | Bacteria | 2593 |
| 79 | Ga0070706_100202669 | 3300005467 | Bacteria | 1853 |
| 80 | Ga0070706_100960396 | 3300005467 | Unclassified | 789 |
| 81 | Ga0070707_100000511 | 3300005468 | Bacteria | 38643 |
| 82 | Ga0070707_100010774 | 3300005468 | Bacteria | 8515 |
| 83 | Ga0070707_100036478 | 3300005468 | Bacteria | 4691 |
| 84 | Ga0070707_100727335 | 3300005468 | Bacteria | 955 |
| 85 | Ga0070698_100055634 | 3300005471 | Bacteria | 4010 |
| 86 | Ga0070698_100079781 | 3300005471 | Bacteria | 3269 |
| 87 | Ga0070698_100110822 | 3300005471 | Bacteria | 2709 |
| 88 | Ga0070698_100177267 | 3300005471 | Bacteria | 2070 |
| 89 | Ga0070698_100472753 | 3300005471 | Bacteria | 1190 |
| 90 | Ga0070698_100520805 | 3300005471 | Bacteria | 1127 |
| 91 | Ga0070698_100625718 | 3300005471 | Bacteria | 1017 |
| 92 | Ga0070698_100840861 | 3300005471 | Unclassified | 863 |
| 93 | Ga0070699_100117274 | 3300005518 | Bacteria | 2340 |
| 94 | Ga0070679_100220661 | 3300005530 | Bacteria | 1857 |
| 95 | Ga0070684_100487010 | 3300005535 | Unclassified | 1142 |
| 96 | Ga0068853_100015572 | 3300005539 | Bacteria | 6247 |
| 97 | Ga0070672_100087676 | 3300005543 | Bacteria | 2505 |
| 98 | Ga0070672_100175644 | 3300005543 | Bacteria | 1783 |
| 99 | Ga0070686_100040736 | 3300005544 | Bacteria | 2899 |
| 100 | Ga0070686_100062901 | 3300005544 | Bacteria | 2402 |
| 101 | Ga0070686_100126938 | 3300005544 | Bacteria | 1759 |
| 102 | Ga0070686_100516901 | 3300005544 | Bacteria | 929 |
| 103 | Ga0070695_100093783 | 3300005545 | Bacteria | 2009 |
| 104 | Ga0070695_100099097 | 3300005545 | Bacteria | 1959 |
| 105 | Ga0070695_100165560 | 3300005545 | Bacteria | 1556 |
| 106 | Ga0070696_100006869 | 3300005546 | Bacteria | 7595 |
| 107 | Ga0070696_100122627 | 3300005546 | Bacteria | 1882 |
| 108 | Ga0070696_100174785 | 3300005546 | Bacteria | 1590 |
| 109 | Ga0070696_100211759 | 3300005546 | Bacteria | 1451 |
| 110 | Ga0070696_100391987 | 3300005546 | Bacteria | 1084 |
| 111 | Ga0070693_100001834 | 3300005547 | Bacteria | 9700 |
| 112 | Ga0070693_100005402 | 3300005547 | Bacteria | 6130 |
| 113 | Ga0070693_100170598 | 3300005547 | Unclassified | 1393 |
| 114 | Ga0070693_100480409 | 3300005547 | Unclassified | 878 |
| 115 | Ga0070665_100095068 | 3300005548 | Bacteria | 2984 |
| 116 | Ga0070704_100014179 | 3300005549 | Bacteria | 4972 |
| 117 | Ga0070704_100086782 | 3300005549 | Bacteria | 2320 |
| 118 | Ga0070704_100318175 | 3300005549 | Bacteria | 1303 |
| 119 | Ga0068855_100156311 | 3300005563 | Bacteria | 2590 |
| 120 | Ga0070664_100502036 | 3300005564 | Bacteria | 1118 |
| 121 | Ga0068854_100391247 | 3300005578 | Bacteria | 1148 |
| 122 | Ga0068854_100437271 | 3300005578 | Bacteria | 1090 |
| 123 | Ga0068854_100663004 | 3300005578 | Bacteria | 897 |
| 124 | Ga0068856_100002969 | 3300005614 | Bacteria | 17381 |
| 125 | Ga0068856_100021597 | 3300005614 | Bacteria | 6256 |
| 126 | Ga0068856_100321475 | 3300005614 | Bacteria | 1564 |
| 127 | Ga0068856_100415054 | 3300005614 | Bacteria | 1366 |
| 128 | Ga0070702_100000676 | 3300005615 | Bacteria | 12792 |
| 129 | Ga0070702_100026855 | 3300005615 | Bacteria | 3099 |
| 130 | Ga0070702_100259934 | 3300005615 | Bacteria | 1181 |
| 131 | Ga0068852_100054409 | 3300005616 | Bacteria | 3450 |
| 132 | Ga0068864_100410839 | 3300005618 | Bacteria | 1288 |
| 133 | Ga0068864_100778555 | 3300005618 | Bacteria | 939 |
| 134 | Ga0068866_10000624 | 3300005718 | Bacteria | 16096 |
| 135 | Ga0068866_10006504 | 3300005718 | Bacteria | 4870 |
| 136 | Ga0068866_10235318 | 3300005718 | Bacteria | 1113 |
| 137 | Ga0068866_10428718 | 3300005718 | Bacteria | 859 |
| 138 | Ga0068861_100030702 | 3300005719 | Bacteria | 3941 |
| 139 | Ga0068861_100065512 | 3300005719 | Bacteria | 2799 |
| 140 | Ga0068863_100135083 | 3300005841 | Bacteria | 2356 |
| 141 | Ga0068858_100276448 | 3300005842 | Bacteria | 1599 |
| 142 | Ga0068858_100592589 | 3300005842 | Bacteria | 1075 |
| 143 | Ga0068862_100128195 | 3300005844 | Bacteria | 2242 |
| 144 | Ga0068862_100217476 | 3300005844 | Bacteria | 1729 |
| 145 | Ga0068862_100268120 | 3300005844 | Bacteria | 1561 |
| 146 | Ga0068862_100333842 | 3300005844 | Bacteria | 1402 |
| 147 | Ga0081455_10101542 | 3300005937 | Bacteria | 2308 |
| 148 | Ga0070717_10067652 | 3300006028 | Bacteria | 2972 |
| 149 | Ga0070717_10162570 | 3300006028 | Archaea | 1937 |
| 150 | Ga0070717_10228285 | 3300006028 | Bacteria | 1638 |
| 151 | Ga0070717_10385834 | 3300006028 | Bacteria | 1257 |
| 152 | Ga0075365_10058973 | 3300006038 | Bacteria | 2557 |
| 153 | Ga0075365_10438967 | 3300006038 | Unclassified | 922 |
| 154 | Ga0075364_10023067 | 3300006051 | Bacteria | 3938 |
| 155 | Ga0070715_10000737 | 3300006163 | Bacteria | 8827 |
| 156 | Ga0070715_10008584 | 3300006163 | Bacteria | 3565 |
| 157 | Ga0070715_10096148 | 3300006163 | Bacteria | 1373 |
| 158 | Ga0070716_100144365 | 3300006173 | Bacteria | 1522 |
| 159 | Ga0070716_100166006 | 3300006173 | Bacteria | 1436 |
| 160 | Ga0070716_100231052 | 3300006173 | Unclassified | 1249 |
| 161 | Ga0070716_100282711 | 3300006173 | Bacteria | 1146 |
| 162 | Ga0070712_100042581 | 3300006175 | Bacteria | 3123 |
| 163 | Ga0070712_100141993 | 3300006175 | Bacteria | 1834 |
| 164 | Ga0070712_100211879 | 3300006175 | Bacteria | 1528 |
| 165 | Ga0070712_100612711 | 3300006175 | Archaea | 922 |
| 166 | Ga0075362_10079471 | 3300006177 | Bacteria | 1510 |
| 167 | Ga0075369_10166176 | 3300006186 | Unclassified | 1012 |
| 168 | Ga0097621_100004541 | 3300006237 | Bacteria | 9680 |
| 169 | Ga0097621_100016827 | 3300006237 | Bacteria | 5540 |
| 170 | Ga0097621_100586079 | 3300006237 | Bacteria | 1018 |
| 171 | Ga0068871_100127102 | 3300006358 | Bacteria | 2158 |
| 172 | Ga0068871_100643936 | 3300006358 | Bacteria | 967 |
| 173 | Ga0075428_100006760 | 3300006844 | Bacteria | 12759 |
| 174 | Ga0075428_100367704 | 3300006844 | Archaea | 1542 |
| 175 | Ga0075428_100373574 | 3300006844 | Unclassified | 1529 |
| 176 | Ga0075430_100558903 | 3300006846 | Bacteria | 944 |
| 177 | Ga0075431_100003951 | 3300006847 | Bacteria | 14441 |
| 178 | Ga0075431_100066582 | 3300006847 | Bacteria | 3719 |
| 179 | Ga0075431_100956357 | 3300006847 | Bacteria | 825 |
| 180 | Ga0075433_10002301 | 3300006852 | Bacteria | 14554 |
| 181 | Ga0075433_10280987 | 3300006852 | Bacteria | 1475 |
| 182 | Ga0075433_10339193 | 3300006852 | Unclassified | 1328 |
| 183 | Ga0075433_10374880 | 3300006852 | Bacteria | 1256 |
| 184 | Ga0075433_10529448 | 3300006852 | Unclassified | 1037 |
| 185 | Ga0075433_10535015 | 3300006852 | Bacteria | 1030 |
| 186 | Ga0075433_10553039 | 3300006852 | Unclassified | 1012 |
| 187 | Ga0075433_10620596 | 3300006852 | Unclassified | 948 |
| 188 | Ga0075434_100001735 | 3300006871 | Bacteria | 18707 |
| 189 | Ga0075434_100002903 | 3300006871 | Bacteria | 15214 |
| 190 | Ga0075434_100005482 | 3300006871 | Bacteria | 11557 |
| 191 | Ga0075434_100035540 | 3300006871 | Bacteria | 4926 |
| 192 | Ga0075434_100046968 | 3300006871 | Bacteria | 4285 |
| 193 | Ga0075434_100070137 | 3300006871 | Unclassified | 3495 |
| 194 | Ga0075434_100224654 | 3300006871 | Bacteria | 1897 |
| 195 | Ga0075434_100467377 | 3300006871 | Bacteria | 1283 |
| 196 | Ga0075429_100183696 | 3300006880 | Bacteria | 1832 |
| 197 | Ga0068865_100001271 | 3300006881 | Bacteria | 14687 |
| 198 | Ga0068865_100156395 | 3300006881 | Bacteria | 1734 |
| 199 | Ga0075436_100003584 | 3300006914 | Bacteria | 10635 |
| 200 | Ga0075436_100058845 | 3300006914 | Bacteria | 2654 |
| 201 | Ga0075436_100115273 | 3300006914 | Bacteria | 1877 |
| 202 | Ga0075436_100277829 | 3300006914 | Unclassified | 1197 |
| 203 | Ga0075436_100314915 | 3300006914 | Bacteria | 1123 |
| 204 | Ga0097620_100942440 | 3300006931 | Bacteria | 947 |
| 205 | Ga0075435_100000284 | 3300007076 | Bacteria | 31543 |
| 206 | Ga0075435_100001809 | 3300007076 | Bacteria | 13908 |
| 207 | Ga0075435_100226689 | 3300007076 | Bacteria | 1587 |
| 208 | Ga0105250_10077542 | 3300009092 | Bacteria | 1345 |
| 209 | Ga0105240_10826936 | 3300009093 | Unclassified | 1001 |
| 210 | Ga0111539_10073102 | 3300009094 | Bacteria | 4043 |
| 211 | Ga0111539_10117237 | 3300009094 | Bacteria | 3121 |
| 212 | Ga0111539_10641969 | 3300009094 | Bacteria | 1236 |
| 213 | Ga0111539_11380715 | 3300009094 | Bacteria | 817 |
| 214 | Ga0105245_10002220 | 3300009098 | Bacteria | 17580 |
| 215 | Ga0105245_10012223 | 3300009098 | Bacteria | 7469 |
| 216 | Ga0105245_10016423 | 3300009098 | Bacteria | 6457 |
| 217 | Ga0105245_10016536 | 3300009098 | Bacteria | 6437 |
| 218 | Ga0105245_10023158 | 3300009098 | Bacteria | 5450 |
| 219 | Ga0105245_10055949 | 3300009098 | Bacteria | 3545 |
| 220 | Ga0105245_10086114 | 3300009098 | Bacteria | 2881 |
| 221 | Ga0105245_10185932 | 3300009098 | Bacteria | 1988 |
| 222 | Ga0105245_10205405 | 3300009098 | Bacteria | 1893 |
| 223 | Ga0105245_10410868 | 3300009098 | Bacteria | 1355 |
| 224 | Ga0105245_10528407 | 3300009098 | Bacteria | 1199 |
| 225 | Ga0105245_11112498 | 3300009098 | Bacteria | 836 |
| 226 | Ga0105247_10009237 | 3300009101 | Bacteria | 5992 |
| 227 | Ga0105247_10135380 | 3300009101 | Bacteria | 1609 |
| 228 | Ga0105247_10295955 | 3300009101 | Bacteria | 1121 |
| 229 | Ga0114129_10028492 | 3300009147 | Bacteria | 7914 |
| 230 | Ga0114129_10048033 | 3300009147 | Bacteria | 5997 |
| 231 | Ga0114129_10206852 | 3300009147 | Bacteria | 2655 |
| 232 | Ga0114129_10336450 | 3300009147 | Bacteria | 2003 |
| 233 | Ga0114129_10339024 | 3300009147 | Bacteria | 1994 |
| 234 | Ga0114129_11032202 | 3300009147 | Bacteria | 1033 |
| 235 | Ga0105243_10002337 | 3300009148 | Bacteria | 15873 |
| 236 | Ga0105243_10082229 | 3300009148 | Bacteria | 2632 |
| 237 | Ga0105243_10245984 | 3300009148 | Bacteria | 1594 |
| 238 | Ga0105243_10324090 | 3300009148 | Bacteria | 1405 |
| 239 | Ga0105241_10032280 | 3300009174 | Bacteria | 3924 |
| 240 | Ga0105241_10035308 | 3300009174 | Bacteria | 3760 |
| 241 | Ga0105241_10961496 | 3300009174 | Bacteria | 797 |
| 242 | Ga0105242_10000857 | 3300009176 | Bacteria | 23571 |
| 243 | Ga0105242_10063325 | 3300009176 | Bacteria | 3045 |
| 244 | Ga0105242_10160149 | 3300009176 | Bacteria | 1969 |
| 245 | Ga0105242_10241727 | 3300009176 | Bacteria | 1623 |
| 246 | Ga0105242_10542559 | 3300009176 | Bacteria | 1113 |
| 247 | Ga0105242_10602054 | 3300009176 | Bacteria | 1062 |
| 248 | Ga0105242_10756665 | 3300009176 | Bacteria | 957 |
| 249 | Ga0105248_10016269 | 3300009177 | Bacteria | 8188 |
| 250 | Ga0105248_10028019 | 3300009177 | Bacteria | 6274 |
| 251 | Ga0105248_10757073 | 3300009177 | Unclassified | 1096 |
| 252 | Ga0105237_10532120 | 3300009545 | Bacteria | 1182 |
| 253 | Ga0105249_10005899 | 3300009553 | Bacteria | 10602 |
| 254 | Ga0105249_10010239 | 3300009553 | Bacteria | 8235 |
| 255 | Ga0105249_10118624 | 3300009553 | Bacteria | 2511 |
| 256 | Ga0105249_10165713 | 3300009553 | Bacteria | 2139 |
| 257 | Ga0105239_10016348 | 3300010375 | Bacteria | 8205 |
| 258 | Ga0105239_10068167 | 3300010375 | Bacteria | 3910 |
| 259 | Ga0105239_10221523 | 3300010375 | Bacteria | 2122 |
| 260 | Ga0105239_10274783 | 3300010375 | Bacteria | 1896 |
| 261 | Ga0105239_10365628 | 3300010375 | Bacteria | 1630 |
| 262 | Ga0105239_10448867 | 3300010375 | Bacteria | 1463 |
| 263 | Ga0105239_10483589 | 3300010375 | Bacteria | 1407 |
| 264 | Ga0105239_11296706 | 3300010375 | Unclassified | 840 |
| 265 | Ga0105246_10014865 | 3300011119 | Bacteria | 4903 |
| 266 | Ga0105246_10048970 | 3300011119 | Bacteria | 2891 |
| 267 | Ga0105246_10097548 | 3300011119 | Bacteria | 2133 |
| 268 | Ga0105246_10695907 | 3300011119 | Unclassified | 890 |
| 269 | Ga0157326_1003426 | 3300012513 | Bacteria | 1669 |
| 270 | Ga0157373_10035036 | 3300013100 | Bacteria | 3605 |
| 271 | Ga0157371_10382498 | 3300013102 | Archaea | 1028 |
| 272 | Ga0157370_10727876 | 3300013104 | Bacteria | 905 |
| 273 | Ga0157374_10027019 | 3300013296 | Bacteria | 5170 |
| 274 | Ga0157374_10755389 | 3300013296 | Bacteria | 987 |
| 275 | Ga0157374_11282337 | 3300013296 | Archaea | 754 |
| 276 | Ga0157378_10003292 | 3300013297 | Bacteria | 14378 |
| 277 | Ga0157378_10313731 | 3300013297 | Bacteria | 1521 |
| 278 | Ga0157378_10392079 | 3300013297 | Bacteria | 1366 |
| 279 | Ga0157378_10668191 | 3300013297 | Bacteria | 1056 |
| 280 | Ga0157378_11109492 | 3300013297 | Archaea | 828 |
| 281 | Ga0163162_10021368 | 3300013306 | Bacteria | 6372 |
| 282 | Ga0163162_10147406 | 3300013306 | Bacteria | 2470 |
| 283 | Ga0163162_10512157 | 3300013306 | Bacteria | 1330 |
| 284 | Ga0157372_10136991 | 3300013307 | Bacteria | 2820 |
| 285 | Ga0157372_10825895 | 3300013307 | Bacteria | 1076 |
| 286 | Ga0157372_11256138 | 3300013307 | Archaea | 855 |
| 287 | Ga0157375_10297863 | 3300013308 | Bacteria | 1776 |
| 288 | Ga0157375_10320764 | 3300013308 | Bacteria | 1714 |
| 289 | Ga0157375_11602502 | 3300013308 | Unclassified | 770 |
| 290 | Ga0163163_10933068 | 3300014325 | Bacteria | 931 |
| 291 | Ga0157380_10249533 | 3300014326 | Bacteria | 1606 |
| 292 | Ga0157380_10266617 | 3300014326 | Bacteria | 1559 |
| 293 | Ga0157380_10443939 | 3300014326 | Bacteria | 1244 |
| 294 | Ga0157377_10005732 | 3300014745 | Bacteria | 5859 |
| 295 | Ga0157377_10223984 | 3300014745 | Bacteria | 1206 |
| 296 | Ga0157377_10273523 | 3300014745 | Archaea | 1104 |
| 297 | Ga0157379_10466959 | 3300014968 | Bacteria | 1167 |
| 298 | Ga0157379_11060156 | 3300014968 | Bacteria | 775 |
| 299 | Ga0157376_10003946 | 3300014969 | Bacteria | 10263 |
| 300 | Ga0157376_10220390 | 3300014969 | Bacteria | 1757 |
| 301 | Ga0157376_10249571 | 3300014969 | Bacteria | 1657 |
| 302 | Ga0163161_10261123 | 3300017792 | Bacteria | 1353 |
| 303 | Ga0163161_10641014 | 3300017792 | Bacteria | 879 |
| 304 | Ga0163161_10666384 | 3300017792 | Unclassified | 863 |
| 305 | Ga0163161_10750433 | 3300017792 | Bacteria | 816 |
| 306 | Ga0207653_10003551 | 3300025885 | Bacteria | 4909 |
| 307 | Ga0207692_10008001 | 3300025898 | Bacteria | 4361 |
| 308 | Ga0207692_10013934 | 3300025898 | Bacteria | 3501 |
| 309 | Ga0207692_10265080 | 3300025898 | Bacteria | 1034 |
| 310 | Ga0207692_10377971 | 3300025898 | Bacteria | 879 |
| 311 | Ga0207642_10210609 | 3300025899 | Bacteria | 1080 |
| 312 | Ga0207710_10066670 | 3300025900 | Bacteria | 1643 |
| 313 | Ga0207710_10198273 | 3300025900 | Bacteria | 991 |
| 314 | Ga0207688_10014915 | 3300025901 | Bacteria | 4216 |
| 315 | Ga0207688_10089866 | 3300025901 | Bacteria | 1763 |
| 316 | Ga0207680_10066300 | 3300025903 | Bacteria | 2220 |
| 317 | Ga0207680_10234876 | 3300025903 | Bacteria | 1261 |
| 318 | Ga0207647_10063868 | 3300025904 | Bacteria | 2238 |
| 319 | Ga0207685_10008451 | 3300025905 | Bacteria | 2932 |
| 320 | Ga0207699_10012576 | 3300025906 | Bacteria | 4308 |
| 321 | Ga0207699_10491786 | 3300025906 | Bacteria | 885 |
| 322 | Ga0207643_10204730 | 3300025908 | Bacteria | 1203 |
| 323 | Ga0207684_10185627 | 3300025910 | Unclassified | 1793 |
| 324 | Ga0207684_10272202 | 3300025910 | Unclassified | 1461 |
| 325 | Ga0207684_10337454 | 3300025910 | Unclassified | 1298 |
| 326 | Ga0207684_10350354 | 3300025910 | Bacteria | 1271 |
| 327 | Ga0207684_10586701 | 3300025910 | Bacteria | 952 |
| 328 | Ga0207707_10567686 | 3300025912 | Bacteria | 963 |
| 329 | Ga0207671_10205883 | 3300025914 | Bacteria | 1538 |
| 330 | Ga0207693_10001284 | 3300025915 | Bacteria | 22326 |
| 331 | Ga0207693_10006504 | 3300025915 | Bacteria | 9674 |
| 332 | Ga0207693_10032035 | 3300025915 | Bacteria | 4151 |
| 333 | Ga0207693_10037393 | 3300025915 | Bacteria | 3826 |
| 334 | Ga0207693_10052145 | 3300025915 | Bacteria | 3209 |
| 335 | Ga0207693_10060055 | 3300025915 | Unclassified | 2979 |
| 336 | Ga0207693_10121881 | 3300025915 | Bacteria | 2048 |
| 337 | Ga0207693_10140687 | 3300025915 | Bacteria | 1898 |
| 338 | Ga0207693_10157315 | 3300025915 | Bacteria | 1787 |
| 339 | Ga0207693_10221563 | 3300025915 | Bacteria | 1486 |
| 340 | Ga0207663_10025979 | 3300025916 | Bacteria | 3393 |
| 341 | Ga0207663_10028628 | 3300025916 | Bacteria | 3263 |
| 342 | Ga0207663_10090891 | 3300025916 | Bacteria | 2025 |
| 343 | Ga0207663_10405656 | 3300025916 | Unclassified | 1043 |
| 344 | Ga0207663_10405703 | 3300025916 | Bacteria | 1043 |
| 345 | Ga0207663_10482980 | 3300025916 | Bacteria | 960 |
| 346 | Ga0207660_10005533 | 3300025917 | Bacteria | 8206 |
| 347 | Ga0207660_10050742 | 3300025917 | Bacteria | 2947 |
| 348 | Ga0207660_10311713 | 3300025917 | Bacteria | 1255 |
| 349 | Ga0207662_10072910 | 3300025918 | Bacteria | 2082 |
| 350 | Ga0207662_10226124 | 3300025918 | Bacteria | 1220 |
| 351 | Ga0207662_10277881 | 3300025918 | Bacteria | 1107 |
| 352 | Ga0207657_10018059 | 3300025919 | Bacteria | 6748 |
| 353 | Ga0207657_10138556 | 3300025919 | Bacteria | 1989 |
| 354 | Ga0207657_10217456 | 3300025919 | Bacteria | 1532 |
| 355 | Ga0207646_10008723 | 3300025922 | Bacteria | 10116 |
| 356 | Ga0207646_10073582 | 3300025922 | Bacteria | 3052 |
| 357 | Ga0207646_10456857 | 3300025922 | Bacteria | 1152 |
| 358 | Ga0207646_10509993 | 3300025922 | Unclassified | 1083 |
| 359 | Ga0207681_10062821 | 3300025923 | Bacteria | 2559 |
| 360 | Ga0207681_10272223 | 3300025923 | Bacteria | 1330 |
| 361 | Ga0207694_10052561 | 3300025924 | Bacteria | 3158 |
| 362 | Ga0207659_10062826 | 3300025926 | Bacteria | 2682 |
| 363 | Ga0207687_10008519 | 3300025927 | Bacteria | 6705 |
| 364 | Ga0207687_10020128 | 3300025927 | Bacteria | 4425 |
| 365 | Ga0207687_10020967 | 3300025927 | Bacteria | 4338 |
| 366 | Ga0207687_10069743 | 3300025927 | Bacteria | 2508 |
| 367 | Ga0207687_10094293 | 3300025927 | Bacteria | 2190 |
| 368 | Ga0207687_10121722 | 3300025927 | Bacteria | 1952 |
| 369 | Ga0207687_10176832 | 3300025927 | Bacteria | 1650 |
| 370 | Ga0207687_10320074 | 3300025927 | Bacteria | 1255 |
| 371 | Ga0207687_10348014 | 3300025927 | Bacteria | 1207 |
| 372 | Ga0207700_10241177 | 3300025928 | Bacteria | 1541 |
| 373 | Ga0207700_10496238 | 3300025928 | Bacteria | 1080 |
| 374 | Ga0207664_10024650 | 3300025929 | Bacteria | 4522 |
| 375 | Ga0207664_10044801 | 3300025929 | Bacteria | 3466 |
| 376 | Ga0207664_10091945 | 3300025929 | Bacteria | 2489 |
| 377 | Ga0207664_10146942 | 3300025929 | Bacteria | 2000 |
| 378 | Ga0207664_10281634 | 3300025929 | Unclassified | 1459 |
| 379 | Ga0207664_10554080 | 3300025929 | Bacteria | 1032 |
| 380 | Ga0207644_10057090 | 3300025931 | Bacteria | 2818 |
| 381 | Ga0207690_10016283 | 3300025932 | Bacteria | 4520 |
| 382 | Ga0207706_10071647 | 3300025933 | Bacteria | 3048 |
| 383 | Ga0207686_10001206 | 3300025934 | Bacteria | 14994 |
| 384 | Ga0207709_10003931 | 3300025935 | Bacteria | 8678 |
| 385 | Ga0207709_10027468 | 3300025935 | Bacteria | 3279 |
| 386 | Ga0207709_10298851 | 3300025935 | Bacteria | 1196 |
| 387 | Ga0207709_10314913 | 3300025935 | Bacteria | 1169 |
| 388 | Ga0207709_10364676 | 3300025935 | Unclassified | 1095 |
| 389 | Ga0207709_10417379 | 3300025935 | Bacteria | 1030 |
| 390 | Ga0207670_10248063 | 3300025936 | Bacteria | 1375 |
| 391 | Ga0207670_10299454 | 3300025936 | Bacteria | 1259 |
| 392 | Ga0207669_10002666 | 3300025937 | Bacteria | 7642 |
| 393 | Ga0207669_10366272 | 3300025937 | Bacteria | 1119 |
| 394 | Ga0207669_10573678 | 3300025937 | Bacteria | 913 |
| 395 | Ga0207704_10009850 | 3300025938 | Bacteria | 4631 |
| 396 | Ga0207665_10005836 | 3300025939 | Bacteria | 8191 |
| 397 | Ga0207665_10006154 | 3300025939 | Bacteria | 7969 |
| 398 | Ga0207691_10002281 | 3300025940 | Bacteria | 18781 |
| 399 | Ga0207691_10137105 | 3300025940 | Bacteria | 2158 |
| 400 | Ga0207711_10054269 | 3300025941 | Bacteria | 3439 |
| 401 | Ga0207711_10058617 | 3300025941 | Bacteria | 3314 |
| 402 | Ga0207711_10391085 | 3300025941 | Bacteria | 1291 |
| 403 | Ga0207711_10539737 | 3300025941 | Bacteria | 1088 |
| 404 | Ga0207689_10122390 | 3300025942 | Unclassified | 2140 |
| 405 | Ga0207689_10397848 | 3300025942 | Bacteria | 1148 |
| 406 | Ga0207661_10079431 | 3300025944 | Bacteria | 2704 |
| 407 | Ga0207661_10875230 | 3300025944 | Bacteria | 827 |
| 408 | Ga0207679_10211672 | 3300025945 | Bacteria | 1626 |
| 409 | Ga0207667_10113528 | 3300025949 | Bacteria | 2793 |
| 410 | Ga0207667_10251344 | 3300025949 | Unclassified | 1808 |
| 411 | Ga0207651_10088119 | 3300025960 | Bacteria | 2262 |
| 412 | Ga0207651_10470845 | 3300025960 | Bacteria | 1081 |
| 413 | Ga0207712_10002308 | 3300025961 | Bacteria | 12387 |
| 414 | Ga0207712_10003283 | 3300025961 | Bacteria | 10260 |
| 415 | Ga0207712_10164844 | 3300025961 | Bacteria | 1726 |
| 416 | Ga0207712_10221956 | 3300025961 | Bacteria | 1511 |
| 417 | Ga0207668_10137283 | 3300025972 | Bacteria | 1875 |
| 418 | Ga0207640_10128658 | 3300025981 | Bacteria | 1827 |
| 419 | Ga0207640_10253849 | 3300025981 | Bacteria | 1366 |
| 420 | Ga0207640_10380858 | 3300025981 | Bacteria | 1143 |
| 421 | Ga0207640_10590376 | 3300025981 | Bacteria | 939 |
| 422 | Ga0207640_10735027 | 3300025981 | Unclassified | 849 |
| 423 | Ga0207658_10155201 | 3300025986 | Bacteria | 1870 |
| 424 | Ga0207677_10059489 | 3300026023 | Bacteria | 2635 |
| 425 | Ga0207677_10273528 | 3300026023 | Bacteria | 1383 |
| 426 | Ga0207703_10152178 | 3300026035 | Bacteria | 2018 |
| 427 | Ga0207703_10241664 | 3300026035 | Unclassified | 1624 |
| 428 | Ga0207703_10543577 | 3300026035 | Bacteria | 1095 |
| 429 | Ga0207678_10050160 | 3300026067 | Bacteria | 3606 |
| 430 | Ga0207678_10105012 | 3300026067 | Bacteria | 2410 |
| 431 | Ga0207708_10000370 | 3300026075 | Bacteria | 35189 |
| 432 | Ga0207708_10004615 | 3300026075 | Bacteria | 10141 |
| 433 | Ga0207708_10056212 | 3300026075 | Bacteria | 3002 |
| 434 | Ga0207702_10002526 | 3300026078 | Bacteria | 17233 |
| 435 | Ga0207702_10039342 | 3300026078 | Bacteria | 3961 |
| 436 | Ga0207702_10699333 | 3300026078 | Bacteria | 999 |
| 437 | Ga0207702_11175542 | 3300026078 | Bacteria | 761 |
| 438 | Ga0207648_10001656 | 3300026089 | Bacteria | 24400 |
| 439 | Ga0207648_10097415 | 3300026089 | Bacteria | 2574 |
| 440 | Ga0207648_10171342 | 3300026089 | Bacteria | 1919 |
| 441 | Ga0207674_10076445 | 3300026116 | Bacteria | 3356 |
| 442 | Ga0207675_100001023 | 3300026118 | Bacteria | 27745 |
| 443 | Ga0207675_100022607 | 3300026118 | Bacteria | 5854 |
| 444 | Ga0207675_100060576 | 3300026118 | Bacteria | 3534 |
| 445 | Ga0207675_100226238 | 3300026118 | Unclassified | 1804 |
| 446 | Ga0207675_100563333 | 3300026118 | Unclassified | 1140 |
| 447 | Ga0207683_10000703 | 3300026121 | Bacteria | 30509 |
| 448 | Ga0207683_10009220 | 3300026121 | Bacteria | 8410 |
| 449 | Ga0207683_10126376 | 3300026121 | Bacteria | 2298 |
| 450 | Ga0207683_10143997 | 3300026121 | Bacteria | 2148 |
| 451 | Ga0207683_10466671 | 3300026121 | Bacteria | 1164 |
| 452 | Ga0207698_10038122 | 3300026142 | Bacteria | 3548 |
| 453 | Ga0207698_10122567 | 3300026142 | Bacteria | 2203 |
| 454 | Ga0207698_10892497 | 3300026142 | Bacteria | 896 |
| 455 | Ga0209588_1011697 | 3300027671 | Bacteria | 2655 |
| 456 | Ga0207428_10040067 | 3300027907 | Bacteria | 3802 |
| 457 | Ga0207428_10272174 | 3300027907 | Bacteria | 1259 |
| 458 | Ga0207428_10394461 | 3300027907 | Unclassified | 1014 |
| 459 | Ga0268266_10213335 | 3300028379 | Bacteria | 1771 |
| 460 | Ga0268265_10143944 | 3300028380 | Bacteria | 2000 |
| 461 | Ga0268265_10145349 | 3300028380 | Bacteria | 1992 |
| 462 | Ga0268264_10055989 | 3300028381 | Bacteria | 3295 |
| 463 | Ga0268264_10292317 | 3300028381 | Bacteria | 1531 |
| 464 | Ga0268264_10292745 | 3300028381 | Bacteria | 1530 |
| 465 | Ga0307517_10054449 | 3300028786 | Bacteria | 3955 |
| 466 | Ga0307515_10008048 | 3300028794 | Bacteria | 20659 |
| 467 | Ga0307513_10608716 | 3300031456 | Bacteria | 801 |
| 468 | Ga0373959_0010858 | 3300034820 | Bacteria | 1599 |
| 469 | Ga0373938_0008959 | 3300034957 | Bacteria | 1800 |
| 470 | Ga0373926_0020889 | 3300035083 | Bacteria | 2264 |
| 471 | Ga0373940_0093157 | 3300035088 | Bacteria | 905 |
| 472 | Ga0373944_0032996 | 3300035089 | Unclassified | 1567 |
| 473 | Ga0373949_0007870 | 3300035090 | Bacteria | 2336 |
| 474 | Ga0373951_0009558 | 3300035091 | Bacteria | 2182 |
| 475 | Ga0373952_0007667 | 3300035092 | Bacteria | 2031 |
| 476 | Ga0373932_0013893 | 3300035112 | Bacteria | 2014 |
| 477 | Ga0373936_0110252 | 3300035113 | Unclassified | 1168 |
| 478 | Ga0373941_0025398 | 3300035115 | Bacteria | 1711 |
| 479 | Ga0373945_0043228 | 3300035116 | Bacteria | 1634 |
| 480 | Ga0373960_0096175 | 3300035121 | Bacteria | 954 |
| 481 | Ga0373943_0006763 | 3300035170 | Bacteria | 5145 |
| 482 | Ga0373946_0116250 | 3300035171 | Unclassified | 1216 |
| 483 | Ga0373961_0022069 | 3300035241 | Bacteria | 1700 |
| 484 | Ga0373962_0065885 | 3300035242 | Bacteria | 1073 |
| 485 | Ga0373931_0180667 | 3300035691 | Bacteria | 1249 |
| 486 | Ga0373927_0121010 | 3300035695 | Bacteria | 1708 |
| 487 | Ga0373947_0004379 | 3300035725 | Bacteria | 8282 |
| 488 | Ga0373937_0759326 | 3300036401 | Bacteria | 917 |
| 489 | Ga0373925_0007097 | 3300037068 | Bacteria | 8188 |
| 490 | Ga0373925_0548947 | 3300037068 | Unclassified | 950 |
| 491 | Ga0451576_1166587 | 3300045051 | Bacteria | 805 |
| 492 | Ga0495617_104559 | 3300046452 | Bacteria | 919 |
| 493 | Ga0495592_0031672 | 3300046454 | Bacteria | 3995 |
| 494 | Ga0495603_0000598 | 3300046455 | Bacteria | 20275 |
| 495 | Ga0495629_0006073 | 3300046459 | Bacteria | 8974 |
| 496 | Ga0495629_0027320 | 3300046459 | Unclassified | 4051 |
| 497 | Ga0495629_0215926 | 3300046459 | Bacteria | 1324 |
| 498 | Ga0495641_0008494 | 3300046461 | Bacteria | 6248 |
| 499 | Ga0495653_0103112 | 3300046463 | Bacteria | 2063 |
| 500 | Ga0495580_0014040 | 3300046472 | Bacteria | 6092 |
| 501 | Ga0495582_0001037 | 3300046473 | Bacteria | 15567 |
| 502 | Ga0495639_0005017 | 3300046475 | Bacteria | 5680 |
| 503 | Ga0495662_0001596 | 3300046476 | Bacteria | 11248 |
| 504 | Ga0495584_0125112 | 3300046491 | Bacteria | 1303 |
| 505 | Ga0495594_0000152 | 3300046499 | Bacteria | 32972 |
| 506 | Ga0495594_0282436 | 3300046499 | Bacteria | 946 |
| 507 | Ga0495607_0074576 | 3300046501 | Bacteria | 1883 |
| 508 | Ga0495620_0009203 | 3300046515 | Bacteria | 5264 |
| 509 | Ga0495628_0095857 | 3300046516 | Unclassified | 2292 |
| 510 | Ga0495630_0040708 | 3300046517 | Bacteria | 3472 |
| 511 | Ga0495630_0105465 | 3300046517 | Bacteria | 2134 |
| 512 | Ga0495632_0022092 | 3300046519 | Bacteria | 3417 |
| 513 | Ga0495637_0070353 | 3300046520 | Bacteria | 1414 |
| 514 | Ga0495643_0005524 | 3300046522 | Bacteria | 8526 |
| 515 | Ga0495644_0099882 | 3300046523 | Unclassified | 1097 |
| 516 | Ga0495666_0005591 | 3300046526 | Bacteria | 6332 |
| 517 | Ga0495666_0009431 | 3300046526 | Bacteria | 4882 |
| 518 | Ga0495665_0006283 | 3300046531 | Bacteria | 6411 |
| 519 | Ga0495640_0032279 | 3300046533 | Bacteria | 3730 |
| 520 | Ga0495640_0266764 | 3300046533 | Unclassified | 1068 |
| 521 | Ga0495586_0030816 | 3300046535 | Unclassified | 2870 |
| 522 | Ga0495645_0258558 | 3300046543 | Bacteria | 1154 |
| 523 | Ga0495622_0000291 | 3300046557 | Bacteria | 37888 |
| 524 | Ga0495667_0071040 | 3300046559 | Bacteria | 2271 |
| 525 | Ga0495656_0135992 | 3300046615 | Bacteria | 1174 |
| 526 | Ga0495611_0109226 | 3300046648 | Bacteria | 1287 |
| 527 | Ga0495659_0048643 | 3300046664 | Unclassified | 1537 |
| 528 | Ga0495659_0106752 | 3300046664 | Bacteria | 1090 |
| 529 | Ga0495599_0268590 | 3300046678 | Bacteria | 1035 |
| 530 | Ga0495646_0175064 | 3300046680 | Bacteria | 1180 |
| 531 | Ga0495647_0000716 | 3300046681 | Bacteria | 9820 |
| 532 | Ga0495658_0004324 | 3300046683 | Bacteria | 6996 |
| 533 | Ga0495658_0215409 | 3300046683 | Bacteria | 1201 |
| 534 | Ga0495613_0004872 | 3300046689 | Bacteria | 10076 |
| 535 | Ga0495624_0023521 | 3300046690 | Bacteria | 4063 |
| 536 | Ga0495624_0046134 | 3300046690 | Bacteria | 2771 |
| 537 | Ga0495670_0201537 | 3300046691 | Unclassified | 1054 |
| 538 | Ga0495670_0283235 | 3300046691 | Bacteria | 887 |
| 539 | Ga0495671_0217225 | 3300046692 | Bacteria | 926 |
| 540 | Ga0495649_0130661 | 3300046694 | Bacteria | 1325 |
| 541 | Ga0495589_0160956 | 3300046794 | Bacteria | 1069 |
| 542 | Ga0495581_0008820 | 3300047315 | Bacteria | 5835 |
| 543 | Ga0495674_0031944 | 3300047319 | Bacteria | 4778 |
| 544 | Ga0495674_0060097 | 3300047319 | Bacteria | 3317 |
| 545 | Ga0495674_0240599 | 3300047319 | Unclassified | 1491 |
| 546 | Ga0495672_0267083 | 3300047320 | Bacteria | 823 |
| 547 | Ga0495676_0000619 | 3300047321 | Bacteria | 29413 |
| 548 | Ga0495676_0053837 | 3300047321 | Bacteria | 3203 |
| 549 | Ga0495683_0022209 | 3300047323 | Bacteria | 3264 |
| 550 | Ga0495687_004680 | 3300047443 | Bacteria | 9115 |
| 551 | Ga0495677_0198028 | 3300047445 | Bacteria | 781 |
| 552 | Ga0495681_0010923 | 3300047470 | Bacteria | 5456 |
| 553 | Ga0495593_0007555 | 3300047673 | Bacteria | 6351 |
| 554 | Ga0495602_0204919 | 3300048088 | Bacteria | 1502 |
| 555 | Ga0495614_0000555 | 3300048089 | Bacteria | 15471 |
| 556 | Ga0495614_0004055 | 3300048089 | Bacteria | 6583 |
| 557 | Ga0495626_0092082 | 3300048091 | Bacteria | 1332 |
| 558 | Ga0496100_0006109 | 3300048903 | Bacteria | 6545 |
| 559 | Ga0496100_0015781 | 3300048903 | Bacteria | 4417 |
| 560 | Ga0496100_0061036 | 3300048903 | Bacteria | 2483 |
| 561 | Ga0496100_0144801 | 3300048903 | Bacteria | 1688 |
| 562 | Ga0496100_0413172 | 3300048903 | Unclassified | 1029 |
| 563 | Ga0496100_0622723 | 3300048903 | Unclassified | 839 |
| 564 | Ga0496101_0001011 | 3300048904 | Bacteria | 16565 |
| 565 | Ga0496101_0001309 | 3300048904 | Bacteria | 14880 |
| 566 | Ga0496101_0012823 | 3300048904 | Bacteria | 5604 |
| 567 | Ga0496101_0033450 | 3300048904 | Bacteria | 3626 |
| 568 | Ga0496101_0054251 | 3300048904 | Bacteria | 2893 |
| 569 | Ga0496101_0088467 | 3300048904 | Bacteria | 2300 |
| 570 | Ga0496101_0170031 | 3300048904 | Bacteria | 1675 |
| 571 | Ga0496101_0185972 | 3300048904 | Bacteria | 1601 |
| 572 | Ga0496101_0229591 | 3300048904 | Unclassified | 1442 |
| 573 | Ga0496102_0003745 | 3300048905 | Bacteria | 12854 |
| 574 | Ga0496102_0006061 | 3300048905 | Bacteria | 10306 |
| 575 | Ga0496102_0016789 | 3300048905 | Bacteria | 6402 |
| 576 | Ga0496102_0022931 | 3300048905 | Bacteria | 5537 |
| 577 | Ga0496102_0047488 | 3300048905 | Bacteria | 3902 |
| 578 | Ga0496102_0188174 | 3300048905 | Bacteria | 1945 |
| 579 | Ga0496102_0355082 | 3300048905 | Unclassified | 1380 |
| 580 | Ga0496102_0738420 | 3300048905 | Bacteria | 907 |
| 581 | Ga0496102_0851750 | 3300048905 | Unclassified | 834 |
| 582 | Ga0496102_1214391 | 3300048905 | Bacteria | 673 |
| 583 | Ga0496103_0003723 | 3300048906 | Bacteria | 9271 |
| 584 | Ga0496103_0009427 | 3300048906 | Bacteria | 5785 |
| 585 | Ga0496103_0051436 | 3300048906 | Bacteria | 2550 |
| 586 | Ga0496103_0080589 | 3300048906 | Bacteria | 2047 |
| 587 | Ga0496103_0166566 | 3300048906 | Unclassified | 1414 |
| 588 | Ga0496104_0000504 | 3300048907 | Bacteria | 33646 |
| 589 | Ga0496104_0004535 | 3300048907 | Bacteria | 12101 |
| 590 | Ga0496104_0008804 | 3300048907 | Bacteria | 8971 |
| 591 | Ga0496104_0032463 | 3300048907 | Bacteria | 4859 |
| 592 | Ga0496104_0045978 | 3300048907 | Bacteria | 4107 |
| 593 | Ga0496104_0098429 | 3300048907 | Bacteria | 2800 |
| 594 | Ga0496104_0444360 | 3300048907 | Bacteria | 1209 |
| 595 | Ga0496104_0903256 | 3300048907 | Unclassified | 788 |
| 596 | Ga0496105_0052553 | 3300048908 | Bacteria | 3365 |
| 597 | Ga0496105_0072489 | 3300048908 | Bacteria | 2846 |
| 598 | Ga0496105_0085161 | 3300048908 | Bacteria | 2611 |
| 599 | Ga0496106_0001207 | 3300048909 | Bacteria | 19306 |
| 600 | Ga0496106_0005486 | 3300048909 | Bacteria | 9382 |
| 601 | Ga0496106_0080320 | 3300048909 | Bacteria | 2504 |
| 602 | Ga0496106_0119329 | 3300048909 | Bacteria | 2060 |
| 603 | Ga0496106_0195850 | 3300048909 | Bacteria | 1607 |
| 604 | Ga0496106_0206736 | 3300048909 | Unclassified | 1563 |
| 605 | Ga0496106_0207534 | 3300048909 | Bacteria | 1560 |
| 606 | Ga0496107_0001691 | 3300048910 | Bacteria | 13818 |
| 607 | Ga0496107_0001719 | 3300048910 | Bacteria | 13741 |
| 608 | Ga0496107_0007634 | 3300048910 | Bacteria | 7468 |
| 609 | Ga0496107_0011965 | 3300048910 | Bacteria | 6056 |
| 610 | Ga0496107_0015197 | 3300048910 | Bacteria | 5393 |
| 611 | Ga0496107_0026101 | 3300048910 | Bacteria | 4140 |
| 612 | Ga0496107_0063786 | 3300048910 | Bacteria | 2670 |
| 613 | Ga0496107_0065556 | 3300048910 | Bacteria | 2633 |
| 614 | Ga0496107_0114715 | 3300048910 | Bacteria | 1982 |
| 615 | Ga0496107_0141067 | 3300048910 | Bacteria | 1781 |
| 616 | Ga0496107_0179775 | 3300048910 | Bacteria | 1571 |
| 617 | Ga0496107_0358768 | 3300048910 | Bacteria | 1084 |
| 618 | Ga0496108_0011148 | 3300048911 | Bacteria | 7305 |
| 619 | Ga0496108_0042143 | 3300048911 | Bacteria | 3811 |
| 620 | Ga0496108_0048746 | 3300048911 | Bacteria | 3542 |
| 621 | Ga0496108_0055349 | 3300048911 | Bacteria | 3331 |
| 622 | Ga0496108_0171658 | 3300048911 | Bacteria | 1876 |
| 623 | Ga0496108_0888307 | 3300048911 | Bacteria | 765 |
| 624 | Ga0496109_0010571 | 3300048912 | Bacteria | 7893 |
| 625 | Ga0496109_0012446 | 3300048912 | Bacteria | 7344 |
| 626 | Ga0496109_0022799 | 3300048912 | Bacteria | 5548 |
| 627 | Ga0496109_0109284 | 3300048912 | Bacteria | 2570 |
| 628 | Ga0496109_0161813 | 3300048912 | Unclassified | 2097 |
| 629 | Ga0496109_0580681 | 3300048912 | Bacteria | 1056 |
| 630 | Ga0496109_0722084 | 3300048912 | Bacteria | 934 |
| 631 | Ga0496110_0007496 | 3300048913 | Bacteria | 8721 |
| 632 | Ga0496110_0281207 | 3300048913 | Bacteria | 1515 |
| 633 | Ga0496111_0060985 | 3300048914 | Bacteria | 2734 |
| 634 | Ga0496111_0122647 | 3300048914 | Bacteria | 1920 |
| 635 | Ga0496111_0253520 | 3300048914 | Bacteria | 1306 |
| 636 | Ga0496111_0551425 | 3300048914 | Bacteria | 846 |
| 637 | Ga0496112_0076010 | 3300048915 | Bacteria | 3322 |
| 638 | Ga0496112_0151700 | 3300048915 | Bacteria | 2284 |
| 639 | Ga0496112_0229228 | 3300048915 | Bacteria | 1812 |
| 640 | Ga0496112_0358341 | 3300048915 | Bacteria | 1401 |
| 641 | Ga0496112_0569465 | 3300048915 | Bacteria | 1066 |
| 642 | Ga0496113_0078498 | 3300048916 | Bacteria | 2526 |
| 643 | Ga0496113_0578546 | 3300048916 | Bacteria | 900 |
| 644 | Ga0496114_0001293 | 3300048917 | Bacteria | 18946 |
| 645 | Ga0496114_0002456 | 3300048917 | Bacteria | 14155 |
| 646 | Ga0496114_0005072 | 3300048917 | Bacteria | 10265 |
| 647 | Ga0496114_0014102 | 3300048917 | Bacteria | 6407 |
| 648 | Ga0496114_0057318 | 3300048917 | Bacteria | 3252 |
| 649 | Ga0496114_0074261 | 3300048917 | Bacteria | 2862 |
| 650 | Ga0496114_0208835 | 3300048917 | Bacteria | 1712 |
| 651 | Ga0496114_0241185 | 3300048917 | Bacteria | 1589 |
| 652 | Ga0496114_0798595 | 3300048917 | Unclassified | 822 |
| 653 | Ga0496115_0000227 | 3300048918 | Bacteria | 51259 |
| 654 | Ga0496115_0000867 | 3300048918 | Bacteria | 22015 |
| 655 | Ga0496115_0005762 | 3300048918 | Bacteria | 9021 |
| 656 | Ga0496115_0009699 | 3300048918 | Bacteria | 7168 |
| 657 | Ga0496115_0045364 | 3300048918 | Bacteria | 3508 |
| 658 | Ga0496115_0102836 | 3300048918 | Bacteria | 2343 |
| 659 | Ga0496115_0113090 | 3300048918 | Bacteria | 2231 |
| 660 | Ga0496115_0385457 | 3300048918 | Bacteria | 1139 |
| 661 | Ga0496115_0493958 | 3300048918 | Bacteria | 984 |
| 662 | Ga0496126_0082413 | 3300048929 | Bacteria | 2842 |
| 663 | Ga0501067_0003444 | 3300049583 | Bacteria | 8702 |
| 664 | Ga0501068_0136269 | 3300049584 | Bacteria | 1537 |
| 665 | Ga0501069_0001535 | 3300049585 | Bacteria | 11419 |
| 666 | nmdc:mga0yw44_207261_c1 | 3300050492 | Bacteria | 1296 |
| 667 | nmdc:mga05p37_168613_c1 | 3300050507 | Bacteria | 2671 |
| 668 | nmdc:mga05p37_24796_c1 | 3300050507 | Bacteria | 7291 |
| 669 | nmdc:mga05p37_290016_c1 | 3300050507 | Bacteria | 1948 |
| 670 | nmdc:mga05p37_356227_c1 | 3300050507 | Bacteria | 1722 |
| 671 | nmdc:mga05p37_481826_c1 | 3300050507 | Bacteria | 1429 |
| 672 | nmdc:mga05p37_5975_c1 | 3300050507 | Bacteria | 14326 |
| 673 | nmdc:mga05p37_821736_c1 | 3300050507 | Unclassified | 1013 |
| 674 | nmdc:mga09592_100092_c1 | 3300050508 | Bacteria | 2482 |
| 675 | nmdc:mga09592_266179_c1 | 3300050508 | Bacteria | 1487 |
| 676 | nmdc:mga09592_470914_c1 | 3300050508 | Unclassified | 1083 |
| 677 | nmdc:mga09592_635705_c1 | 3300050508 | Unclassified | 912 |
| 678 | nmdc:mga09592_69793_c1 | 3300050508 | Bacteria | 2981 |
| 679 | nmdc:mga09592_99263_c1 | 3300050508 | Bacteria | 2493 |
| 680 | nmdc:mga0qj67_649682_c1 | 3300050509 | Unclassified | 841 |
| 681 | nmdc:mga06r32_33429_c1 | 3300050510 | Bacteria | 4843 |
| 682 | nmdc:mga06r32_5648_c1 | 3300050510 | Bacteria | 11252 |
| 683 | nmdc:mga08y16_188440_c1 | 3300050511 | Bacteria | 2140 |
| 684 | nmdc:mga08y16_20726_c1 | 3300050511 | Bacteria | 6939 |
| 685 | nmdc:mga08y16_304871_c1 | 3300050511 | Unclassified | 1641 |
| 686 | nmdc:mga08y16_58431_c1 | 3300050511 | Bacteria | 4030 |
| 687 | nmdc:mga08y16_914685_c1 | 3300050511 | Bacteria | 863 |
| 688 | nmdc:mga0n895_157998_c1 | 3300050512 | Bacteria | 2298 |
| 689 | nmdc:mga0n895_17713_c1 | 3300050512 | Bacteria | 6572 |
| 690 | nmdc:mga0n895_2041_c1 | 3300050512 | Bacteria | 15531 |
| 691 | nmdc:mga0n895_282700_c1 | 3300050512 | Bacteria | 1682 |
| 692 | nmdc:mga0n895_360874_c1 | 3300050512 | Bacteria | 1471 |
| 693 | nmdc:mga0n895_45110_c1 | 3300050512 | Bacteria | 4301 |
| 694 | nmdc:mga0n895_466616_c1 | 3300050512 | Unclassified | 1274 |
| 695 | nmdc:mga0n895_49212_c1 | 3300050512 | Bacteria | 4128 |
| 696 | nmdc:mga0n895_71944_c1 | 3300050512 | Bacteria | 3430 |
| 697 | nmdc:mga0rr50_112785_c1 | 3300050513 | Bacteria | 2154 |
| 698 | nmdc:mga0rr50_138622_c1 | 3300050513 | Bacteria | 1955 |
| 699 | nmdc:mga0rr50_18740_c1 | 3300050513 | Bacteria | 4657 |
| 700 | nmdc:mga0rr50_325049_c1 | 3300050513 | Bacteria | 1290 |
| 701 | nmdc:mga0rr50_570_c1 | 3300050513 | Bacteria | 19808 |
| 702 | nmdc:mga0rr50_592128_c1 | 3300050513 | Bacteria | 945 |
| 703 | nmdc:mga08x19_100460_c1 | 3300050514 | Bacteria | 1919 |
| 704 | nmdc:mga08x19_126266_c1 | 3300050514 | Bacteria | 1718 |
| 705 | nmdc:mga08x19_21664_c1 | 3300050514 | Bacteria | 3971 |
| 706 | nmdc:mga08x19_9820_c1 | 3300050514 | Bacteria | 5734 |
| 707 | nmdc:mga0a205_307063_c1 | 3300050515 | Bacteria | 1459 |
| 708 | nmdc:mga0a205_325338_c1 | 3300050515 | Unclassified | 1408 |
| 709 | nmdc:mga0a205_386812_c1 | 3300050515 | Bacteria | 1264 |
| 710 | nmdc:mga0a205_426513_c1 | 3300050515 | Bacteria | 1188 |
| 711 | nmdc:mga0a205_431322_c1 | 3300050515 | Bacteria | 1179 |
| 712 | nmdc:mga0a205_462629_c1 | 3300050515 | Unclassified | 1128 |
| 713 | nmdc:mga0a205_908162_c1 | 3300050515 | Unclassified | 727 |
| 714 | nmdc:mga0sz30_18404_c2 | 3300050516 | Bacteria | 2446 |
| 715 | Ga0495601_0310265 | 3300053077 | Unclassified | 1027 |
| 716 | Ga0495612_0000648 | 3300053078 | Bacteria | 13983 |
| 717 | Ga0495619_0022226 | 3300053085 | Bacteria | 4056 |
| 718 | Ga0495619_0501298 | 3300053085 | Unclassified | 835 |
| 719 | Ga0500578_0336132 | 3300053086 | Unclassified | 886 |
| 720 | Ga0500646_0054699 | 3300053090 | Bacteria | 1160 |
| 721 | Ga0500583_0206130 | 3300053092 | Unclassified | 977 |
| 722 | Ga0500654_121595 | 3300053099 | Bacteria | 1024 |
| 723 | Ga0500569_008074 | 3300053109 | Bacteria | 2394 |
| 724 | Ga0500561_0014965 | 3300053137 | Bacteria | 1712 |
| 725 | Ga0500616_0033134 | 3300053153 | Bacteria | 2820 |
| 726 | Ga0500634_0015437 | 3300053161 | Bacteria | 4055 |
| 727 | Ga0530510_0062545 | 3300061734 | Bacteria | 2694 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047445 | Ga0495677_0198028 | Ga0495677_0198028_178_741 | 172 |
| 2 | 3300046691 | Ga0495670_0201537 | Ga0495670_0201537_294_845 | 174 |
| 3 | 3300035116 | Ga0373945_0043228 | Ga0373945_0043228_1025_1621 | 187 |
| 4 | 3300048910 | Ga0496107_0141067 | Ga0496107_0141067_1171_1767 | 187 |
| 5 | 3300053085 | Ga0495619_0501298 | Ga0495619_0501298_223_819 | 187 |
| 6 | 3300026118 | Ga0207675_100563333 | Ga0207675_1005633331 | 193 |
| 7 | 3300009177 | Ga0105248_10757073 | Ga0105248_107570732 | 195 |
| 8 | 3300013100 | Ga0157373_10035036 | Ga0157373_100350363 | 195 |
| 9 | 3300035113 | Ga0373936_0110252 | Ga0373936_0110252_14_634 | 195 |
| 10 | 3300046459 | Ga0495629_0215926 | Ga0495629_0215926_226_846 | 195 |
| 11 | 3300046648 | Ga0495611_0109226 | Ga0495611_0109226_656_1270 | 195 |
| 12 | 3300048910 | Ga0496107_0179775 | Ga0496107_0179775_124_759 | 195 |
| 13 | 3300048917 | Ga0496114_0798595 | Ga0496114_0798595_24_659 | 195 |
| 14 | 3300009545 | Ga0105237_10532120 | Ga0105237_105321202 | 196 |
| 15 | 3300035088 | Ga0373940_0093157 | Ga0373940_0093157_10_642 | 196 |
| 16 | 3300050509 | nmdc:mga0qj67_649682_c1 | nmdc:mga0qj67_649682_c1_41_676 | 196 |
| 17 | 3300046516 | Ga0495628_0095857 | Ga0495628_0095857_477_1142 | 197 |
| 18 | 3300053078 | Ga0495612_0000648 | Ga0495612_0000648_5514_6179 | 197 |
| 19 | 3300046533 | Ga0495640_0266764 | Ga0495640_0266764_90_737 | 204 |
| 20 | 3300048905 | Ga0496102_1214391 | Ga0496102_1214391_14_658 | 204 |
| 21 | 3300028794 | Ga0307515_10008048 | Ga0307515_100080487 | 205 |
| 22 | 3300050511 | nmdc:mga08y16_304871_c1 | nmdc:mga08y16_304871_c1_515_1132 | 205 |
| 23 | 3300009093 | Ga0105240_10826936 | Ga0105240_108269362 | 206 |
| 24 | 3300005467 | Ga0070706_100068874 | Ga0070706_1000688742 | 207 |
| 25 | 3300005445 | Ga0070708_100657175 | Ga0070708_1006571751 | 208 |
| 26 | 3300005471 | Ga0070698_100110822 | Ga0070698_1001108222 | 208 |
| 27 | 3300006028 | Ga0070717_10067652 | Ga0070717_100676523 | 208 |
| 28 | 3300009098 | Ga0105245_10086114 | Ga0105245_100861143 | 209 |
| 29 | 3300013307 | Ga0157372_11256138 | Ga0157372_112561382 | 209 |
| 30 | 3300001978 | JGI24747J21853_1011099 | JGI24747J21853_10110991 | 210 |
| 31 | 3300002077 | JGI24744J21845_10002897 | JGI24744J21845_100028974 | 210 |
| 32 | 3300005328 | Ga0070676_10152643 | Ga0070676_101526432 | 210 |
| 33 | 3300005329 | Ga0070683_100045356 | Ga0070683_1000453563 | 210 |
| 34 | 3300005329 | Ga0070683_100585434 | Ga0070683_1005854341 | 210 |
| 35 | 3300005330 | Ga0070690_100047336 | Ga0070690_1000473362 | 210 |
| 36 | 3300005334 | Ga0068869_100128600 | Ga0068869_1001286002 | 210 |
| 37 | 3300005334 | Ga0068869_100139105 | Ga0068869_1001391053 | 210 |
| 38 | 3300005334 | Ga0068869_100149733 | Ga0068869_1001497332 | 210 |
| 39 | 3300005336 | Ga0070680_100017805 | Ga0070680_1000178052 | 210 |
| 40 | 3300005336 | Ga0070680_100184222 | Ga0070680_1001842223 | 210 |
| 41 | 3300005336 | Ga0070680_100263589 | Ga0070680_1002635892 | 210 |
| 42 | 3300005337 | Ga0070682_100002394 | Ga0070682_1000023943 | 210 |
| 43 | 3300005337 | Ga0070682_100022994 | Ga0070682_1000229945 | 210 |
| 44 | 3300005338 | Ga0068868_100015516 | Ga0068868_1000155163 | 210 |
| 45 | 3300005338 | Ga0068868_100091883 | Ga0068868_1000918832 | 210 |
| 46 | 3300005338 | Ga0068868_100143253 | Ga0068868_1001432532 | 210 |
| 47 | 3300005339 | Ga0070660_100015317 | Ga0070660_1000153173 | 210 |
| 48 | 3300005341 | Ga0070691_10029496 | Ga0070691_100294962 | 210 |
| 49 | 3300005341 | Ga0070691_10051628 | Ga0070691_100516282 | 210 |
| 50 | 3300005343 | Ga0070687_100304868 | Ga0070687_1003048682 | 210 |
| 51 | 3300005343 | Ga0070687_100307732 | Ga0070687_1003077322 | 210 |
| 52 | 3300005343 | Ga0070687_100450535 | Ga0070687_1004505351 | 210 |
| 53 | 3300005345 | Ga0070692_10095438 | Ga0070692_100954382 | 210 |
| 54 | 3300005345 | Ga0070692_10262601 | Ga0070692_102626012 | 210 |
| 55 | 3300005347 | Ga0070668_100023578 | Ga0070668_1000235785 | 210 |
| 56 | 3300005347 | Ga0070668_100248735 | Ga0070668_1002487352 | 210 |
| 57 | 3300005353 | Ga0070669_100120066 | Ga0070669_1001200662 | 210 |
| 58 | 3300005353 | Ga0070669_100184736 | Ga0070669_1001847362 | 210 |
| 59 | 3300005354 | Ga0070675_100546685 | Ga0070675_1005466852 | 210 |
| 60 | 3300005355 | Ga0070671_100048211 | Ga0070671_1000482114 | 210 |
| 61 | 3300005356 | Ga0070674_100064498 | Ga0070674_1000644982 | 210 |
| 62 | 3300005356 | Ga0070674_100646178 | Ga0070674_1006461782 | 210 |
| 63 | 3300005364 | Ga0070673_100049553 | Ga0070673_1000495532 | 210 |
| 64 | 3300005364 | Ga0070673_100111277 | Ga0070673_1001112772 | 210 |
| 65 | 3300005365 | Ga0070688_100000841 | Ga0070688_1000008417 | 210 |
| 66 | 3300005366 | Ga0070659_100006905 | Ga0070659_1000069053 | 210 |
| 67 | 3300005366 | Ga0070659_100079438 | Ga0070659_1000794382 | 210 |
| 68 | 3300005367 | Ga0070667_100192770 | Ga0070667_1001927702 | 210 |
| 69 | 3300005434 | Ga0070709_10053899 | Ga0070709_100538992 | 210 |
| 70 | 3300005434 | Ga0070709_10211278 | Ga0070709_102112782 | 210 |
| 71 | 3300005435 | Ga0070714_100062419 | Ga0070714_1000624192 | 210 |
| 72 | 3300005435 | Ga0070714_100088687 | Ga0070714_1000886873 | 210 |
| 73 | 3300005435 | Ga0070714_100204689 | Ga0070714_1002046892 | 210 |
| 74 | 3300005435 | Ga0070714_100234252 | Ga0070714_1002342521 | 210 |
| 75 | 3300005435 | Ga0070714_100691230 | Ga0070714_1006912302 | 210 |
| 76 | 3300005436 | Ga0070713_100631798 | Ga0070713_1006317982 | 210 |
| 77 | 3300005437 | Ga0070710_10014642 | Ga0070710_100146423 | 210 |
| 78 | 3300005437 | Ga0070710_10242488 | Ga0070710_102424881 | 210 |
| 79 | 3300005438 | Ga0070701_10012209 | Ga0070701_100122093 | 210 |
| 80 | 3300005439 | Ga0070711_100047894 | Ga0070711_1000478942 | 210 |
| 81 | 3300005439 | Ga0070711_100053464 | Ga0070711_1000534641 | 210 |
| 82 | 3300005439 | Ga0070711_100093198 | Ga0070711_1000931982 | 210 |
| 83 | 3300005439 | Ga0070711_100094408 | Ga0070711_1000944081 | 210 |
| 84 | 3300005439 | Ga0070711_100179877 | Ga0070711_1001798772 | 210 |
| 85 | 3300005439 | Ga0070711_100455449 | Ga0070711_1004554492 | 210 |
| 86 | 3300005440 | Ga0070705_100022110 | Ga0070705_1000221102 | 210 |
| 87 | 3300005440 | Ga0070705_100114078 | Ga0070705_1001140781 | 210 |
| 88 | 3300005440 | Ga0070705_100397250 | Ga0070705_1003972502 | 210 |
| 89 | 3300005441 | Ga0070700_100001535 | Ga0070700_1000015354 | 210 |
| 90 | 3300005441 | Ga0070700_100034748 | Ga0070700_1000347482 | 210 |
| 91 | 3300005444 | Ga0070694_100172697 | Ga0070694_1001726972 | 210 |
| 92 | 3300005444 | Ga0070694_100223748 | Ga0070694_1002237482 | 210 |
| 93 | 3300005444 | Ga0070694_100322016 | Ga0070694_1003220161 | 210 |
| 94 | 3300005445 | Ga0070708_100066025 | Ga0070708_1000660252 | 210 |
| 95 | 3300005445 | Ga0070708_100075392 | Ga0070708_1000753923 | 210 |
| 96 | 3300005455 | Ga0070663_100407715 | Ga0070663_1004077151 | 210 |
| 97 | 3300005456 | Ga0070678_100032322 | Ga0070678_1000323224 | 210 |
| 98 | 3300005456 | Ga0070678_100359491 | Ga0070678_1003594912 | 210 |
| 99 | 3300005457 | Ga0070662_100112084 | Ga0070662_1001120843 | 210 |
| 100 | 3300005457 | Ga0070662_100378597 | Ga0070662_1003785973 | 210 |
| 101 | 3300005458 | Ga0070681_10804985 | Ga0070681_108049851 | 210 |
| 102 | 3300005459 | Ga0068867_100001471 | Ga0068867_10000147112 | 210 |
| 103 | 3300005459 | Ga0068867_100046414 | Ga0068867_1000464142 | 210 |
| 104 | 3300005466 | Ga0070685_10014278 | Ga0070685_100142782 | 210 |
| 105 | 3300005467 | Ga0070706_100107639 | Ga0070706_1001076393 | 210 |
| 106 | 3300005467 | Ga0070706_100202669 | Ga0070706_1002026692 | 210 |
| 107 | 3300005467 | Ga0070706_100960396 | Ga0070706_1009603961 | 210 |
| 108 | 3300005468 | Ga0070707_100000511 | Ga0070707_10000051132 | 210 |
| 109 | 3300005468 | Ga0070707_100010774 | Ga0070707_1000107742 | 210 |
| 110 | 3300005468 | Ga0070707_100036478 | Ga0070707_1000364783 | 210 |
| 111 | 3300005468 | Ga0070707_100727335 | Ga0070707_1007273352 | 210 |
| 112 | 3300005471 | Ga0070698_100055634 | Ga0070698_1000556343 | 210 |
| 113 | 3300005471 | Ga0070698_100079781 | Ga0070698_1000797812 | 210 |
| 114 | 3300005471 | Ga0070698_100177267 | Ga0070698_1001772672 | 210 |
| 115 | 3300005471 | Ga0070698_100472753 | Ga0070698_1004727531 | 210 |
| 116 | 3300005471 | Ga0070698_100520805 | Ga0070698_1005208051 | 210 |
| 117 | 3300005471 | Ga0070698_100625718 | Ga0070698_1006257181 | 210 |
| 118 | 3300005471 | Ga0070698_100840861 | Ga0070698_1008408611 | 210 |
| 119 | 3300005518 | Ga0070699_100117274 | Ga0070699_1001172745 | 210 |
| 120 | 3300005530 | Ga0070679_100220661 | Ga0070679_1002206612 | 210 |
| 121 | 3300005535 | Ga0070684_100487010 | Ga0070684_1004870101 | 210 |
| 122 | 3300005539 | Ga0068853_100015572 | Ga0068853_1000155726 | 210 |
| 123 | 3300005543 | Ga0070672_100087676 | Ga0070672_1000876763 | 210 |
| 124 | 3300005543 | Ga0070672_100175644 | Ga0070672_1001756442 | 210 |
| 125 | 3300005544 | Ga0070686_100040736 | Ga0070686_1000407362 | 210 |
| 126 | 3300005544 | Ga0070686_100062901 | Ga0070686_1000629012 | 210 |
| 127 | 3300005544 | Ga0070686_100126938 | Ga0070686_1001269382 | 210 |
| 128 | 3300005544 | Ga0070686_100516901 | Ga0070686_1005169012 | 210 |
| 129 | 3300005545 | Ga0070695_100093783 | Ga0070695_1000937832 | 210 |
| 130 | 3300005545 | Ga0070695_100099097 | Ga0070695_1000990973 | 210 |
| 131 | 3300005545 | Ga0070695_100165560 | Ga0070695_1001655601 | 210 |
| 132 | 3300005546 | Ga0070696_100006869 | Ga0070696_1000068695 | 210 |
| 133 | 3300005546 | Ga0070696_100122627 | Ga0070696_1001226273 | 210 |
| 134 | 3300005546 | Ga0070696_100174785 | Ga0070696_1001747851 | 210 |
| 135 | 3300005546 | Ga0070696_100211759 | Ga0070696_1002117592 | 210 |
| 136 | 3300005546 | Ga0070696_100391987 | Ga0070696_1003919872 | 210 |
| 137 | 3300005547 | Ga0070693_100001834 | Ga0070693_1000018342 | 210 |
| 138 | 3300005547 | Ga0070693_100005402 | Ga0070693_1000054022 | 210 |
| 139 | 3300005547 | Ga0070693_100170598 | Ga0070693_1001705982 | 210 |
| 140 | 3300005547 | Ga0070693_100480409 | Ga0070693_1004804091 | 210 |
| 141 | 3300005548 | Ga0070665_100095068 | Ga0070665_1000950683 | 210 |
| 142 | 3300005549 | Ga0070704_100014179 | Ga0070704_1000141795 | 210 |
| 143 | 3300005549 | Ga0070704_100086782 | Ga0070704_1000867822 | 210 |
| 144 | 3300005549 | Ga0070704_100318175 | Ga0070704_1003181752 | 210 |
| 145 | 3300005563 | Ga0068855_100156311 | Ga0068855_1001563112 | 210 |
| 146 | 3300005564 | Ga0070664_100502036 | Ga0070664_1005020362 | 210 |
| 147 | 3300005578 | Ga0068854_100391247 | Ga0068854_1003912472 | 210 |
| 148 | 3300005578 | Ga0068854_100437271 | Ga0068854_1004372712 | 210 |
| 149 | 3300005578 | Ga0068854_100663004 | Ga0068854_1006630041 | 210 |
| 150 | 3300005614 | Ga0068856_100002969 | Ga0068856_10000296910 | 210 |
| 151 | 3300005614 | Ga0068856_100021597 | Ga0068856_1000215973 | 210 |
| 152 | 3300005614 | Ga0068856_100321475 | Ga0068856_1003214751 | 210 |
| 153 | 3300005614 | Ga0068856_100415054 | Ga0068856_1004150542 | 210 |
| 154 | 3300005615 | Ga0070702_100000676 | Ga0070702_10000067611 | 210 |
| 155 | 3300005615 | Ga0070702_100026855 | Ga0070702_1000268554 | 210 |
| 156 | 3300005615 | Ga0070702_100259934 | Ga0070702_1002599341 | 210 |
| 157 | 3300005616 | Ga0068852_100054409 | Ga0068852_1000544094 | 210 |
| 158 | 3300005618 | Ga0068864_100410839 | Ga0068864_1004108392 | 210 |
| 159 | 3300005618 | Ga0068864_100778555 | Ga0068864_1007785551 | 210 |
| 160 | 3300005718 | Ga0068866_10000624 | Ga0068866_1000062412 | 210 |
| 161 | 3300005718 | Ga0068866_10006504 | Ga0068866_100065045 | 210 |
| 162 | 3300005718 | Ga0068866_10235318 | Ga0068866_102353182 | 210 |
| 163 | 3300005718 | Ga0068866_10428718 | Ga0068866_104287182 | 210 |
| 164 | 3300005719 | Ga0068861_100030702 | Ga0068861_1000307023 | 210 |
| 165 | 3300005719 | Ga0068861_100065512 | Ga0068861_1000655123 | 210 |
| 166 | 3300005841 | Ga0068863_100135083 | Ga0068863_1001350832 | 210 |
| 167 | 3300005842 | Ga0068858_100276448 | Ga0068858_1002764482 | 210 |
| 168 | 3300005842 | Ga0068858_100592589 | Ga0068858_1005925892 | 210 |
| 169 | 3300005844 | Ga0068862_100128195 | Ga0068862_1001281952 | 210 |
| 170 | 3300005844 | Ga0068862_100217476 | Ga0068862_1002174762 | 210 |
| 171 | 3300005844 | Ga0068862_100268120 | Ga0068862_1002681201 | 210 |
| 172 | 3300005844 | Ga0068862_100333842 | Ga0068862_1003338422 | 210 |
| 173 | 3300005937 | Ga0081455_10101542 | Ga0081455_101015423 | 210 |
| 174 | 3300006028 | Ga0070717_10162570 | Ga0070717_101625702 | 210 |
| 175 | 3300006028 | Ga0070717_10228285 | Ga0070717_102282852 | 210 |
| 176 | 3300006028 | Ga0070717_10385834 | Ga0070717_103858341 | 210 |
| 177 | 3300006038 | Ga0075365_10058973 | Ga0075365_100589733 | 210 |
| 178 | 3300006038 | Ga0075365_10438967 | Ga0075365_104389671 | 210 |
| 179 | 3300006051 | Ga0075364_10023067 | Ga0075364_100230675 | 210 |
| 180 | 3300006163 | Ga0070715_10000737 | Ga0070715_100007378 | 210 |
| 181 | 3300006163 | Ga0070715_10008584 | Ga0070715_100085842 | 210 |
| 182 | 3300006163 | Ga0070715_10096148 | Ga0070715_100961482 | 210 |
| 183 | 3300006173 | Ga0070716_100144365 | Ga0070716_1001443653 | 210 |
| 184 | 3300006173 | Ga0070716_100166006 | Ga0070716_1001660062 | 210 |
| 185 | 3300006173 | Ga0070716_100231052 | Ga0070716_1002310522 | 210 |
| 186 | 3300006173 | Ga0070716_100282711 | Ga0070716_1002827112 | 210 |
| 187 | 3300006175 | Ga0070712_100042581 | Ga0070712_1000425814 | 210 |
| 188 | 3300006175 | Ga0070712_100141993 | Ga0070712_1001419932 | 210 |
| 189 | 3300006175 | Ga0070712_100211879 | Ga0070712_1002118792 | 210 |
| 190 | 3300006175 | Ga0070712_100612711 | Ga0070712_1006127112 | 210 |
| 191 | 3300006177 | Ga0075362_10079471 | Ga0075362_100794712 | 210 |
| 192 | 3300006186 | Ga0075369_10166176 | Ga0075369_101661762 | 210 |
| 193 | 3300006237 | Ga0097621_100004541 | Ga0097621_1000045418 | 210 |
| 194 | 3300006237 | Ga0097621_100016827 | Ga0097621_1000168273 | 210 |
| 195 | 3300006237 | Ga0097621_100586079 | Ga0097621_1005860791 | 210 |
| 196 | 3300006358 | Ga0068871_100127102 | Ga0068871_1001271022 | 210 |
| 197 | 3300006358 | Ga0068871_100643936 | Ga0068871_1006439362 | 210 |
| 198 | 3300006844 | Ga0075428_100006760 | Ga0075428_1000067606 | 210 |
| 199 | 3300006844 | Ga0075428_100367704 | Ga0075428_1003677042 | 210 |
| 200 | 3300006844 | Ga0075428_100373574 | Ga0075428_1003735742 | 210 |
| 201 | 3300006846 | Ga0075430_100558903 | Ga0075430_1005589032 | 210 |
| 202 | 3300006847 | Ga0075431_100003951 | Ga0075431_1000039517 | 210 |
| 203 | 3300006847 | Ga0075431_100066582 | Ga0075431_1000665823 | 210 |
| 204 | 3300006847 | Ga0075431_100956357 | Ga0075431_1009563571 | 210 |
| 205 | 3300006852 | Ga0075433_10002301 | Ga0075433_100023014 | 210 |
| 206 | 3300006852 | Ga0075433_10280987 | Ga0075433_102809871 | 210 |
| 207 | 3300006852 | Ga0075433_10339193 | Ga0075433_103391932 | 210 |
| 208 | 3300006852 | Ga0075433_10374880 | Ga0075433_103748802 | 210 |
| 209 | 3300006852 | Ga0075433_10529448 | Ga0075433_105294482 | 210 |
| 210 | 3300006852 | Ga0075433_10535015 | Ga0075433_105350152 | 210 |
| 211 | 3300006852 | Ga0075433_10553039 | Ga0075433_105530392 | 210 |
| 212 | 3300006852 | Ga0075433_10620596 | Ga0075433_106205962 | 210 |
| 213 | 3300006871 | Ga0075434_100001735 | Ga0075434_1000017353 | 210 |
| 214 | 3300006871 | Ga0075434_100002903 | Ga0075434_1000029035 | 210 |
| 215 | 3300006871 | Ga0075434_100005482 | Ga0075434_1000054829 | 210 |
| 216 | 3300006871 | Ga0075434_100035540 | Ga0075434_1000355403 | 210 |
| 217 | 3300006871 | Ga0075434_100046968 | Ga0075434_1000469682 | 210 |
| 218 | 3300006871 | Ga0075434_100070137 | Ga0075434_1000701372 | 210 |
| 219 | 3300006871 | Ga0075434_100224654 | Ga0075434_1002246541 | 210 |
| 220 | 3300006871 | Ga0075434_100467377 | Ga0075434_1004673772 | 210 |
| 221 | 3300006880 | Ga0075429_100183696 | Ga0075429_1001836962 | 210 |
| 222 | 3300006881 | Ga0068865_100001271 | Ga0068865_1000012712 | 210 |
| 223 | 3300006881 | Ga0068865_100156395 | Ga0068865_1001563952 | 210 |
| 224 | 3300006914 | Ga0075436_100003584 | Ga0075436_1000035843 | 210 |
| 225 | 3300006914 | Ga0075436_100058845 | Ga0075436_1000588452 | 210 |
| 226 | 3300006914 | Ga0075436_100115273 | Ga0075436_1001152732 | 210 |
| 227 | 3300006914 | Ga0075436_100277829 | Ga0075436_1002778292 | 210 |
| 228 | 3300006914 | Ga0075436_100314915 | Ga0075436_1003149152 | 210 |
| 229 | 3300006931 | Ga0097620_100942440 | Ga0097620_1009424401 | 210 |
| 230 | 3300007076 | Ga0075435_100000284 | Ga0075435_10000028416 | 210 |
| 231 | 3300007076 | Ga0075435_100001809 | Ga0075435_10000180914 | 210 |
| 232 | 3300007076 | Ga0075435_100226689 | Ga0075435_1002266892 | 210 |
| 233 | 3300009092 | Ga0105250_10077542 | Ga0105250_100775422 | 210 |
| 234 | 3300009094 | Ga0111539_10073102 | Ga0111539_100731024 | 210 |
| 235 | 3300009094 | Ga0111539_10117237 | Ga0111539_101172375 | 210 |
| 236 | 3300009094 | Ga0111539_10641969 | Ga0111539_106419693 | 210 |
| 237 | 3300009094 | Ga0111539_11380715 | Ga0111539_113807151 | 210 |
| 238 | 3300009098 | Ga0105245_10002220 | Ga0105245_100022203 | 210 |
| 239 | 3300009098 | Ga0105245_10012223 | Ga0105245_100122238 | 210 |
| 240 | 3300009098 | Ga0105245_10016423 | Ga0105245_100164234 | 210 |
| 241 | 3300009098 | Ga0105245_10016536 | Ga0105245_100165367 | 210 |
| 242 | 3300009098 | Ga0105245_10023158 | Ga0105245_100231585 | 210 |
| 243 | 3300009098 | Ga0105245_10055949 | Ga0105245_100559492 | 210 |
| 244 | 3300009098 | Ga0105245_10185932 | Ga0105245_101859322 | 210 |
| 245 | 3300009098 | Ga0105245_10205405 | Ga0105245_102054052 | 210 |
| 246 | 3300009098 | Ga0105245_10410868 | Ga0105245_104108682 | 210 |
| 247 | 3300009098 | Ga0105245_10528407 | Ga0105245_105284071 | 210 |
| 248 | 3300009098 | Ga0105245_11112498 | Ga0105245_111124982 | 210 |
| 249 | 3300009101 | Ga0105247_10009237 | Ga0105247_100092372 | 210 |
| 250 | 3300009101 | Ga0105247_10135380 | Ga0105247_101353802 | 210 |
| 251 | 3300009101 | Ga0105247_10295955 | Ga0105247_102959552 | 210 |
| 252 | 3300009147 | Ga0114129_10028492 | Ga0114129_100284926 | 210 |
| 253 | 3300009147 | Ga0114129_10048033 | Ga0114129_100480332 | 210 |
| 254 | 3300009147 | Ga0114129_10206852 | Ga0114129_102068522 | 210 |
| 255 | 3300009147 | Ga0114129_10336450 | Ga0114129_103364502 | 210 |
| 256 | 3300009147 | Ga0114129_10339024 | Ga0114129_103390242 | 210 |
| 257 | 3300009147 | Ga0114129_11032202 | Ga0114129_110322021 | 210 |
| 258 | 3300009148 | Ga0105243_10002337 | Ga0105243_100023377 | 210 |
| 259 | 3300009148 | Ga0105243_10082229 | Ga0105243_100822294 | 210 |
| 260 | 3300009148 | Ga0105243_10245984 | Ga0105243_102459842 | 210 |
| 261 | 3300009148 | Ga0105243_10324090 | Ga0105243_103240902 | 210 |
| 262 | 3300009174 | Ga0105241_10032280 | Ga0105241_100322804 | 210 |
| 263 | 3300009174 | Ga0105241_10035308 | Ga0105241_100353082 | 210 |
| 264 | 3300009174 | Ga0105241_10961496 | Ga0105241_109614961 | 210 |
| 265 | 3300009176 | Ga0105242_10000857 | Ga0105242_1000085712 | 210 |
| 266 | 3300009176 | Ga0105242_10063325 | Ga0105242_100633254 | 210 |
| 267 | 3300009176 | Ga0105242_10160149 | Ga0105242_101601492 | 210 |
| 268 | 3300009176 | Ga0105242_10241727 | Ga0105242_102417272 | 210 |
| 269 | 3300009176 | Ga0105242_10542559 | Ga0105242_105425592 | 210 |
| 270 | 3300009176 | Ga0105242_10602054 | Ga0105242_106020542 | 210 |
| 271 | 3300009176 | Ga0105242_10756665 | Ga0105242_107566651 | 210 |
| 272 | 3300009177 | Ga0105248_10016269 | Ga0105248_100162693 | 210 |
| 273 | 3300009177 | Ga0105248_10028019 | Ga0105248_100280193 | 210 |
| 274 | 3300009553 | Ga0105249_10005899 | Ga0105249_1000589910 | 210 |
| 275 | 3300009553 | Ga0105249_10010239 | Ga0105249_100102395 | 210 |
| 276 | 3300009553 | Ga0105249_10118624 | Ga0105249_101186242 | 210 |
| 277 | 3300009553 | Ga0105249_10165713 | Ga0105249_101657132 | 210 |
| 278 | 3300010375 | Ga0105239_10016348 | Ga0105239_100163483 | 210 |
| 279 | 3300010375 | Ga0105239_10068167 | Ga0105239_100681672 | 210 |
| 280 | 3300010375 | Ga0105239_10221523 | Ga0105239_102215233 | 210 |
| 281 | 3300010375 | Ga0105239_10274783 | Ga0105239_102747833 | 210 |
| 282 | 3300010375 | Ga0105239_10365628 | Ga0105239_103656282 | 210 |
| 283 | 3300010375 | Ga0105239_10448867 | Ga0105239_104488672 | 210 |
| 284 | 3300010375 | Ga0105239_10483589 | Ga0105239_104835892 | 210 |
| 285 | 3300010375 | Ga0105239_11296706 | Ga0105239_112967062 | 210 |
| 286 | 3300011119 | Ga0105246_10014865 | Ga0105246_100148651 | 210 |
| 287 | 3300011119 | Ga0105246_10048970 | Ga0105246_100489704 | 210 |
| 288 | 3300011119 | Ga0105246_10097548 | Ga0105246_100975483 | 210 |
| 289 | 3300011119 | Ga0105246_10695907 | Ga0105246_106959072 | 210 |
| 290 | 3300012513 | Ga0157326_1003426 | Ga0157326_10034262 | 210 |
| 291 | 3300013102 | Ga0157371_10382498 | Ga0157371_103824982 | 210 |
| 292 | 3300013104 | Ga0157370_10727876 | Ga0157370_107278762 | 210 |
| 293 | 3300013296 | Ga0157374_10027019 | Ga0157374_100270196 | 210 |
| 294 | 3300013296 | Ga0157374_10755389 | Ga0157374_107553891 | 210 |
| 295 | 3300013296 | Ga0157374_11282337 | Ga0157374_112823371 | 210 |
| 296 | 3300013297 | Ga0157378_10003292 | Ga0157378_100032922 | 210 |
| 297 | 3300013297 | Ga0157378_10313731 | Ga0157378_103137312 | 210 |
| 298 | 3300013297 | Ga0157378_10392079 | Ga0157378_103920793 | 210 |
| 299 | 3300013297 | Ga0157378_10668191 | Ga0157378_106681912 | 210 |
| 300 | 3300013297 | Ga0157378_11109492 | Ga0157378_111094922 | 210 |
| 301 | 3300013306 | Ga0163162_10021368 | Ga0163162_100213684 | 210 |
| 302 | 3300013306 | Ga0163162_10147406 | Ga0163162_101474063 | 210 |
| 303 | 3300013306 | Ga0163162_10512157 | Ga0163162_105121571 | 210 |
| 304 | 3300013307 | Ga0157372_10136991 | Ga0157372_101369912 | 210 |
| 305 | 3300013307 | Ga0157372_10825895 | Ga0157372_108258952 | 210 |
| 306 | 3300013308 | Ga0157375_10297863 | Ga0157375_102978631 | 210 |
| 307 | 3300013308 | Ga0157375_10320764 | Ga0157375_103207642 | 210 |
| 308 | 3300013308 | Ga0157375_11602502 | Ga0157375_116025021 | 210 |
| 309 | 3300014325 | Ga0163163_10933068 | Ga0163163_109330681 | 210 |
| 310 | 3300014326 | Ga0157380_10249533 | Ga0157380_102495332 | 210 |
| 311 | 3300014326 | Ga0157380_10266617 | Ga0157380_102666172 | 210 |
| 312 | 3300014326 | Ga0157380_10443939 | Ga0157380_104439392 | 210 |
| 313 | 3300014745 | Ga0157377_10005732 | Ga0157377_100057324 | 210 |
| 314 | 3300014745 | Ga0157377_10223984 | Ga0157377_102239842 | 210 |
| 315 | 3300014745 | Ga0157377_10273523 | Ga0157377_102735232 | 210 |
| 316 | 3300014968 | Ga0157379_10466959 | Ga0157379_104669592 | 210 |
| 317 | 3300014968 | Ga0157379_11060156 | Ga0157379_110601561 | 210 |
| 318 | 3300014969 | Ga0157376_10003946 | Ga0157376_100039463 | 210 |
| 319 | 3300014969 | Ga0157376_10220390 | Ga0157376_102203902 | 210 |
| 320 | 3300014969 | Ga0157376_10249571 | Ga0157376_102495712 | 210 |
| 321 | 3300017792 | Ga0163161_10261123 | Ga0163161_102611232 | 210 |
| 322 | 3300017792 | Ga0163161_10641014 | Ga0163161_106410142 | 210 |
| 323 | 3300017792 | Ga0163161_10666384 | Ga0163161_106663842 | 210 |
| 324 | 3300017792 | Ga0163161_10750433 | Ga0163161_107504331 | 210 |
| 325 | 3300025885 | Ga0207653_10003551 | Ga0207653_100035512 | 210 |
| 326 | 3300025898 | Ga0207692_10008001 | Ga0207692_100080013 | 210 |
| 327 | 3300025898 | Ga0207692_10013934 | Ga0207692_100139342 | 210 |
| 328 | 3300025898 | Ga0207692_10265080 | Ga0207692_102650801 | 210 |
| 329 | 3300025898 | Ga0207692_10377971 | Ga0207692_103779712 | 210 |
| 330 | 3300025899 | Ga0207642_10210609 | Ga0207642_102106092 | 210 |
| 331 | 3300025900 | Ga0207710_10066670 | Ga0207710_100666702 | 210 |
| 332 | 3300025900 | Ga0207710_10198273 | Ga0207710_101982732 | 210 |
| 333 | 3300025901 | Ga0207688_10014915 | Ga0207688_100149153 | 210 |
| 334 | 3300025901 | Ga0207688_10089866 | Ga0207688_100898663 | 210 |
| 335 | 3300025903 | Ga0207680_10066300 | Ga0207680_100663002 | 210 |
| 336 | 3300025903 | Ga0207680_10234876 | Ga0207680_102348762 | 210 |
| 337 | 3300025904 | Ga0207647_10063868 | Ga0207647_100638682 | 210 |
| 338 | 3300025905 | Ga0207685_10008451 | Ga0207685_100084513 | 210 |
| 339 | 3300025906 | Ga0207699_10012576 | Ga0207699_100125762 | 210 |
| 340 | 3300025906 | Ga0207699_10491786 | Ga0207699_104917862 | 210 |
| 341 | 3300025908 | Ga0207643_10204730 | Ga0207643_102047302 | 210 |
| 342 | 3300025910 | Ga0207684_10185627 | Ga0207684_101856272 | 210 |
| 343 | 3300025910 | Ga0207684_10272202 | Ga0207684_102722021 | 210 |
| 344 | 3300025910 | Ga0207684_10337454 | Ga0207684_103374542 | 210 |
| 345 | 3300025910 | Ga0207684_10350354 | Ga0207684_103503542 | 210 |
| 346 | 3300025910 | Ga0207684_10586701 | Ga0207684_105867012 | 210 |
| 347 | 3300025912 | Ga0207707_10567686 | Ga0207707_105676862 | 210 |
| 348 | 3300025914 | Ga0207671_10205883 | Ga0207671_102058832 | 210 |
| 349 | 3300025915 | Ga0207693_10001284 | Ga0207693_100012846 | 210 |
| 350 | 3300025915 | Ga0207693_10006504 | Ga0207693_100065045 | 210 |
| 351 | 3300025915 | Ga0207693_10032035 | Ga0207693_100320352 | 210 |
| 352 | 3300025915 | Ga0207693_10037393 | Ga0207693_100373933 | 210 |
| 353 | 3300025915 | Ga0207693_10052145 | Ga0207693_100521452 | 210 |
| 354 | 3300025915 | Ga0207693_10060055 | Ga0207693_100600553 | 210 |
| 355 | 3300025915 | Ga0207693_10121881 | Ga0207693_101218813 | 210 |
| 356 | 3300025915 | Ga0207693_10140687 | Ga0207693_101406872 | 210 |
| 357 | 3300025915 | Ga0207693_10157315 | Ga0207693_101573152 | 210 |
| 358 | 3300025915 | Ga0207693_10221563 | Ga0207693_102215632 | 210 |
| 359 | 3300025916 | Ga0207663_10025979 | Ga0207663_100259794 | 210 |
| 360 | 3300025916 | Ga0207663_10028628 | Ga0207663_100286282 | 210 |
| 361 | 3300025916 | Ga0207663_10090891 | Ga0207663_100908912 | 210 |
| 362 | 3300025916 | Ga0207663_10405656 | Ga0207663_104056561 | 210 |
| 363 | 3300025916 | Ga0207663_10405703 | Ga0207663_104057031 | 210 |
| 364 | 3300025916 | Ga0207663_10482980 | Ga0207663_104829802 | 210 |
| 365 | 3300025917 | Ga0207660_10005533 | Ga0207660_100055334 | 210 |
| 366 | 3300025917 | Ga0207660_10050742 | Ga0207660_100507422 | 210 |
| 367 | 3300025917 | Ga0207660_10311713 | Ga0207660_103117132 | 210 |
| 368 | 3300025918 | Ga0207662_10072910 | Ga0207662_100729102 | 210 |
| 369 | 3300025918 | Ga0207662_10226124 | Ga0207662_102261242 | 210 |
| 370 | 3300025918 | Ga0207662_10277881 | Ga0207662_102778812 | 210 |
| 371 | 3300025919 | Ga0207657_10018059 | Ga0207657_100180593 | 210 |
| 372 | 3300025919 | Ga0207657_10138556 | Ga0207657_101385561 | 210 |
| 373 | 3300025919 | Ga0207657_10217456 | Ga0207657_102174561 | 210 |
| 374 | 3300025922 | Ga0207646_10008723 | Ga0207646_100087239 | 210 |
| 375 | 3300025922 | Ga0207646_10073582 | Ga0207646_100735822 | 210 |
| 376 | 3300025922 | Ga0207646_10456857 | Ga0207646_104568572 | 210 |
| 377 | 3300025922 | Ga0207646_10509993 | Ga0207646_105099932 | 210 |
| 378 | 3300025923 | Ga0207681_10062821 | Ga0207681_100628212 | 210 |
| 379 | 3300025923 | Ga0207681_10272223 | Ga0207681_102722231 | 210 |
| 380 | 3300025924 | Ga0207694_10052561 | Ga0207694_100525613 | 210 |
| 381 | 3300025926 | Ga0207659_10062826 | Ga0207659_100628262 | 210 |
| 382 | 3300025927 | Ga0207687_10008519 | Ga0207687_100085195 | 210 |
| 383 | 3300025927 | Ga0207687_10020128 | Ga0207687_100201285 | 210 |
| 384 | 3300025927 | Ga0207687_10020967 | Ga0207687_100209676 | 210 |
| 385 | 3300025927 | Ga0207687_10069743 | Ga0207687_100697432 | 210 |
| 386 | 3300025927 | Ga0207687_10094293 | Ga0207687_100942932 | 210 |
| 387 | 3300025927 | Ga0207687_10121722 | Ga0207687_101217222 | 210 |
| 388 | 3300025927 | Ga0207687_10176832 | Ga0207687_101768323 | 210 |
| 389 | 3300025927 | Ga0207687_10320074 | Ga0207687_103200742 | 210 |
| 390 | 3300025927 | Ga0207687_10348014 | Ga0207687_103480142 | 210 |
| 391 | 3300025928 | Ga0207700_10241177 | Ga0207700_102411771 | 210 |
| 392 | 3300025928 | Ga0207700_10496238 | Ga0207700_104962382 | 210 |
| 393 | 3300025929 | Ga0207664_10024650 | Ga0207664_100246503 | 210 |
| 394 | 3300025929 | Ga0207664_10044801 | Ga0207664_100448013 | 210 |
| 395 | 3300025929 | Ga0207664_10091945 | Ga0207664_100919452 | 210 |
| 396 | 3300025929 | Ga0207664_10146942 | Ga0207664_101469422 | 210 |
| 397 | 3300025929 | Ga0207664_10281634 | Ga0207664_102816342 | 210 |
| 398 | 3300025929 | Ga0207664_10554080 | Ga0207664_105540802 | 210 |
| 399 | 3300025931 | Ga0207644_10057090 | Ga0207644_100570902 | 210 |
| 400 | 3300025932 | Ga0207690_10016283 | Ga0207690_100162832 | 210 |
| 401 | 3300025933 | Ga0207706_10071647 | Ga0207706_100716473 | 210 |
| 402 | 3300025934 | Ga0207686_10001206 | Ga0207686_1000120612 | 210 |
| 403 | 3300025935 | Ga0207709_10003931 | Ga0207709_100039312 | 210 |
| 404 | 3300025935 | Ga0207709_10027468 | Ga0207709_100274683 | 210 |
| 405 | 3300025935 | Ga0207709_10298851 | Ga0207709_102988512 | 210 |
| 406 | 3300025935 | Ga0207709_10314913 | Ga0207709_103149132 | 210 |
| 407 | 3300025935 | Ga0207709_10364676 | Ga0207709_103646761 | 210 |
| 408 | 3300025935 | Ga0207709_10417379 | Ga0207709_104173792 | 210 |
| 409 | 3300025936 | Ga0207670_10248063 | Ga0207670_102480632 | 210 |
| 410 | 3300025936 | Ga0207670_10299454 | Ga0207670_102994542 | 210 |
| 411 | 3300025937 | Ga0207669_10002666 | Ga0207669_100026667 | 210 |
| 412 | 3300025937 | Ga0207669_10366272 | Ga0207669_103662722 | 210 |
| 413 | 3300025937 | Ga0207669_10573678 | Ga0207669_105736782 | 210 |
| 414 | 3300025938 | Ga0207704_10009850 | Ga0207704_100098505 | 210 |
| 415 | 3300025939 | Ga0207665_10005836 | Ga0207665_100058362 | 210 |
| 416 | 3300025939 | Ga0207665_10006154 | Ga0207665_100061545 | 210 |
| 417 | 3300025940 | Ga0207691_10002281 | Ga0207691_100022812 | 210 |
| 418 | 3300025940 | Ga0207691_10137105 | Ga0207691_101371052 | 210 |
| 419 | 3300025941 | Ga0207711_10054269 | Ga0207711_100542693 | 210 |
| 420 | 3300025941 | Ga0207711_10058617 | Ga0207711_100586172 | 210 |
| 421 | 3300025941 | Ga0207711_10391085 | Ga0207711_103910852 | 210 |
| 422 | 3300025941 | Ga0207711_10539737 | Ga0207711_105397372 | 210 |
| 423 | 3300025942 | Ga0207689_10122390 | Ga0207689_101223903 | 210 |
| 424 | 3300025942 | Ga0207689_10397848 | Ga0207689_103978482 | 210 |
| 425 | 3300025944 | Ga0207661_10079431 | Ga0207661_100794312 | 210 |
| 426 | 3300025944 | Ga0207661_10875230 | Ga0207661_108752301 | 210 |
| 427 | 3300025945 | Ga0207679_10211672 | Ga0207679_102116723 | 210 |
| 428 | 3300025949 | Ga0207667_10113528 | Ga0207667_101135283 | 210 |
| 429 | 3300025949 | Ga0207667_10251344 | Ga0207667_102513442 | 210 |
| 430 | 3300025960 | Ga0207651_10088119 | Ga0207651_100881192 | 210 |
| 431 | 3300025960 | Ga0207651_10470845 | Ga0207651_104708452 | 210 |
| 432 | 3300025961 | Ga0207712_10002308 | Ga0207712_100023084 | 210 |
| 433 | 3300025961 | Ga0207712_10003283 | Ga0207712_100032839 | 210 |
| 434 | 3300025961 | Ga0207712_10164844 | Ga0207712_101648441 | 210 |
| 435 | 3300025961 | Ga0207712_10221956 | Ga0207712_102219562 | 210 |
| 436 | 3300025972 | Ga0207668_10137283 | Ga0207668_101372832 | 210 |
| 437 | 3300025981 | Ga0207640_10128658 | Ga0207640_101286583 | 210 |
| 438 | 3300025981 | Ga0207640_10253849 | Ga0207640_102538492 | 210 |
| 439 | 3300025981 | Ga0207640_10380858 | Ga0207640_103808582 | 210 |
| 440 | 3300025981 | Ga0207640_10590376 | Ga0207640_105903761 | 210 |
| 441 | 3300025981 | Ga0207640_10735027 | Ga0207640_107350272 | 210 |
| 442 | 3300025986 | Ga0207658_10155201 | Ga0207658_101552012 | 210 |
| 443 | 3300026023 | Ga0207677_10059489 | Ga0207677_100594892 | 210 |
| 444 | 3300026023 | Ga0207677_10273528 | Ga0207677_102735282 | 210 |
| 445 | 3300026035 | Ga0207703_10152178 | Ga0207703_101521782 | 210 |
| 446 | 3300026035 | Ga0207703_10241664 | Ga0207703_102416642 | 210 |
| 447 | 3300026035 | Ga0207703_10543577 | Ga0207703_105435772 | 210 |
| 448 | 3300026067 | Ga0207678_10050160 | Ga0207678_100501602 | 210 |
| 449 | 3300026067 | Ga0207678_10105012 | Ga0207678_101050122 | 210 |
| 450 | 3300026075 | Ga0207708_10000370 | Ga0207708_100003703 | 210 |
| 451 | 3300026075 | Ga0207708_10004615 | Ga0207708_100046155 | 210 |
| 452 | 3300026075 | Ga0207708_10056212 | Ga0207708_100562123 | 210 |
| 453 | 3300026078 | Ga0207702_10002526 | Ga0207702_1000252610 | 210 |
| 454 | 3300026078 | Ga0207702_10039342 | Ga0207702_100393422 | 210 |
| 455 | 3300026078 | Ga0207702_10699333 | Ga0207702_106993332 | 210 |
| 456 | 3300026078 | Ga0207702_11175542 | Ga0207702_111755421 | 210 |
| 457 | 3300026089 | Ga0207648_10001656 | Ga0207648_1000165611 | 210 |
| 458 | 3300026089 | Ga0207648_10097415 | Ga0207648_100974152 | 210 |
| 459 | 3300026089 | Ga0207648_10171342 | Ga0207648_101713423 | 210 |
| 460 | 3300026116 | Ga0207674_10076445 | Ga0207674_100764454 | 210 |
| 461 | 3300026118 | Ga0207675_100001023 | Ga0207675_10000102320 | 210 |
| 462 | 3300026118 | Ga0207675_100022607 | Ga0207675_1000226073 | 210 |
| 463 | 3300026118 | Ga0207675_100060576 | Ga0207675_1000605762 | 210 |
| 464 | 3300026118 | Ga0207675_100226238 | Ga0207675_1002262382 | 210 |
| 465 | 3300026121 | Ga0207683_10000703 | Ga0207683_1000070315 | 210 |
| 466 | 3300026121 | Ga0207683_10009220 | Ga0207683_100092203 | 210 |
| 467 | 3300026121 | Ga0207683_10126376 | Ga0207683_101263761 | 210 |
| 468 | 3300026121 | Ga0207683_10143997 | Ga0207683_101439973 | 210 |
| 469 | 3300026121 | Ga0207683_10466671 | Ga0207683_104666712 | 210 |
| 470 | 3300026142 | Ga0207698_10038122 | Ga0207698_100381223 | 210 |
| 471 | 3300026142 | Ga0207698_10122567 | Ga0207698_101225672 | 210 |
| 472 | 3300026142 | Ga0207698_10892497 | Ga0207698_108924971 | 210 |
| 473 | 3300027671 | Ga0209588_1011697 | Ga0209588_10116973 | 210 |
| 474 | 3300027907 | Ga0207428_10040067 | Ga0207428_100400674 | 210 |
| 475 | 3300027907 | Ga0207428_10272174 | Ga0207428_102721742 | 210 |
| 476 | 3300027907 | Ga0207428_10394461 | Ga0207428_103944612 | 210 |
| 477 | 3300028379 | Ga0268266_10213335 | Ga0268266_102133352 | 210 |
| 478 | 3300028380 | Ga0268265_10143944 | Ga0268265_101439442 | 210 |
| 479 | 3300028380 | Ga0268265_10145349 | Ga0268265_101453492 | 210 |
| 480 | 3300028381 | Ga0268264_10055989 | Ga0268264_100559892 | 210 |
| 481 | 3300028381 | Ga0268264_10292317 | Ga0268264_102923172 | 210 |
| 482 | 3300028381 | Ga0268264_10292745 | Ga0268264_102927452 | 210 |
| 483 | 3300028786 | Ga0307517_10054449 | Ga0307517_100544492 | 210 |
| 484 | 3300031456 | Ga0307513_10608716 | Ga0307513_106087162 | 210 |
| 485 | 3300034820 | Ga0373959_0010858 | Ga0373959_0010858_705_1379 | 210 |
| 486 | 3300034957 | Ga0373938_0008959 | Ga0373938_0008959_485_1159 | 210 |
| 487 | 3300035083 | Ga0373926_0020889 | Ga0373926_0020889_1223_1888 | 210 |
| 488 | 3300035089 | Ga0373944_0032996 | Ga0373944_0032996_541_1206 | 210 |
| 489 | 3300035090 | Ga0373949_0007870 | Ga0373949_0007870_707_1381 | 210 |
| 490 | 3300035091 | Ga0373951_0009558 | Ga0373951_0009558_415_1089 | 210 |
| 491 | 3300035092 | Ga0373952_0007667 | Ga0373952_0007667_531_1205 | 210 |
| 492 | 3300035112 | Ga0373932_0013893 | Ga0373932_0013893_581_1255 | 210 |
| 493 | 3300035115 | Ga0373941_0025398 | Ga0373941_0025398_938_1612 | 210 |
| 494 | 3300035121 | Ga0373960_0096175 | Ga0373960_0096175_212_889 | 210 |
| 495 | 3300035170 | Ga0373943_0006763 | Ga0373943_0006763_1062_1727 | 210 |
| 496 | 3300035171 | Ga0373946_0116250 | Ga0373946_0116250_346_1011 | 210 |
| 497 | 3300035241 | Ga0373961_0022069 | Ga0373961_0022069_881_1555 | 210 |
| 498 | 3300035242 | Ga0373962_0065885 | Ga0373962_0065885_158_832 | 210 |
| 499 | 3300035691 | Ga0373931_0180667 | Ga0373931_0180667_165_824 | 210 |
| 500 | 3300035695 | Ga0373927_0121010 | Ga0373927_0121010_217_882 | 210 |
| 501 | 3300035725 | Ga0373947_0004379 | Ga0373947_0004379_6647_7312 | 210 |
| 502 | 3300036401 | Ga0373937_0759326 | Ga0373937_0759326_204_863 | 210 |
| 503 | 3300037068 | Ga0373925_0007097 | Ga0373925_0007097_2414_3079 | 210 |
| 504 | 3300037068 | Ga0373925_0548947 | Ga0373925_0548947_219_878 | 210 |
| 505 | 3300045051 | Ga0451576_1166587 | Ga0451576_1166587_47_724 | 210 |
| 506 | 3300046452 | Ga0495617_104559 | Ga0495617_104559_103_780 | 210 |
| 507 | 3300046454 | Ga0495592_0031672 | Ga0495592_0031672_2903_3568 | 210 |
| 508 | 3300046455 | Ga0495603_0000598 | Ga0495603_0000598_9601_10260 | 210 |
| 509 | 3300046459 | Ga0495629_0006073 | Ga0495629_0006073_3660_4319 | 210 |
| 510 | 3300046459 | Ga0495629_0027320 | Ga0495629_0027320_656_1321 | 210 |
| 511 | 3300046461 | Ga0495641_0008494 | Ga0495641_0008494_5258_5923 | 210 |
| 512 | 3300046463 | Ga0495653_0103112 | Ga0495653_0103112_86_751 | 210 |
| 513 | 3300046472 | Ga0495580_0014040 | Ga0495580_0014040_1826_2491 | 210 |
| 514 | 3300046473 | Ga0495582_0001037 | Ga0495582_0001037_12172_12837 | 210 |
| 515 | 3300046475 | Ga0495639_0005017 | Ga0495639_0005017_2240_2905 | 210 |
| 516 | 3300046476 | Ga0495662_0001596 | Ga0495662_0001596_8726_9391 | 210 |
| 517 | 3300046491 | Ga0495584_0125112 | Ga0495584_0125112_302_955 | 210 |
| 518 | 3300046499 | Ga0495594_0000152 | Ga0495594_0000152_10507_11166 | 210 |
| 519 | 3300046499 | Ga0495594_0282436 | Ga0495594_0282436_98_757 | 210 |
| 520 | 3300046501 | Ga0495607_0074576 | Ga0495607_0074576_486_1163 | 210 |
| 521 | 3300046515 | Ga0495620_0009203 | Ga0495620_0009203_386_1045 | 210 |
| 522 | 3300046517 | Ga0495630_0040708 | Ga0495630_0040708_77_742 | 210 |
| 523 | 3300046517 | Ga0495630_0105465 | Ga0495630_0105465_1146_1811 | 210 |
| 524 | 3300046519 | Ga0495632_0022092 | Ga0495632_0022092_1762_2421 | 210 |
| 525 | 3300046520 | Ga0495637_0070353 | Ga0495637_0070353_454_1113 | 210 |
| 526 | 3300046522 | Ga0495643_0005524 | Ga0495643_0005524_1124_1783 | 210 |
| 527 | 3300046523 | Ga0495644_0099882 | Ga0495644_0099882_279_959 | 210 |
| 528 | 3300046526 | Ga0495666_0005591 | Ga0495666_0005591_4410_5075 | 210 |
| 529 | 3300046526 | Ga0495666_0009431 | Ga0495666_0009431_3765_4424 | 210 |
| 530 | 3300046531 | Ga0495665_0006283 | Ga0495665_0006283_483_1148 | 210 |
| 531 | 3300046533 | Ga0495640_0032279 | Ga0495640_0032279_2585_3250 | 210 |
| 532 | 3300046535 | Ga0495586_0030816 | Ga0495586_0030816_1907_2572 | 210 |
| 533 | 3300046543 | Ga0495645_0258558 | Ga0495645_0258558_246_911 | 210 |
| 534 | 3300046557 | Ga0495622_0000291 | Ga0495622_0000291_21967_22626 | 210 |
| 535 | 3300046559 | Ga0495667_0071040 | Ga0495667_0071040_283_948 | 210 |
| 536 | 3300046615 | Ga0495656_0135992 | Ga0495656_0135992_70_735 | 210 |
| 537 | 3300046664 | Ga0495659_0048643 | Ga0495659_0048643_387_1064 | 210 |
| 538 | 3300046664 | Ga0495659_0106752 | Ga0495659_0106752_344_1009 | 210 |
| 539 | 3300046678 | Ga0495599_0268590 | Ga0495599_0268590_146_811 | 210 |
| 540 | 3300046680 | Ga0495646_0175064 | Ga0495646_0175064_236_901 | 210 |
| 541 | 3300046681 | Ga0495647_0000716 | Ga0495647_0000716_1763_2428 | 210 |
| 542 | 3300046683 | Ga0495658_0004324 | Ga0495658_0004324_482_1147 | 210 |
| 543 | 3300046683 | Ga0495658_0215409 | Ga0495658_0215409_48_713 | 210 |
| 544 | 3300046689 | Ga0495613_0004872 | Ga0495613_0004872_9243_9902 | 210 |
| 545 | 3300046690 | Ga0495624_0023521 | Ga0495624_0023521_2136_2795 | 210 |
| 546 | 3300046690 | Ga0495624_0046134 | Ga0495624_0046134_1857_2522 | 210 |
| 547 | 3300046691 | Ga0495670_0283235 | Ga0495670_0283235_63_740 | 210 |
| 548 | 3300046692 | Ga0495671_0217225 | Ga0495671_0217225_32_742 | 210 |
| 549 | 3300046694 | Ga0495649_0130661 | Ga0495649_0130661_505_1164 | 210 |
| 550 | 3300046794 | Ga0495589_0160956 | Ga0495589_0160956_89_748 | 210 |
| 551 | 3300047315 | Ga0495581_0008820 | Ga0495581_0008820_2982_3647 | 210 |
| 552 | 3300047319 | Ga0495674_0031944 | Ga0495674_0031944_2577_3242 | 210 |
| 553 | 3300047319 | Ga0495674_0060097 | Ga0495674_0060097_784_1449 | 210 |
| 554 | 3300047319 | Ga0495674_0240599 | Ga0495674_0240599_319_984 | 210 |
| 555 | 3300047320 | Ga0495672_0267083 | Ga0495672_0267083_54_713 | 210 |
| 556 | 3300047321 | Ga0495676_0000619 | Ga0495676_0000619_20889_21548 | 210 |
| 557 | 3300047321 | Ga0495676_0053837 | Ga0495676_0053837_1261_1926 | 210 |
| 558 | 3300047323 | Ga0495683_0022209 | Ga0495683_0022209_763_1422 | 210 |
| 559 | 3300047443 | Ga0495687_004680 | Ga0495687_004680_4462_5121 | 210 |
| 560 | 3300047470 | Ga0495681_0010923 | Ga0495681_0010923_1465_2124 | 210 |
| 561 | 3300047673 | Ga0495593_0007555 | Ga0495593_0007555_3780_4445 | 210 |
| 562 | 3300048088 | Ga0495602_0204919 | Ga0495602_0204919_564_1253 | 210 |
| 563 | 3300048089 | Ga0495614_0000555 | Ga0495614_0000555_1388_2047 | 210 |
| 564 | 3300048089 | Ga0495614_0004055 | Ga0495614_0004055_5445_6110 | 210 |
| 565 | 3300048091 | Ga0495626_0092082 | Ga0495626_0092082_652_1311 | 210 |
| 566 | 3300048903 | Ga0496100_0006109 | Ga0496100_0006109_5595_6278 | 210 |
| 567 | 3300048903 | Ga0496100_0015781 | Ga0496100_0015781_2659_3336 | 210 |
| 568 | 3300048903 | Ga0496100_0061036 | Ga0496100_0061036_712_1377 | 210 |
| 569 | 3300048903 | Ga0496100_0144801 | Ga0496100_0144801_163_837 | 210 |
| 570 | 3300048903 | Ga0496100_0413172 | Ga0496100_0413172_304_966 | 210 |
| 571 | 3300048903 | Ga0496100_0622723 | Ga0496100_0622723_53_718 | 210 |
| 572 | 3300048904 | Ga0496101_0001011 | Ga0496101_0001011_15702_16367 | 210 |
| 573 | 3300048904 | Ga0496101_0001309 | Ga0496101_0001309_7459_8136 | 210 |
| 574 | 3300048904 | Ga0496101_0012823 | Ga0496101_0012823_1618_2283 | 210 |
| 575 | 3300048904 | Ga0496101_0033450 | Ga0496101_0033450_735_1409 | 210 |
| 576 | 3300048904 | Ga0496101_0054251 | Ga0496101_0054251_2189_2851 | 210 |
| 577 | 3300048904 | Ga0496101_0088467 | Ga0496101_0088467_804_1478 | 210 |
| 578 | 3300048904 | Ga0496101_0170031 | Ga0496101_0170031_483_1160 | 210 |
| 579 | 3300048904 | Ga0496101_0185972 | Ga0496101_0185972_687_1370 | 210 |
| 580 | 3300048904 | Ga0496101_0229591 | Ga0496101_0229591_727_1392 | 210 |
| 581 | 3300048905 | Ga0496102_0003745 | Ga0496102_0003745_2774_3457 | 210 |
| 582 | 3300048905 | Ga0496102_0006061 | Ga0496102_0006061_4168_4833 | 210 |
| 583 | 3300048905 | Ga0496102_0016789 | Ga0496102_0016789_3147_3812 | 210 |
| 584 | 3300048905 | Ga0496102_0022931 | Ga0496102_0022931_213_887 | 210 |
| 585 | 3300048905 | Ga0496102_0047488 | Ga0496102_0047488_2083_2745 | 210 |
| 586 | 3300048905 | Ga0496102_0188174 | Ga0496102_0188174_101_778 | 210 |
| 587 | 3300048905 | Ga0496102_0355082 | Ga0496102_0355082_124_789 | 210 |
| 588 | 3300048905 | Ga0496102_0738420 | Ga0496102_0738420_167_832 | 210 |
| 589 | 3300048905 | Ga0496102_0851750 | Ga0496102_0851750_107_766 | 210 |
| 590 | 3300048906 | Ga0496103_0003723 | Ga0496103_0003723_6018_6701 | 210 |
| 591 | 3300048906 | Ga0496103_0009427 | Ga0496103_0009427_3431_4105 | 210 |
| 592 | 3300048906 | Ga0496103_0051436 | Ga0496103_0051436_1831_2508 | 210 |
| 593 | 3300048906 | Ga0496103_0080589 | Ga0496103_0080589_128_793 | 210 |
| 594 | 3300048906 | Ga0496103_0166566 | Ga0496103_0166566_169_831 | 210 |
| 595 | 3300048907 | Ga0496104_0000504 | Ga0496104_0000504_26663_27328 | 210 |
| 596 | 3300048907 | Ga0496104_0004535 | Ga0496104_0004535_8787_9449 | 210 |
| 597 | 3300048907 | Ga0496104_0008804 | Ga0496104_0008804_2419_3087 | 210 |
| 598 | 3300048907 | Ga0496104_0032463 | Ga0496104_0032463_457_1131 | 210 |
| 599 | 3300048907 | Ga0496104_0045978 | Ga0496104_0045978_1009_1683 | 210 |
| 600 | 3300048907 | Ga0496104_0098429 | Ga0496104_0098429_615_1280 | 210 |
| 601 | 3300048907 | Ga0496104_0444360 | Ga0496104_0444360_272_955 | 210 |
| 602 | 3300048907 | Ga0496104_0903256 | Ga0496104_0903256_32_712 | 210 |
| 603 | 3300048908 | Ga0496105_0052553 | Ga0496105_0052553_1283_1951 | 210 |
| 604 | 3300048908 | Ga0496105_0072489 | Ga0496105_0072489_774_1448 | 210 |
| 605 | 3300048908 | Ga0496105_0085161 | Ga0496105_0085161_448_1131 | 210 |
| 606 | 3300048909 | Ga0496106_0001207 | Ga0496106_0001207_9465_10148 | 210 |
| 607 | 3300048909 | Ga0496106_0005486 | Ga0496106_0005486_1753_2418 | 210 |
| 608 | 3300048909 | Ga0496106_0080320 | Ga0496106_0080320_787_1449 | 210 |
| 609 | 3300048909 | Ga0496106_0119329 | Ga0496106_0119329_1255_1932 | 210 |
| 610 | 3300048909 | Ga0496106_0195850 | Ga0496106_0195850_498_1166 | 210 |
| 611 | 3300048909 | Ga0496106_0206736 | Ga0496106_0206736_817_1482 | 210 |
| 612 | 3300048909 | Ga0496106_0207534 | Ga0496106_0207534_451_1110 | 210 |
| 613 | 3300048910 | Ga0496107_0001691 | Ga0496107_0001691_12811_13494 | 210 |
| 614 | 3300048910 | Ga0496107_0001719 | Ga0496107_0001719_317_985 | 210 |
| 615 | 3300048910 | Ga0496107_0007634 | Ga0496107_0007634_948_1610 | 210 |
| 616 | 3300048910 | Ga0496107_0011965 | Ga0496107_0011965_740_1402 | 210 |
| 617 | 3300048910 | Ga0496107_0015197 | Ga0496107_0015197_152_817 | 210 |
| 618 | 3300048910 | Ga0496107_0026101 | Ga0496107_0026101_738_1427 | 210 |
| 619 | 3300048910 | Ga0496107_0063786 | Ga0496107_0063786_145_822 | 210 |
| 620 | 3300048910 | Ga0496107_0065556 | Ga0496107_0065556_1244_1918 | 210 |
| 621 | 3300048910 | Ga0496107_0114715 | Ga0496107_0114715_528_1193 | 210 |
| 622 | 3300048910 | Ga0496107_0358768 | Ga0496107_0358768_255_929 | 210 |
| 623 | 3300048911 | Ga0496108_0011148 | Ga0496108_0011148_5653_6327 | 210 |
| 624 | 3300048911 | Ga0496108_0042143 | Ga0496108_0042143_2806_3474 | 210 |
| 625 | 3300048911 | Ga0496108_0048746 | Ga0496108_0048746_1708_2367 | 210 |
| 626 | 3300048911 | Ga0496108_0055349 | Ga0496108_0055349_1399_2064 | 210 |
| 627 | 3300048911 | Ga0496108_0171658 | Ga0496108_0171658_442_1107 | 210 |
| 628 | 3300048911 | Ga0496108_0888307 | Ga0496108_0888307_80_742 | 210 |
| 629 | 3300048912 | Ga0496109_0010571 | Ga0496109_0010571_1444_2109 | 210 |
| 630 | 3300048912 | Ga0496109_0012446 | Ga0496109_0012446_2120_2800 | 210 |
| 631 | 3300048912 | Ga0496109_0022799 | Ga0496109_0022799_2425_3093 | 210 |
| 632 | 3300048912 | Ga0496109_0109284 | Ga0496109_0109284_628_1302 | 210 |
| 633 | 3300048912 | Ga0496109_0161813 | Ga0496109_0161813_949_1626 | 210 |
| 634 | 3300048912 | Ga0496109_0580681 | Ga0496109_0580681_223_882 | 210 |
| 635 | 3300048912 | Ga0496109_0722084 | Ga0496109_0722084_89_751 | 210 |
| 636 | 3300048913 | Ga0496110_0007496 | Ga0496110_0007496_4483_5151 | 210 |
| 637 | 3300048913 | Ga0496110_0281207 | Ga0496110_0281207_446_1123 | 210 |
| 638 | 3300048914 | Ga0496111_0060985 | Ga0496111_0060985_1314_1988 | 210 |
| 639 | 3300048914 | Ga0496111_0122647 | Ga0496111_0122647_876_1556 | 210 |
| 640 | 3300048914 | Ga0496111_0253520 | Ga0496111_0253520_155_814 | 210 |
| 641 | 3300048914 | Ga0496111_0551425 | Ga0496111_0551425_14_691 | 210 |
| 642 | 3300048915 | Ga0496112_0076010 | Ga0496112_0076010_988_1653 | 210 |
| 643 | 3300048915 | Ga0496112_0151700 | Ga0496112_0151700_348_1031 | 210 |
| 644 | 3300048915 | Ga0496112_0229228 | Ga0496112_0229228_157_831 | 210 |
| 645 | 3300048915 | Ga0496112_0358341 | Ga0496112_0358341_483_1163 | 210 |
| 646 | 3300048915 | Ga0496112_0569465 | Ga0496112_0569465_180_857 | 210 |
| 647 | 3300048916 | Ga0496113_0078498 | Ga0496113_0078498_1729_2394 | 210 |
| 648 | 3300048916 | Ga0496113_0578546 | Ga0496113_0578546_41_706 | 210 |
| 649 | 3300048917 | Ga0496114_0001293 | Ga0496114_0001293_12669_13352 | 210 |
| 650 | 3300048917 | Ga0496114_0002456 | Ga0496114_0002456_9315_9983 | 210 |
| 651 | 3300048917 | Ga0496114_0005072 | Ga0496114_0005072_3089_3751 | 210 |
| 652 | 3300048917 | Ga0496114_0014102 | Ga0496114_0014102_2203_2868 | 210 |
| 653 | 3300048917 | Ga0496114_0057318 | Ga0496114_0057318_2247_2912 | 210 |
| 654 | 3300048917 | Ga0496114_0074261 | Ga0496114_0074261_1888_2562 | 210 |
| 655 | 3300048917 | Ga0496114_0208835 | Ga0496114_0208835_703_1368 | 210 |
| 656 | 3300048917 | Ga0496114_0241185 | Ga0496114_0241185_316_990 | 210 |
| 657 | 3300048918 | Ga0496115_0000227 | Ga0496115_0000227_27729_28391 | 210 |
| 658 | 3300048918 | Ga0496115_0000867 | Ga0496115_0000867_16005_16670 | 210 |
| 659 | 3300048918 | Ga0496115_0005762 | Ga0496115_0005762_201_884 | 210 |
| 660 | 3300048918 | Ga0496115_0009699 | Ga0496115_0009699_6073_6741 | 210 |
| 661 | 3300048918 | Ga0496115_0045364 | Ga0496115_0045364_1451_2116 | 210 |
| 662 | 3300048918 | Ga0496115_0102836 | Ga0496115_0102836_1274_1948 | 210 |
| 663 | 3300048918 | Ga0496115_0113090 | Ga0496115_0113090_246_923 | 210 |
| 664 | 3300048918 | Ga0496115_0385457 | Ga0496115_0385457_201_878 | 210 |
| 665 | 3300048918 | Ga0496115_0493958 | Ga0496115_0493958_88_765 | 210 |
| 666 | 3300048929 | Ga0496126_0082413 | Ga0496126_0082413_1162_1821 | 210 |
| 667 | 3300049583 | Ga0501067_0003444 | Ga0501067_0003444_3040_3708 | 210 |
| 668 | 3300049584 | Ga0501068_0136269 | Ga0501068_0136269_388_1056 | 210 |
| 669 | 3300049585 | Ga0501069_0001535 | Ga0501069_0001535_5515_6183 | 210 |
| 670 | 3300050492 | nmdc:mga0yw44_207261_c1 | nmdc:mga0yw44_207261_c1_236_934 | 210 |
| 671 | 3300050507 | nmdc:mga05p37_168613_c1 | nmdc:mga05p37_168613_c1_653_1330 | 210 |
| 672 | 3300050507 | nmdc:mga05p37_24796_c1 | nmdc:mga05p37_24796_c1_1667_2362 | 210 |
| 673 | 3300050507 | nmdc:mga05p37_290016_c1 | nmdc:mga05p37_290016_c1_605_1258 | 210 |
| 674 | 3300050507 | nmdc:mga05p37_356227_c1 | nmdc:mga05p37_356227_c1_971_1636 | 210 |
| 675 | 3300050507 | nmdc:mga05p37_481826_c1 | nmdc:mga05p37_481826_c1_514_1179 | 210 |
| 676 | 3300050507 | nmdc:mga05p37_5975_c1 | nmdc:mga05p37_5975_c1_5772_6449 | 210 |
| 677 | 3300050507 | nmdc:mga05p37_821736_c1 | nmdc:mga05p37_821736_c1_261_926 | 210 |
| 678 | 3300050508 | nmdc:mga09592_100092_c1 | nmdc:mga09592_100092_c1_1688_2341 | 210 |
| 679 | 3300050508 | nmdc:mga09592_266179_c1 | nmdc:mga09592_266179_c1_328_993 | 210 |
| 680 | 3300050508 | nmdc:mga09592_470914_c1 | nmdc:mga09592_470914_c1_310_975 | 210 |
| 681 | 3300050508 | nmdc:mga09592_635705_c1 | nmdc:mga09592_635705_c1_66_719 | 210 |
| 682 | 3300050508 | nmdc:mga09592_69793_c1 | nmdc:mga09592_69793_c1_2016_2693 | 210 |
| 683 | 3300050508 | nmdc:mga09592_99263_c1 | nmdc:mga09592_99263_c1_1293_1988 | 210 |
| 684 | 3300050510 | nmdc:mga06r32_33429_c1 | nmdc:mga06r32_33429_c1_3111_3806 | 210 |
| 685 | 3300050510 | nmdc:mga06r32_5648_c1 | nmdc:mga06r32_5648_c1_4838_5515 | 210 |
| 686 | 3300050511 | nmdc:mga08y16_188440_c1 | nmdc:mga08y16_188440_c1_1391_2068 | 210 |
| 687 | 3300050511 | nmdc:mga08y16_20726_c1 | nmdc:mga08y16_20726_c1_1391_2068 | 210 |
| 688 | 3300050511 | nmdc:mga08y16_58431_c1 | nmdc:mga08y16_58431_c1_2822_3487 | 210 |
| 689 | 3300050511 | nmdc:mga08y16_914685_c1 | nmdc:mga08y16_914685_c1_74_739 | 210 |
| 690 | 3300050512 | nmdc:mga0n895_157998_c1 | nmdc:mga0n895_157998_c1_906_1583 | 210 |
| 691 | 3300050512 | nmdc:mga0n895_17713_c1 | nmdc:mga0n895_17713_c1_1160_1840 | 210 |
| 692 | 3300050512 | nmdc:mga0n895_2041_c1 | nmdc:mga0n895_2041_c1_619_1284 | 210 |
| 693 | 3300050512 | nmdc:mga0n895_282700_c1 | nmdc:mga0n895_282700_c1_331_993 | 210 |
| 694 | 3300050512 | nmdc:mga0n895_360874_c1 | nmdc:mga0n895_360874_c1_793_1458 | 210 |
| 695 | 3300050512 | nmdc:mga0n895_45110_c1 | nmdc:mga0n895_45110_c1_983_1630 | 210 |
| 696 | 3300050512 | nmdc:mga0n895_466616_c1 | nmdc:mga0n895_466616_c1_214_876 | 210 |
| 697 | 3300050512 | nmdc:mga0n895_49212_c1 | nmdc:mga0n895_49212_c1_2822_3487 | 210 |
| 698 | 3300050512 | nmdc:mga0n895_71944_c1 | nmdc:mga0n895_71944_c1_829_1494 | 210 |
| 699 | 3300050513 | nmdc:mga0rr50_112785_c1 | nmdc:mga0rr50_112785_c1_169_834 | 210 |
| 700 | 3300050513 | nmdc:mga0rr50_138622_c1 | nmdc:mga0rr50_138622_c1_19_699 | 210 |
| 701 | 3300050513 | nmdc:mga0rr50_18740_c1 | nmdc:mga0rr50_18740_c1_108_773 | 210 |
| 702 | 3300050513 | nmdc:mga0rr50_325049_c1 | nmdc:mga0rr50_325049_c1_272_961 | 210 |
| 703 | 3300050513 | nmdc:mga0rr50_570_c1 | nmdc:mga0rr50_570_c1_10449_11114 | 210 |
| 704 | 3300050513 | nmdc:mga0rr50_592128_c1 | nmdc:mga0rr50_592128_c1_136_801 | 210 |
| 705 | 3300050514 | nmdc:mga08x19_100460_c1 | nmdc:mga08x19_100460_c1_845_1510 | 210 |
| 706 | 3300050514 | nmdc:mga08x19_126266_c1 | nmdc:mga08x19_126266_c1_299_952 | 210 |
| 707 | 3300050514 | nmdc:mga08x19_21664_c1 | nmdc:mga08x19_21664_c1_2200_2865 | 210 |
| 708 | 3300050514 | nmdc:mga08x19_9820_c1 | nmdc:mga08x19_9820_c1_3780_4445 | 210 |
| 709 | 3300050515 | nmdc:mga0a205_307063_c1 | nmdc:mga0a205_307063_c1_211_876 | 210 |
| 710 | 3300050515 | nmdc:mga0a205_325338_c1 | nmdc:mga0a205_325338_c1_593_1246 | 210 |
| 711 | 3300050515 | nmdc:mga0a205_386812_c1 | nmdc:mga0a205_386812_c1_39_704 | 210 |
| 712 | 3300050515 | nmdc:mga0a205_426513_c1 | nmdc:mga0a205_426513_c1_163_828 | 210 |
| 713 | 3300050515 | nmdc:mga0a205_431322_c1 | nmdc:mga0a205_431322_c1_165_842 | 210 |
| 714 | 3300050515 | nmdc:mga0a205_462629_c1 | nmdc:mga0a205_462629_c1_80_742 | 210 |
| 715 | 3300050515 | nmdc:mga0a205_908162_c1 | nmdc:mga0a205_908162_c1_56_709 | 210 |
| 716 | 3300050516 | nmdc:mga0sz30_18404_c2 | nmdc:mga0sz30_18404_c2_1661_2323 | 210 |
| 717 | 3300053077 | Ga0495601_0310265 | Ga0495601_0310265_254_919 | 210 |
| 718 | 3300053085 | Ga0495619_0022226 | Ga0495619_0022226_2239_2904 | 210 |
| 719 | 3300053086 | Ga0500578_0336132 | Ga0500578_0336132_182_841 | 210 |
| 720 | 3300053090 | Ga0500646_0054699 | Ga0500646_0054699_362_1021 | 210 |
| 721 | 3300053092 | Ga0500583_0206130 | Ga0500583_0206130_244_903 | 210 |
| 722 | 3300053099 | Ga0500654_121595 | Ga0500654_121595_286_945 | 210 |
| 723 | 3300053109 | Ga0500569_008074 | Ga0500569_008074_501_1160 | 210 |
| 724 | 3300053137 | Ga0500561_0014965 | Ga0500561_0014965_766_1425 | 210 |
| 725 | 3300053153 | Ga0500616_0033134 | Ga0500616_0033134_1557_2216 | 210 |
| 726 | 3300053161 | Ga0500634_0015437 | Ga0500634_0015437_288_947 | 210 |
| 727 | 3300061734 | Ga0530510_0062545 | Ga0530510_0062545_208_876 | 210 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2b34-assembly1.cif.gz_A | structure of mar1 ribonuclease from caenorhabditis elegans | 0.9456 | 9 | 189 |
| 1j2r-assembly1.cif.gz_A | crystal structure of escherichia coli gene product yecd at 1.3 a resolution | 0.9201 | 7 | 173 |
| 1yac-assembly1.cif.gz_A | the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity | 0.9047 | 7 | 202 |
| 4wgf-assembly1.cif.gz_C | ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide | 0.8948 | 7 | 205 |
| 1x9g-assembly1.cif.gz_A | putative mar1 ribonuclease from leishmania donovani | 0.8925 | 8 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0JME6_2_195_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9443 | 5 | 188 | 3.40.50.850 |
| af_Q9W127_4_199_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9194 | 7 | 189 | 3.40.50.850 |
| 1j2rB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9144 | 10 | 169 | 3.40.50.850 |
| af_Q54NZ8_2_198_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.9126 | 5 | 198 | 3.40.50.850 |
| af_Q54RC7_3_195_3.40.50.850 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like | 0.8933 | 7 | 192 | 3.40.50.850 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9PAZ2-F1-model_v4 | Hydrolase | 0.9911 | 41 | 165 |
GO:0016787
|
| AF-A0A4R2JXE4-F1-model_v4 | Nicotinamidase-related amidase | 0.99 | 7 | 198 |
|
| AF-A0A5J6IBJ0-F1-model_v4 | Isochorismatase family protein | 0.9882 | 7 | 199 |
|
| AF-A0A442FYR2-F1-model_v4 | Isochorismatase family protein | 0.9882 | 9 | 158 |
|
| AF-A0A1I4AVV4-F1-model_v4 | Nicotinamidase-related amidase | 0.988 | 7 | 198 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar