F477779

General Info

Members Datasets Scaffolds Average Seq Length
728 284 1456 121

Family's Representative Sequence

Representative Sequence 3300005328|Ga0070676_10006442|Ga0070676_100064425
Length 138
Sequence MFDTNYTKHTNYHELRTSMKKLAKREEQIMQVYWDLGKAFIKEVIPHLPDPKPHYNSVATIVKILEEKGFLDHEAIGNVYSYFPKISREEYQKHDMKDIVKKYFDNSYPRMLAFFAKEQNLSEKELKEILEMIKSDKS

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 2088090002 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
187 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
194 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
195 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
198 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
199 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
200 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
201 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
204 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
205 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
206 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
229 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
230 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
245 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
246 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
247 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
250 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
251 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
252 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
253 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
263 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
264 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
267 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
268 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
271 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
272 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
273 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
274 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
275 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
276 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
277 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
278 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
279 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
280 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
281 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
282 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
283 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
284 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.35
Metatranscriptomes 0
Isolates 1.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.06
Nodule 0
Rhizoplane 1.92
Rhizosphere 91.9
Stem 0
Stem Tuber 0
Unclassified 21.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10006442 3300005328 Bacteria 6275
2 CNA_F6ESG4R02GKPM1 2088090002 Bacteria 507
3 JGI25406J46586_10160090 3300003203 Unclassified 657
4 rootH2_10340456 3300003320 Unclassified 1630
5 rootH1_10388672 3300003323 Unclassified 1586
6 Ga0065714_10002780 3300005288 Bacteria 12386
7 Ga0065714_10008400 3300005288 Bacteria 2987
8 Ga0065704_10018505 3300005289 Bacteria 2054
9 Ga0065704_10495783 3300005289 Bacteria 670
10 Ga0065712_10153950 3300005290 Bacteria 1348
11 Ga0065712_10512818 3300005290 Bacteria 641
12 Ga0065712_10834097 3300005290 Unclassified 502
13 Ga0065715_10027975 3300005293 Bacteria 1634
14 Ga0065715_10277504 3300005293 Bacteria 1095
15 Ga0065715_10551731 3300005293 Bacteria 740
16 Ga0065707_10103348 3300005295 Bacteria 2753
17 Ga0065707_10420512 3300005295 Bacteria 831
18 Ga0065707_10597090 3300005295 Unclassified 692
19 Ga0070658_10383727 3300005327 Bacteria 1206
20 Ga0070676_10683586 3300005328 Bacteria 748
21 Ga0070683_100047424 3300005329 Bacteria 3970
22 Ga0070683_100161092 3300005329 Bacteria 2129
23 Ga0070683_100334253 3300005329 Bacteria 1442
24 Ga0070683_101961349 3300005329 Bacteria 563
25 Ga0070690_100172724 3300005330 Bacteria 1488
26 Ga0070690_100578841 3300005330 Bacteria 850
27 Ga0070670_100065566 3300005331 Bacteria 3116
28 Ga0070670_100108062 3300005331 Bacteria 2397
29 Ga0070670_100129781 3300005331 Bacteria 2176
30 Ga0070670_100185011 3300005331 Bacteria 1809
31 Ga0070670_100448539 3300005331 Bacteria 1143
32 Ga0070670_100664206 3300005331 Bacteria 936
33 Ga0070670_101796862 3300005331 Unclassified 564
34 Ga0070677_10133241 3300005333 Bacteria 1137
35 Ga0070677_10400039 3300005333 Bacteria 724
36 Ga0068869_100037066 3300005334 Bacteria 3465
37 Ga0068869_100248166 3300005334 Bacteria 1421
38 Ga0068869_100439429 3300005334 Bacteria 1079
39 Ga0068869_100873849 3300005334 Bacteria 777
40 Ga0070666_10056032 3300005335 Bacteria 2661
41 Ga0070666_11222892 3300005335 Bacteria 560
42 Ga0070682_100341267 3300005337 Bacteria 1113
43 Ga0068868_100091600 3300005338 Bacteria 2450
44 Ga0068868_100267123 3300005338 Bacteria 1444
45 Ga0068868_100620658 3300005338 Bacteria 960
46 Ga0068868_100926826 3300005338 Bacteria 793
47 Ga0070660_100903612 3300005339 Bacteria 745
48 Ga0070689_100007532 3300005340 Bacteria 7620
49 Ga0070689_100099742 3300005340 Bacteria 2297
50 Ga0070689_100231672 3300005340 Bacteria 1518
51 Ga0070689_100471164 3300005340 Bacteria 1071
52 Ga0070687_100699987 3300005343 Bacteria 708
53 Ga0070661_100057494 3300005344 Bacteria 2850
54 Ga0070668_102092002 3300005347 Unclassified 523
55 Ga0070669_100156596 3300005353 Unclassified 1767
56 Ga0070669_100363299 3300005353 Bacteria 1178
57 Ga0070669_100593254 3300005353 Bacteria 927
58 Ga0070669_101764539 3300005353 Unclassified 540
59 Ga0070669_101984101 3300005353 Unclassified 509
60 Ga0070675_100055526 3300005354 Bacteria 3260
61 Ga0070675_100119203 3300005354 Bacteria 2241
62 Ga0070675_100153456 3300005354 Bacteria 1976
63 Ga0070675_100331730 3300005354 Unclassified 1346
64 Ga0070671_100056167 3300005355 Unclassified 3275
65 Ga0070671_100261210 3300005355 Bacteria 1472
66 Ga0070671_100538350 3300005355 Bacteria 1006
67 Ga0070671_101412243 3300005355 Bacteria 615
68 Ga0070674_100031187 3300005356 Bacteria 3530
69 Ga0070674_100382789 3300005356 Unclassified 1145
70 Ga0070674_100649687 3300005356 Bacteria 896
71 Ga0070673_100074023 3300005364 Bacteria 2743
72 Ga0070673_100220363 3300005364 Bacteria 1642
73 Ga0070673_100592469 3300005364 Unclassified 1010
74 Ga0070673_100654566 3300005364 Bacteria 962
75 Ga0070673_101144362 3300005364 Bacteria 728
76 Ga0070673_101559123 3300005364 Bacteria 623
77 Ga0070673_101631829 3300005364 Bacteria 609
78 Ga0070688_100093127 3300005365 Bacteria 1972
79 Ga0070688_100301395 3300005365 Unclassified 1159
80 Ga0070688_101508146 3300005365 Unclassified 547
81 Ga0070659_100069554 3300005366 Bacteria 2795
82 Ga0070667_100059036 3300005367 Unclassified 3244
83 Ga0070667_100083177 3300005367 Unclassified 2742
84 Ga0070667_100120350 3300005367 Unclassified 2283
85 Ga0070667_100229768 3300005367 Unclassified 1654
86 Ga0070667_100808260 3300005367 Bacteria 871
87 Ga0070667_100819935 3300005367 Bacteria 864
88 Ga0070667_101815569 3300005367 Unclassified 574
89 Ga0070709_11368966 3300005434 Unclassified 572
90 Ga0070713_101030656 3300005436 Bacteria 794
91 Ga0070701_10946258 3300005438 Bacteria 598
92 Ga0070700_100106015 3300005441 Bacteria 1860
93 Ga0070700_101734848 3300005441 Bacteria 536
94 Ga0070663_100439828 3300005455 Unclassified 1073
95 Ga0070663_101334453 3300005455 Unclassified 634
96 Ga0070678_101300074 3300005456 Bacteria 677
97 Ga0070678_101500547 3300005456 Bacteria 631
98 Ga0070662_100380875 3300005457 Unclassified 1161
99 Ga0070662_101072637 3300005457 Bacteria 691
100 Ga0070662_101714678 3300005457 Unclassified 542
101 Ga0068867_100141751 3300005459 Bacteria 1879
102 Ga0068867_100583220 3300005459 Bacteria 973
103 Ga0068867_101468170 3300005459 Bacteria 634
104 Ga0070685_10024602 3300005466 Unclassified 3309
105 Ga0070685_10086939 3300005466 Bacteria 1885
106 Ga0070685_10109046 3300005466 Bacteria 1702
107 Ga0070685_10545990 3300005466 Unclassified 826
108 Ga0070698_100005484 3300005471 Bacteria 13851
109 Ga0070698_100022480 3300005471 Bacteria 6597
110 Ga0070698_100031347 3300005471 Bacteria 5512
111 Ga0070679_100554036 3300005530 Bacteria 1093
112 Ga0070684_100002669 3300005535 Bacteria 13168
113 Ga0070684_100118730 3300005535 Unclassified 2378
114 Ga0068853_100917433 3300005539 Bacteria 842
115 Ga0068853_101122854 3300005539 Bacteria 758
116 Ga0070672_100141813 3300005543 Unclassified 1982
117 Ga0070672_100354266 3300005543 Bacteria 1252
118 Ga0070672_100621451 3300005543 Unclassified 942
119 Ga0070672_100799900 3300005543 Bacteria 830
120 Ga0070686_100842835 3300005544 Bacteria 742
121 Ga0070686_101392866 3300005544 Bacteria 588
122 Ga0070693_100290458 3300005547 Bacteria 1098
123 Ga0070665_100064660 3300005548 Unclassified 3669
124 Ga0070665_100337642 3300005548 Unclassified 1511
125 Ga0070665_100757338 3300005548 Bacteria 984
126 Ga0070665_102004070 3300005548 Bacteria 584
127 Ga0070704_100528198 3300005549 Unclassified 1028
128 Ga0070664_100087600 3300005564 Bacteria 2692
129 Ga0070664_100165434 3300005564 Bacteria 1960
130 Ga0070664_100184399 3300005564 Bacteria 1856
131 Ga0070664_100197470 3300005564 Bacteria 1794
132 Ga0070664_100491359 3300005564 Unclassified 1130
133 Ga0070664_100549610 3300005564 Bacteria 1068
134 Ga0070664_100719467 3300005564 Unclassified 931
135 Ga0068857_100073434 3300005577 Bacteria 3048
136 Ga0068857_100719268 3300005577 Bacteria 949
137 Ga0068857_100901152 3300005577 Bacteria 848
138 Ga0068857_102171205 3300005577 Bacteria 545
139 Ga0068854_100571855 3300005578 Bacteria 961
140 Ga0068854_100841276 3300005578 Bacteria 803
141 Ga0070702_100289838 3300005615 Bacteria 1128
142 Ga0070702_101155166 3300005615 Bacteria 622
143 Ga0068852_100080524 3300005616 Bacteria 2888
144 Ga0068852_100406241 3300005616 Unclassified 1340
145 Ga0068852_100505890 3300005616 Unclassified 1203
146 Ga0068859_100013562 3300005617 Bacteria 8172
147 Ga0068859_100013830 3300005617 Bacteria 8093
148 Ga0068859_100042847 3300005617 Bacteria 4547
149 Ga0068859_100145417 3300005617 Bacteria 2445
150 Ga0068859_100268908 3300005617 Bacteria 1796
151 Ga0068859_100355209 3300005617 Bacteria 1560
152 Ga0068859_100516580 3300005617 Bacteria 1289
153 Ga0068859_100555425 3300005617 Bacteria 1242
154 Ga0068859_100609294 3300005617 Bacteria 1185
155 Ga0068859_100759746 3300005617 Bacteria 1058
156 Ga0068859_100786647 3300005617 Bacteria 1039
157 Ga0068859_101419754 3300005617 Bacteria 766
158 Ga0068859_101489715 3300005617 Bacteria 747
159 Ga0068859_102338479 3300005617 Unclassified 589
160 Ga0068859_102854114 3300005617 Unclassified 530
161 Ga0068864_100010460 3300005618 Bacteria 7667
162 Ga0068864_100192211 3300005618 Bacteria 1872
163 Ga0068864_100950092 3300005618 Bacteria 850
164 Ga0068864_101938783 3300005618 Unclassified 595
165 Ga0068866_10074811 3300005718 Bacteria 1802
166 Ga0068866_10305692 3300005718 Bacteria 995
167 Ga0068866_10787442 3300005718 Unclassified 660
168 Ga0068861_100051340 3300005719 Bacteria 3130
169 Ga0068861_100054764 3300005719 Bacteria 3040
170 Ga0068861_100087878 3300005719 Bacteria 2446
171 Ga0068861_100649976 3300005719 Unclassified 974
172 Ga0068861_101132408 3300005719 Unclassified 753
173 Ga0068861_102501786 3300005719 Bacteria 520
174 Ga0068851_10424510 3300005834 Bacteria 786
175 Ga0068870_10780175 3300005840 Bacteria 666
176 Ga0068870_11237958 3300005840 Bacteria 542
177 Ga0068863_100001966 3300005841 Bacteria 20422
178 Ga0068863_100145776 3300005841 Bacteria 2264
179 Ga0068863_101051708 3300005841 Unclassified 818
180 Ga0068863_101170353 3300005841 Bacteria 774
181 Ga0068863_102580928 3300005841 Unclassified 517
182 Ga0068858_100221633 3300005842 Unclassified 1791
183 Ga0068858_100355511 3300005842 Bacteria 1404
184 Ga0068858_100703032 3300005842 Bacteria 984
185 Ga0068860_100004009 3300005843 Bacteria 15116
186 Ga0068860_100005881 3300005843 Bacteria 12349
187 Ga0068860_100195525 3300005843 Bacteria 1959
188 Ga0068860_100239146 3300005843 Bacteria 1766
189 Ga0068860_101104792 3300005843 Unclassified 812
190 Ga0068860_102568950 3300005843 Bacteria 529
191 Ga0068862_100415963 3300005844 Bacteria 1260
192 Ga0068862_100849258 3300005844 Unclassified 895
193 Ga0068862_101346236 3300005844 Bacteria 716
194 Ga0068862_101412879 3300005844 Unclassified 699
195 Ga0081539_10001794 3300005985 Bacteria 33997
196 Ga0070717_11221272 3300006028 Unclassified 684
197 Ga0075432_10312819 3300006058 Unclassified 655
198 Ga0075432_10494114 3300006058 Bacteria 544
199 Ga0070715_10540631 3300006163 Unclassified 674
200 Ga0070716_100271747 3300006173 Bacteria 1165
201 Ga0097621_100005069 3300006237 Bacteria 9257
202 Ga0097621_100204497 3300006237 Bacteria 1715
203 Ga0097621_100343939 3300006237 Unclassified 1325
204 Ga0097621_100460416 3300006237 Bacteria 1147
205 Ga0097621_100568195 3300006237 Unclassified 1034
206 Ga0097621_101572586 3300006237 Bacteria 625
207 Ga0075370_10874260 3300006353 Bacteria 549
208 Ga0068871_100008961 3300006358 Bacteria 7221
209 Ga0068871_100017013 3300006358 Bacteria 5491
210 Ga0068871_100327403 3300006358 Unclassified 1351
211 Ga0068871_100827830 3300006358 Bacteria 855
212 Ga0068871_101024414 3300006358 Bacteria 770
213 Ga0075428_100012494 3300006844 Bacteria 9444
214 Ga0075428_102595621 3300006844 Bacteria 518
215 Ga0075430_100817277 3300006846 Bacteria 768
216 Ga0075431_100055186 3300006847 Bacteria 4098
217 Ga0075431_101566198 3300006847 Unclassified 617
218 Ga0075429_100006150 3300006880 Bacteria 10376
219 Ga0075429_100313024 3300006880 Bacteria 1374
220 Ga0075429_100463541 3300006880 Unclassified 1110
221 Ga0068865_100359529 3300006881 Bacteria 1182
222 Ga0097620_100013560 3300006931 Bacteria 8172
223 Ga0097620_100013830 3300006931 Bacteria 8093
224 Ga0097620_100042845 3300006931 Bacteria 4547
225 Ga0097620_100145418 3300006931 Bacteria 2445
226 Ga0097620_100268914 3300006931 Bacteria 1796
227 Ga0097620_100355215 3300006931 Bacteria 1560
228 Ga0097620_100516578 3300006931 Bacteria 1289
229 Ga0097620_100555436 3300006931 Bacteria 1242
230 Ga0097620_100609262 3300006931 Bacteria 1185
231 Ga0097620_100759728 3300006931 Bacteria 1058
232 Ga0097620_100786663 3300006931 Bacteria 1039
233 Ga0097620_101419866 3300006931 Bacteria 766
234 Ga0097620_101489543 3300006931 Bacteria 747
235 Ga0097620_102339664 3300006931 Unclassified 589
236 Ga0097620_102855217 3300006931 Unclassified 530
237 Ga0105251_10053057 3300009011 Bacteria 1928
238 Ga0105251_10065440 3300009011 Bacteria 1701
239 Ga0105244_10000004 3300009036 Bacteria 492478
240 Ga0105240_10669872 3300009093 Bacteria 1135
241 Ga0105240_12165303 3300009093 Bacteria 577
242 Ga0111539_10041924 3300009094 Bacteria 5500
243 Ga0111539_10054398 3300009094 Unclassified 4763
244 Ga0111539_10433793 3300009094 Bacteria 1530
245 Ga0111539_11018641 3300009094 Bacteria 963
246 Ga0111539_11388357 3300009094 Unclassified 815
247 Ga0111539_11414666 3300009094 Unclassified 807
248 Ga0111539_13476687 3300009094 Bacteria 506
249 Ga0105247_10001409 3300009101 Bacteria 17436
250 Ga0105247_10240118 3300009101 Bacteria 1234
251 Ga0114129_10069169 3300009147 Unclassified 4921
252 Ga0114129_10085559 3300009147 Bacteria 4374
253 Ga0114129_11658103 3300009147 Bacteria 781
254 Ga0114129_13124094 3300009147 Unclassified 541
255 Ga0114129_13378419 3300009147 Unclassified 514
256 Ga0105243_11763213 3300009148 Bacteria 649
257 Ga0105241_10200544 3300009174 Unclassified 1666
258 Ga0105241_10358736 3300009174 Bacteria 1268
259 Ga0105241_11591563 3300009174 Unclassified 632
260 Ga0105241_11725373 3300009174 Unclassified 609
261 Ga0105242_10002507 3300009176 Bacteria 14401
262 Ga0105242_10016969 3300009176 Bacteria 5667
263 Ga0105242_10236415 3300009176 Unclassified 1640
264 Ga0105242_10523942 3300009176 Bacteria 1131
265 Ga0105242_11902181 3300009176 Bacteria 635
266 Ga0105242_13009761 3300009176 Unclassified 522
267 Ga0105248_10390555 3300009177 Bacteria 1567
268 Ga0105248_11002871 3300009177 Bacteria 943
269 Ga0105237_10797586 3300009545 Bacteria 951
270 Ga0105237_11305305 3300009545 Bacteria 732
271 Ga0105237_12220334 3300009545 Unclassified 558
272 Ga0105249_10001319 3300009553 Bacteria 21718
273 Ga0105249_10003297 3300009553 Bacteria 13988
274 Ga0105249_10007594 3300009553 Bacteria 9464
275 Ga0105249_10116159 3300009553 Bacteria 2536
276 Ga0105249_10239858 3300009553 Bacteria 1792
277 Ga0105249_10317806 3300009553 Unclassified 1568
278 Ga0105249_10352843 3300009553 Bacteria 1490
279 Ga0105249_11384769 3300009553 Unclassified 775
280 Ga0105249_11389812 3300009553 Bacteria 774
281 Ga0105249_11763330 3300009553 Bacteria 692
282 Ga0105249_11799193 3300009553 Bacteria 685
283 Ga0105249_12793819 3300009553 Unclassified 560
284 Ga0105239_10502842 3300010375 Bacteria 1378
285 Ga0105246_10062756 3300011119 Bacteria 2590
286 Ga0105246_10134559 3300011119 Bacteria 1851
287 Ga0105246_10808700 3300011119 Unclassified 832
288 Ga0157373_10000002 3300013100 Bacteria 750094
289 Ga0157373_10011815 3300013100 Bacteria 6414
290 Ga0157373_10564275 3300013100 Bacteria 826
291 Ga0157373_10605037 3300013100 Bacteria 798
292 Ga0157373_11101378 3300013100 Bacteria 596
293 Ga0157371_10130310 3300013102 Bacteria 1789
294 Ga0157371_10363368 3300013102 Bacteria 1055
295 Ga0157370_10000097 3300013104 Bacteria 99144
296 Ga0157370_10002822 3300013104 Bacteria 20761
297 Ga0157370_10137162 3300013104 Bacteria 2280
298 Ga0157370_10166724 3300013104 Bacteria 2048
299 Ga0157370_10170945 3300013104 Bacteria 2020
300 Ga0157369_10009083 3300013105 Bacteria 11378
301 Ga0157369_10030197 3300013105 Bacteria 5979
302 Ga0157369_10064219 3300013105 Bacteria 3954
303 Ga0157369_11268232 3300013105 Bacteria 751
304 Ga0157374_10008802 3300013296 Bacteria 8639
305 Ga0157374_10027181 3300013296 Bacteria 5157
306 Ga0157374_10137876 3300013296 Bacteria 2366
307 Ga0157374_10182966 3300013296 Bacteria 2048
308 Ga0157374_10420638 3300013296 Bacteria 1335
309 Ga0157374_10537427 3300013296 Bacteria 1176
310 Ga0157374_12280875 3300013296 Bacteria 568
311 Ga0157378_10011051 3300013297 Bacteria 7902
312 Ga0157378_10022058 3300013297 Bacteria 5601
313 Ga0157378_10199073 3300013297 Bacteria 1894
314 Ga0157378_10237076 3300013297 Bacteria 1741
315 Ga0157378_10439418 3300013297 Bacteria 1293
316 Ga0157378_10906581 3300013297 Bacteria 912
317 Ga0157378_11150171 3300013297 Bacteria 814
318 Ga0163162_10019416 3300013306 Bacteria 6666
319 Ga0163162_10026218 3300013306 Bacteria 5761
320 Ga0163162_10034614 3300013306 Bacteria 5027
321 Ga0163162_10093233 3300013306 Bacteria 3096
322 Ga0163162_10124962 3300013306 Bacteria 2678
323 Ga0163162_10204595 3300013306 Bacteria 2103
324 Ga0163162_10301734 3300013306 Bacteria 1733
325 Ga0163162_10676330 3300013306 Bacteria 1155
326 Ga0163162_10743235 3300013306 Unclassified 1101
327 Ga0163162_10794787 3300013306 Bacteria 1064
328 Ga0163162_10914492 3300013306 Bacteria 990
329 Ga0163162_11037318 3300013306 Bacteria 928
330 Ga0163162_11266750 3300013306 Unclassified 837
331 Ga0163162_12286148 3300013306 Unclassified 621
332 Ga0163162_12352130 3300013306 Bacteria 612
333 Ga0157372_10149650 3300013307 Bacteria 2694
334 Ga0157372_10251303 3300013307 Bacteria 2052
335 Ga0157372_10353004 3300013307 Bacteria 1713
336 Ga0157372_11560919 3300013307 Bacteria 760
337 Ga0157372_11699701 3300013307 Bacteria 726
338 Ga0157372_12590426 3300013307 Unclassified 582
339 Ga0157372_12690523 3300013307 Bacteria 571
340 Ga0157372_12991807 3300013307 Bacteria 540
341 Ga0157375_10006773 3300013308 Bacteria 9982
342 Ga0157375_10057411 3300013308 Bacteria 3848
343 Ga0157375_10079911 3300013308 Bacteria 3307
344 Ga0157375_10082143 3300013308 Bacteria 3263
345 Ga0157375_10092904 3300013308 Unclassified 3082
346 Ga0157375_10126295 3300013308 Bacteria 2673
347 Ga0157375_10140620 3300013308 Bacteria 2541
348 Ga0157375_10200943 3300013308 Bacteria 2149
349 Ga0157375_10322326 3300013308 Bacteria 1710
350 Ga0157375_10697142 3300013308 Bacteria 1169
351 Ga0157375_10814958 3300013308 Bacteria 1082
352 Ga0157375_11220379 3300013308 Bacteria 883
353 Ga0157375_12344968 3300013308 Unclassified 636
354 Ga0163163_10001981 3300014325 Bacteria 17328
355 Ga0163163_10514137 3300014325 Bacteria 1259
356 Ga0163163_10673108 3300014325 Bacteria 1098
357 Ga0163163_11514557 3300014325 Unclassified 732
358 Ga0163163_12147433 3300014325 Unclassified 618
359 Ga0163163_12178397 3300014325 Unclassified 614
360 Ga0163163_12992740 3300014325 Unclassified 527
361 Ga0157380_10014307 3300014326 Bacteria 5804
362 Ga0157380_10018408 3300014326 Bacteria 5183
363 Ga0157380_10098483 3300014326 Bacteria 2430
364 Ga0157380_10861281 3300014326 Unclassified 929
365 Ga0157380_10953870 3300014326 Bacteria 888
366 Ga0157380_11059303 3300014326 Bacteria 848
367 Ga0157380_11294363 3300014326 Bacteria 776
368 Ga0157380_11843938 3300014326 Bacteria 664
369 Ga0157380_11901490 3300014326 Bacteria 656
370 Ga0157377_10013851 3300014745 Unclassified 4089
371 Ga0157377_10071880 3300014745 Bacteria 2001
372 Ga0157377_10101437 3300014745 Unclassified 1715
373 Ga0157377_11135217 3300014745 Bacteria 601
374 Ga0157377_11337023 3300014745 Unclassified 562
375 Ga0157379_10016773 3300014968 Bacteria 6446
376 Ga0157379_10168872 3300014968 Bacteria 1975
377 Ga0157379_10186779 3300014968 Bacteria 1873
378 Ga0157379_10635773 3300014968 Bacteria 998
379 Ga0157379_10809923 3300014968 Bacteria 884
380 Ga0157379_10984598 3300014968 Bacteria 803
381 Ga0157376_10091666 3300014969 Bacteria 2633
382 Ga0157376_10264607 3300014969 Bacteria 1613
383 Ga0157376_10565587 3300014969 Unclassified 1127
384 Ga0157376_11098384 3300014969 Bacteria 821
385 Ga0157376_11736848 3300014969 Unclassified 660
386 Ga0157376_12998747 3300014969 Bacteria 511
387 Ga0182006_1002176 3300015261 Bacteria 10863
388 Ga0182007_10180118 3300015262 Bacteria 730
389 Ga0163161_10000026 3300017792 Bacteria 199745
390 Ga0163161_10139905 3300017792 Bacteria 1832
391 Ga0163161_10153991 3300017792 Bacteria 1749
392 Ga0163161_10211944 3300017792 Unclassified 1497
393 Ga0163161_10429485 3300017792 Bacteria 1064
394 Ga0163161_10931595 3300017792 Bacteria 738
395 Ga0207697_10107638 3300025315 Bacteria 1192
396 Ga0207655_1000008 3300025728 Bacteria 734289
397 Ga0207713_1163087 3300025735 Bacteria 709
398 Ga0207713_1247042 3300025735 Bacteria 527
399 Ga0207682_10029013 3300025893 Bacteria 2211
400 Ga0207642_10212513 3300025899 Unclassified 1076
401 Ga0207642_10667951 3300025899 Bacteria 652
402 Ga0207710_10015279 3300025900 Bacteria 3242
403 Ga0207688_10110660 3300025901 Bacteria 1594
404 Ga0207680_10072531 3300025903 Bacteria 2138
405 Ga0207680_10088068 3300025903 Bacteria 1967
406 Ga0207680_11016188 3300025903 Unclassified 594
407 Ga0207647_10042205 3300025904 Bacteria 2863
408 Ga0207647_10222973 3300025904 Bacteria 1086
409 Ga0207645_10011823 3300025907 Bacteria 5942
410 Ga0207645_10692343 3300025907 Bacteria 693
411 Ga0207643_10400214 3300025908 Bacteria 868
412 Ga0207643_10923180 3300025908 Bacteria 565
413 Ga0207705_10689300 3300025909 Bacteria 794
414 Ga0207684_11352300 3300025910 Unclassified 585
415 Ga0207654_10833869 3300025911 Unclassified 667
416 Ga0207662_10020618 3300025918 Bacteria 3761
417 Ga0207662_10459852 3300025918 Unclassified 871
418 Ga0207657_10168828 3300025919 Bacteria 1774
419 Ga0207649_10133661 3300025920 Bacteria 1688
420 Ga0207649_10428961 3300025920 Bacteria 994
421 Ga0207652_10816856 3300025921 Bacteria 827
422 Ga0207646_10194660 3300025922 Unclassified 1831
423 Ga0207681_10140828 3300025923 Bacteria 1796
424 Ga0207681_11018178 3300025923 Bacteria 695
425 Ga0207681_11816878 3300025923 Bacteria 508
426 Ga0207650_10035597 3300025925 Bacteria 3618
427 Ga0207650_10118760 3300025925 Bacteria 2056
428 Ga0207650_10265935 3300025925 Unclassified 1392
429 Ga0207650_10316727 3300025925 Unclassified 1277
430 Ga0207650_11107185 3300025925 Unclassified 674
431 Ga0207650_11260871 3300025925 Bacteria 629
432 Ga0207650_11332689 3300025925 Bacteria 611
433 Ga0207659_10055394 3300025926 Bacteria 2836
434 Ga0207659_10221808 3300025926 Bacteria 1521
435 Ga0207659_10416583 3300025926 Unclassified 1126
436 Ga0207659_11279398 3300025926 Bacteria 630
437 Ga0207659_11419690 3300025926 Bacteria 595
438 Ga0207659_11692003 3300025926 Unclassified 539
439 Ga0207700_11050547 3300025928 Bacteria 729
440 Ga0207644_10212241 3300025931 Unclassified 1531
441 Ga0207644_10433401 3300025931 Bacteria 1078
442 Ga0207706_10045661 3300025933 Bacteria 3881
443 Ga0207706_10074986 3300025933 Bacteria 2974
444 Ga0207706_10267209 3300025933 Bacteria 1493
445 Ga0207706_10449222 3300025933 Unclassified 1115
446 Ga0207706_10696234 3300025933 Bacteria 868
447 Ga0207686_10000200 3300025934 Bacteria 46234
448 Ga0207686_11263386 3300025934 Bacteria 605
449 Ga0207709_11240362 3300025935 Bacteria 615
450 Ga0207670_10103846 3300025936 Bacteria 2034
451 Ga0207670_10163574 3300025936 Bacteria 1663
452 Ga0207670_10284640 3300025936 Unclassified 1289
453 Ga0207670_11505317 3300025936 Bacteria 572
454 Ga0207669_10653424 3300025937 Bacteria 860
455 Ga0207669_10976950 3300025937 Bacteria 711
456 Ga0207669_11112106 3300025937 Unclassified 667
457 Ga0207669_11137177 3300025937 Bacteria 660
458 Ga0207704_10658840 3300025938 Unclassified 863
459 Ga0207704_10780080 3300025938 Bacteria 797
460 Ga0207665_10600284 3300025939 Bacteria 859
461 Ga0207691_10090554 3300025940 Unclassified 2742
462 Ga0207691_10401557 3300025940 Bacteria 1169
463 Ga0207691_11145204 3300025940 Unclassified 646
464 Ga0207691_11667356 3300025940 Unclassified 517
465 Ga0207711_11242231 3300025941 Bacteria 687
466 Ga0207689_10039743 3300025942 Bacteria 3894
467 Ga0207689_10169171 3300025942 Bacteria 1801
468 Ga0207689_10209134 3300025942 Bacteria 1612
469 Ga0207689_10260045 3300025942 Unclassified 1436
470 Ga0207689_10374793 3300025942 Bacteria 1185
471 Ga0207689_10770283 3300025942 Unclassified 812
472 Ga0207661_10030202 3300025944 Bacteria 4172
473 Ga0207661_10226925 3300025944 Bacteria 1652
474 Ga0207679_10178810 3300025945 Bacteria 1753
475 Ga0207679_10469833 3300025945 Unclassified 1118
476 Ga0207667_10749876 3300025949 Bacteria 976
477 Ga0207651_10384443 3300025960 Bacteria 1190
478 Ga0207712_10002897 3300025961 Bacteria 10969
479 Ga0207712_10004281 3300025961 Bacteria 9006
480 Ga0207712_10077710 3300025961 Bacteria 2407
481 Ga0207712_10134125 3300025961 Unclassified 1891
482 Ga0207712_10826164 3300025961 Bacteria 816
483 Ga0207712_10899806 3300025961 Bacteria 782
484 Ga0207712_11963244 3300025961 Bacteria 524
485 Ga0207668_10087974 3300025972 Bacteria 2274
486 Ga0207668_10202832 3300025972 Bacteria 1581
487 Ga0207668_11799895 3300025972 Unclassified 553
488 Ga0207640_10447548 3300025981 Bacteria 1064
489 Ga0207640_10482078 3300025981 Bacteria 1029
490 Ga0207640_11266351 3300025981 Bacteria 657
491 Ga0207658_10068775 3300025986 Bacteria 2673
492 Ga0207658_10363666 3300025986 Unclassified 1263
493 Ga0207658_10403600 3300025986 Unclassified 1202
494 Ga0207658_10762058 3300025986 Bacteria 877
495 Ga0207658_11583956 3300025986 Unclassified 599
496 Ga0207677_10033907 3300026023 Bacteria 3300
497 Ga0207677_10313291 3300026023 Bacteria 1301
498 Ga0207677_10458983 3300026023 Unclassified 1093
499 Ga0207677_12140386 3300026023 Unclassified 520
500 Ga0207703_10304457 3300026035 Bacteria 1455
501 Ga0207703_10404519 3300026035 Bacteria 1267
502 Ga0207703_10795798 3300026035 Bacteria 902
503 Ga0207639_10576649 3300026041 Unclassified 1035
504 Ga0207639_10918954 3300026041 Bacteria 818
505 Ga0207639_11990037 3300026041 Bacteria 542
506 Ga0207678_10054197 3300026067 Unclassified 3454
507 Ga0207678_10325103 3300026067 Bacteria 1323
508 Ga0207702_10983318 3300026078 Bacteria 837
509 Ga0207702_10984363 3300026078 Bacteria 836
510 Ga0207641_10020162 3300026088 Bacteria 5473
511 Ga0207641_10041489 3300026088 Bacteria 3856
512 Ga0207641_11046125 3300026088 Bacteria 814
513 Ga0207641_11328397 3300026088 Bacteria 720
514 Ga0207648_10047106 3300026089 Bacteria 3779
515 Ga0207648_10055161 3300026089 Bacteria 3470
516 Ga0207648_10057539 3300026089 Bacteria 3392
517 Ga0207648_10181197 3300026089 Bacteria 1865
518 Ga0207648_10315820 3300026089 Bacteria 1403
519 Ga0207648_10532132 3300026089 Bacteria 1078
520 Ga0207648_11332845 3300026089 Bacteria 674
521 Ga0207648_11436195 3300026089 Bacteria 648
522 Ga0207676_10129917 3300026095 Bacteria 2140
523 Ga0207676_10156593 3300026095 Unclassified 1969
524 Ga0207676_10157440 3300026095 Bacteria 1964
525 Ga0207676_10729483 3300026095 Bacteria 962
526 Ga0207674_10019713 3300026116 Bacteria 7300
527 Ga0207674_10062109 3300026116 Bacteria 3773
528 Ga0207674_10180762 3300026116 Bacteria 2061
529 Ga0207674_10909694 3300026116 Bacteria 848
530 Ga0207674_11261776 3300026116 Bacteria 708
531 Ga0207675_100010610 3300026118 Bacteria 8629
532 Ga0207675_100034120 3300026118 Bacteria 4743
533 Ga0207675_100270961 3300026118 Bacteria 1647
534 Ga0207675_100363355 3300026118 Bacteria 1420
535 Ga0207675_100632873 3300026118 Bacteria 1075
536 Ga0207675_101079257 3300026118 Bacteria 822
537 Ga0207675_101653731 3300026118 Unclassified 660
538 Ga0207675_102247055 3300026118 Unclassified 560
539 Ga0207683_10991110 3300026121 Unclassified 780
540 Ga0207683_11012352 3300026121 Bacteria 771
541 Ga0207698_10372018 3300026142 Bacteria 1357
542 Ga0207698_10674453 3300026142 Bacteria 1026
543 Ga0207698_10971600 3300026142 Unclassified 859
544 Ga0207698_11074522 3300026142 Bacteria 817
545 Ga0207698_12342274 3300026142 Bacteria 546
546 Ga0209995_1027606 3300027471 Bacteria 948
547 Ga0207428_10672672 3300027907 Unclassified 742
548 Ga0207428_11301296 3300027907 Bacteria 504
549 Ga0268266_10277028 3300028379 Unclassified 1559
550 Ga0268266_10323399 3300028379 Bacteria 1444
551 Ga0268266_10468923 3300028379 Bacteria 1199
552 Ga0268265_10234832 3300028380 Bacteria 1614
553 Ga0268265_10291949 3300028380 Bacteria 1464
554 Ga0268265_11009699 3300028380 Bacteria 822
555 Ga0268265_11232908 3300028380 Bacteria 746
556 Ga0268265_11847226 3300028380 Bacteria 611
557 Ga0268264_10005626 3300028381 Bacteria 10615
558 Ga0268264_10042733 3300028381 Bacteria 3752
559 Ga0268264_10077236 3300028381 Unclassified 2836
560 Ga0268264_10156577 3300028381 Bacteria 2048
561 Ga0268264_11074970 3300028381 Unclassified 812
562 Ga0268264_11170489 3300028381 Bacteria 778
563 Ga0268264_11616869 3300028381 Bacteria 658
564 Ga0307515_10000380 3300028794 Bacteria 108537
565 Ga0307515_10006611 3300028794 Bacteria 23131
566 Ga0307509_10487751 3300031507 Bacteria 919
567 Ga0307408_100020641 3300031548 Bacteria 4450
568 Ga0316576_10263168 3300031727 Bacteria 1294
569 Ga0307413_10598496 3300031824 Bacteria 902
570 Ga0307413_10819778 3300031824 Bacteria 784
571 Ga0307410_10000071 3300031852 Bacteria 35788
572 Ga0307406_10000037 3300031901 Bacteria 80899
573 Ga0307407_10006810 3300031903 Bacteria 5121
574 Ga0307409_102310819 3300031995 Bacteria 567
575 Ga0307416_102686002 3300032002 Bacteria 595
576 Ga0307414_10000012 3300032004 Bacteria 322675
577 Ga0307414_10874760 3300032004 Bacteria 823
578 Ga0307411_10399037 3300032005 Bacteria 1136
579 Ga0307411_10800353 3300032005 Bacteria 830
580 Ga0307411_11281402 3300032005 Bacteria 667
581 Ga0373929_0044557 3300035085 Bacteria 997
582 Ga0373934_0220285 3300035086 Bacteria 783
583 Ga0373952_0029310 3300035092 Bacteria 1212
584 Ga0373955_0325662 3300035172 Bacteria 929
585 Ga0316574_0243033 3300035398 Unclassified 1151
586 Ga0373924_0221624 3300035410 Bacteria 836
587 Ga0373937_0067380 3300036401 Bacteria 3298
588 Ga0316584_0517844 3300036712 Bacteria 836
589 Ga0395900_1769213 3300037418 Bacteria 529
590 Ga0395905_0179469 3300037471 Bacteria 1988
591 Ga0436365_0729052 3300039437 Bacteria 5196
592 Ga0436365_0843457 3300039437 Bacteria 1552
593 Ga0436365_0853306 3300039437 Bacteria 2533
594 Ga0436365_1151340 3300039437 Bacteria 808
595 Ga0436365_1758907 3300039437 Bacteria 764
596 Ga0439447_147320 3300041407 Bacteria 541
597 Ga0439461_0093789 3300041410 Unclassified 723
598 Ga0439466_0022583 3300041411 Bacteria 2219
599 Ga0439466_0152692 3300041411 Bacteria 707
600 Ga0451800_0578341 3300041459 Unclassified 565
601 Ga0451802_0144258 3300041460 Unclassified 519
602 Ga0451802_0831830 3300041460 Bacteria 713
603 Ga0451807_1994737 3300041486 Bacteria 962
604 Ga0451833_1296905 3300041491 Unclassified 590
605 Ga0451839_0785002 3300041496 Bacteria 780
606 Ga0451843_0767574 3300041509 Bacteria 833
607 Ga0451853_3843889 3300041512 Unclassified 880
608 Ga0439431_0233793 3300041997 Unclassified 542
609 Ga0439445_0117259 3300042004 Bacteria 763
610 Ga0439444_0039841 3300042437 Bacteria 918
611 Ga0439444_0200902 3300042437 Unclassified 503
612 Ga0439460_0169504 3300042461 Bacteria 735
613 Ga0451577_0001044 3300042876 Bacteria 40023
614 Ga0451577_0266645 3300042876 Bacteria 1551
615 Ga0451577_0526212 3300042876 Bacteria 1074
616 Ga0453683_0000005 3300044673 Bacteria 741657
617 Ga0453683_0000792 3300044673 Bacteria 31218
618 Ga0453683_0007079 3300044673 Bacteria 7639
619 Ga0453683_0009838 3300044673 Bacteria 6371
620 Ga0453683_0135617 3300044673 Bacteria 1552
621 Ga0453683_0523355 3300044673 Bacteria 770
622 Ga0453683_1053705 3300044673 Unclassified 541
623 Ga0453683_1127602 3300044673 Unclassified 523
624 Ga0453684_0000610 3300044712 Bacteria 131386
625 Ga0453684_0037330 3300044712 Bacteria 6669
626 Ga0453684_0041845 3300044712 Bacteria 6186
627 Ga0453684_0073834 3300044712 Bacteria 4298
628 Ga0453684_0187867 3300044712 Bacteria 2419
629 Ga0453684_0261375 3300044712 Bacteria 1982
630 Ga0453684_0310964 3300044712 Bacteria 1788
631 Ga0453684_0358626 3300044712 Unclassified 1642
632 Ga0453684_0730654 3300044712 Bacteria 1073
633 Ga0451576_0000193 3300045051 Bacteria 154108
634 Ga0451576_0006040 3300045051 Bacteria 14948
635 Ga0451576_0006802 3300045051 Bacteria 13898
636 Ga0451576_0011516 3300045051 Bacteria 10042
637 Ga0451576_0238042 3300045051 Bacteria 1901
638 Ga0451576_0858618 3300045051 Bacteria 953
639 Ga0451576_1095975 3300045051 Unclassified 833
640 Ga0495592_0445143 3300046454 Bacteria 813
641 Ga0495638_0027584 3300046460 Bacteria 3675
642 Ga0495638_0309182 3300046460 Bacteria 849
643 Ga0495606_0000021 3300046507 Bacteria 271238
644 Ga0495610_0000279 3300046512 Bacteria 53150
645 Ga0495610_0001345 3300046512 Bacteria 21797
646 Ga0495628_0299785 3300046516 Bacteria 1190
647 Ga0495632_0296989 3300046519 Bacteria 717
648 Ga0495637_0088822 3300046520 Bacteria 1222
649 Ga0495643_0255454 3300046522 Bacteria 816
650 Ga0495587_0129525 3300046536 Bacteria 1442
651 Ga0495598_0148551 3300046537 Bacteria 816
652 Ga0495621_0304944 3300046539 Bacteria 661
653 Ga0495645_0143842 3300046543 Bacteria 1662
654 Ga0495633_0005737 3300046558 Bacteria 7506
655 Ga0495667_0106133 3300046559 Bacteria 1816
656 Ga0495668_0000097 3300046616 Bacteria 139246
657 Ga0495668_0013869 3300046616 Bacteria 4740
658 Ga0495661_0022788 3300046665 Bacteria 4071
659 Ga0495613_0533742 3300046689 Bacteria 787
660 Ga0495671_0314262 3300046692 Bacteria 753
661 Ga0495581_0643331 3300047315 Bacteria 613
662 Ga0495604_0288924 3300047317 Bacteria 1105
663 Ga0495674_0838556 3300047319 Unclassified 713
664 Ga0495672_0395622 3300047320 Bacteria 633
665 Ga0495680_0259306 3300047322 Bacteria 1230
666 Ga0495686_0000625 3300047472 Bacteria 48634
667 Ga0496100_0514093 3300048903 Bacteria 924
668 Ga0496104_0943806 3300048907 Unclassified 767
669 Ga0496110_0220839 3300048913 Bacteria 1723
670 Ga0496110_1696769 3300048913 Unclassified 542
671 Ga0496111_0086257 3300048914 Bacteria 2297
672 Ga0496111_0180514 3300048914 Unclassified 1569
673 Ga0496112_1227484 3300048915 Unclassified 666
674 Ga0496112_1500157 3300048915 Bacteria 588
675 Ga0496113_0896284 3300048916 Unclassified 702
676 Ga0496114_0062136 3300048917 Unclassified 3126
677 Ga0496116_0000032 3300048919 Bacteria 419997
678 Ga0496121_0233147 3300048924 Bacteria 1288
679 Ga0496124_0299158 3300048927 Bacteria 1163
680 Ga0496125_0000111 3300048928 Bacteria 191489
681 Ga0496126_0004578 3300048929 Bacteria 16402
682 Ga0496126_0167088 3300048929 Bacteria 1877
683 Ga0501290_062370 3300049513 Bacteria 603
684 Ga0501038_0086325 3300049574 Bacteria 2637
685 Ga0501238_000090 3300049671 Bacteria 14589
686 Ga0501249_043346 3300049679 Bacteria 1024
687 Ga0501266_016963 3300049763 Bacteria 971
688 Ga0501280_001826 3300049776 Bacteria 3734
689 nmdc:mga07m45_686929_c1 3300050496 Bacteria 589
690 nmdc:mga05p37_231810_c1 3300050507 Bacteria 2224
691 nmdc:mga05p37_439472_c1 3300050507 Bacteria 1513
692 nmdc:mga05p37_46311_c1 3300050507 Bacteria 5348
693 nmdc:mga09592_208367_c1 3300050508 Unclassified 1693
694 nmdc:mga09592_375511_c1 3300050508 Bacteria 1230
695 nmdc:mga0qj67_1193098_c1 3300050509 Unclassified 592
696 nmdc:mga06r32_1072593_c1 3300050510 Bacteria 755
697 nmdc:mga06r32_360646_c1 3300050510 Bacteria 1437
698 nmdc:mga08y16_1495192_c1 3300050511 Bacteria 636
699 nmdc:mga08y16_1640127_c1 3300050511 Bacteria 600
700 nmdc:mga08y16_285380_c1 3300050511 Bacteria 1702
701 nmdc:mga08y16_771138_c1 3300050511 Unclassified 956
702 nmdc:mga08y16_897432_c1 3300050511 Unclassified 873
703 nmdc:mga0n895_179543_c1 3300050512 Bacteria 2148
704 Ga0500635_0082404 3300053080 Unclassified 1158
705 Ga0500644_0166812 3300053088 Bacteria 893
706 Ga0500646_0136625 3300053090 Bacteria 801
707 Ga0500647_0085727 3300053091 Bacteria 1510
708 Ga0500583_0154170 3300053092 Bacteria 1144
709 Ga0500641_0000020 3300053096 Bacteria 119591
710 Ga0500642_0007034 3300053130 Bacteria 3753
711 Ga0500573_0352650 3300053140 Bacteria 714
712 Ga0500604_0011813 3300053151 Bacteria 2352
713 Ga0500616_0033668 3300053153 Bacteria 2794
714 Ga0500627_0002345 3300053158 Bacteria 5593
715 Ga0500584_040179 3300053726 Bacteria 2148
716 Ga0500611_000020 3300053727 Bacteria 105250
717 2644369708 2643221667 Bacteria 5627472
718 2644642420 2643221716 Bacteria 4986332
719 2644685066 2643221725 Bacteria 5087956
720 2738732096 2738541279 Bacteria 6149495
721 2738764661 2738541285 Bacteria 6150075
722 2739213676 2738543007 Bacteria 6149845
723 2802653989 2802428842 Bacteria 4926114
724 2857615976 2857613821 Bacteria 4917088
725 2904422169 2904419702 Bacteria 5166287
726 2904560054 2904555929 Bacteria 5218588
727 2929153209 2929150217 Bacteria 5462483
728 2977269901 2977268062 Bacteria 5243061
729 Ga0070676_10006442
730 CNA_F6ESG4R02GKPM1
731 JGI25406J46586_10160090
732 rootH2_10340456
733 rootH1_10388672
734 Ga0065714_10002780
735 Ga0065714_10008400
736 Ga0065704_10018505
737 Ga0065704_10495783
738 Ga0065712_10153950
739 Ga0065712_10512818
740 Ga0065712_10834097
741 Ga0065715_10027975
742 Ga0065715_10277504
743 Ga0065715_10551731
744 Ga0065707_10103348
745 Ga0065707_10420512
746 Ga0065707_10597090
747 Ga0070658_10383727
748 Ga0070676_10683586
749 Ga0070683_100047424
750 Ga0070683_100161092
751 Ga0070683_100334253
752 Ga0070683_101961349
753 Ga0070690_100172724
754 Ga0070690_100578841
755 Ga0070670_100065566
756 Ga0070670_100108062
757 Ga0070670_100129781
758 Ga0070670_100185011
759 Ga0070670_100448539
760 Ga0070670_100664206
761 Ga0070670_101796862
762 Ga0070677_10133241
763 Ga0070677_10400039
764 Ga0068869_100037066
765 Ga0068869_100248166
766 Ga0068869_100439429
767 Ga0068869_100873849
768 Ga0070666_10056032
769 Ga0070666_11222892
770 Ga0070682_100341267
771 Ga0068868_100091600
772 Ga0068868_100267123
773 Ga0068868_100620658
774 Ga0068868_100926826
775 Ga0070660_100903612
776 Ga0070689_100007532
777 Ga0070689_100099742
778 Ga0070689_100231672
779 Ga0070689_100471164
780 Ga0070687_100699987
781 Ga0070661_100057494
782 Ga0070668_102092002
783 Ga0070669_100156596
784 Ga0070669_100363299
785 Ga0070669_100593254
786 Ga0070669_101764539
787 Ga0070669_101984101
788 Ga0070675_100055526
789 Ga0070675_100119203
790 Ga0070675_100153456
791 Ga0070675_100331730
792 Ga0070671_100056167
793 Ga0070671_100261210
794 Ga0070671_100538350
795 Ga0070671_101412243
796 Ga0070674_100031187
797 Ga0070674_100382789
798 Ga0070674_100649687
799 Ga0070673_100074023
800 Ga0070673_100220363
801 Ga0070673_100592469
802 Ga0070673_100654566
803 Ga0070673_101144362
804 Ga0070673_101559123
805 Ga0070673_101631829
806 Ga0070688_100093127
807 Ga0070688_100301395
808 Ga0070688_101508146
809 Ga0070659_100069554
810 Ga0070667_100059036
811 Ga0070667_100083177
812 Ga0070667_100120350
813 Ga0070667_100229768
814 Ga0070667_100808260
815 Ga0070667_100819935
816 Ga0070667_101815569
817 Ga0070709_11368966
818 Ga0070713_101030656
819 Ga0070701_10946258
820 Ga0070700_100106015
821 Ga0070700_101734848
822 Ga0070663_100439828
823 Ga0070663_101334453
824 Ga0070678_101300074
825 Ga0070678_101500547
826 Ga0070662_100380875
827 Ga0070662_101072637
828 Ga0070662_101714678
829 Ga0068867_100141751
830 Ga0068867_100583220
831 Ga0068867_101468170
832 Ga0070685_10024602
833 Ga0070685_10086939
834 Ga0070685_10109046
835 Ga0070685_10545990
836 Ga0070698_100005484
837 Ga0070698_100022480
838 Ga0070698_100031347
839 Ga0070679_100554036
840 Ga0070684_100002669
841 Ga0070684_100118730
842 Ga0068853_100917433
843 Ga0068853_101122854
844 Ga0070672_100141813
845 Ga0070672_100354266
846 Ga0070672_100621451
847 Ga0070672_100799900
848 Ga0070686_100842835
849 Ga0070686_101392866
850 Ga0070693_100290458
851 Ga0070665_100064660
852 Ga0070665_100337642
853 Ga0070665_100757338
854 Ga0070665_102004070
855 Ga0070704_100528198
856 Ga0070664_100087600
857 Ga0070664_100165434
858 Ga0070664_100184399
859 Ga0070664_100197470
860 Ga0070664_100491359
861 Ga0070664_100549610
862 Ga0070664_100719467
863 Ga0068857_100073434
864 Ga0068857_100719268
865 Ga0068857_100901152
866 Ga0068857_102171205
867 Ga0068854_100571855
868 Ga0068854_100841276
869 Ga0070702_100289838
870 Ga0070702_101155166
871 Ga0068852_100080524
872 Ga0068852_100406241
873 Ga0068852_100505890
874 Ga0068859_100013562
875 Ga0068859_100013830
876 Ga0068859_100042847
877 Ga0068859_100145417
878 Ga0068859_100268908
879 Ga0068859_100355209
880 Ga0068859_100516580
881 Ga0068859_100555425
882 Ga0068859_100609294
883 Ga0068859_100759746
884 Ga0068859_100786647
885 Ga0068859_101419754
886 Ga0068859_101489715
887 Ga0068859_102338479
888 Ga0068859_102854114
889 Ga0068864_100010460
890 Ga0068864_100192211
891 Ga0068864_100950092
892 Ga0068864_101938783
893 Ga0068866_10074811
894 Ga0068866_10305692
895 Ga0068866_10787442
896 Ga0068861_100051340
897 Ga0068861_100054764
898 Ga0068861_100087878
899 Ga0068861_100649976
900 Ga0068861_101132408
901 Ga0068861_102501786
902 Ga0068851_10424510
903 Ga0068870_10780175
904 Ga0068870_11237958
905 Ga0068863_100001966
906 Ga0068863_100145776
907 Ga0068863_101051708
908 Ga0068863_101170353
909 Ga0068863_102580928
910 Ga0068858_100221633
911 Ga0068858_100355511
912 Ga0068858_100703032
913 Ga0068860_100004009
914 Ga0068860_100005881
915 Ga0068860_100195525
916 Ga0068860_100239146
917 Ga0068860_101104792
918 Ga0068860_102568950
919 Ga0068862_100415963
920 Ga0068862_100849258
921 Ga0068862_101346236
922 Ga0068862_101412879
923 Ga0081539_10001794
924 Ga0070717_11221272
925 Ga0075432_10312819
926 Ga0075432_10494114
927 Ga0070715_10540631
928 Ga0070716_100271747
929 Ga0097621_100005069
930 Ga0097621_100204497
931 Ga0097621_100343939
932 Ga0097621_100460416
933 Ga0097621_100568195
934 Ga0097621_101572586
935 Ga0075370_10874260
936 Ga0068871_100008961
937 Ga0068871_100017013
938 Ga0068871_100327403
939 Ga0068871_100827830
940 Ga0068871_101024414
941 Ga0075428_100012494
942 Ga0075428_102595621
943 Ga0075430_100817277
944 Ga0075431_100055186
945 Ga0075431_101566198
946 Ga0075429_100006150
947 Ga0075429_100313024
948 Ga0075429_100463541
949 Ga0068865_100359529
950 Ga0097620_100013560
951 Ga0097620_100013830
952 Ga0097620_100042845
953 Ga0097620_100145418
954 Ga0097620_100268914
955 Ga0097620_100355215
956 Ga0097620_100516578
957 Ga0097620_100555436
958 Ga0097620_100609262
959 Ga0097620_100759728
960 Ga0097620_100786663
961 Ga0097620_101419866
962 Ga0097620_101489543
963 Ga0097620_102339664
964 Ga0097620_102855217
965 Ga0105251_10053057
966 Ga0105251_10065440
967 Ga0105244_10000004
968 Ga0105240_10669872
969 Ga0105240_12165303
970 Ga0111539_10041924
971 Ga0111539_10054398
972 Ga0111539_10433793
973 Ga0111539_11018641
974 Ga0111539_11388357
975 Ga0111539_11414666
976 Ga0111539_13476687
977 Ga0105247_10001409
978 Ga0105247_10240118
979 Ga0114129_10069169
980 Ga0114129_10085559
981 Ga0114129_11658103
982 Ga0114129_13124094
983 Ga0114129_13378419
984 Ga0105243_11763213
985 Ga0105241_10200544
986 Ga0105241_10358736
987 Ga0105241_11591563
988 Ga0105241_11725373
989 Ga0105242_10002507
990 Ga0105242_10016969
991 Ga0105242_10236415
992 Ga0105242_10523942
993 Ga0105242_11902181
994 Ga0105242_13009761
995 Ga0105248_10390555
996 Ga0105248_11002871
997 Ga0105237_10797586
998 Ga0105237_11305305
999 Ga0105237_12220334
1000 Ga0105249_10001319
1001 Ga0105249_10003297
1002 Ga0105249_10007594
1003 Ga0105249_10116159
1004 Ga0105249_10239858
1005 Ga0105249_10317806
1006 Ga0105249_10352843
1007 Ga0105249_11384769
1008 Ga0105249_11389812
1009 Ga0105249_11763330
1010 Ga0105249_11799193
1011 Ga0105249_12793819
1012 Ga0105239_10502842
1013 Ga0105246_10062756
1014 Ga0105246_10134559
1015 Ga0105246_10808700
1016 Ga0157373_10000002
1017 Ga0157373_10011815
1018 Ga0157373_10564275
1019 Ga0157373_10605037
1020 Ga0157373_11101378
1021 Ga0157371_10130310
1022 Ga0157371_10363368
1023 Ga0157370_10000097
1024 Ga0157370_10002822
1025 Ga0157370_10137162
1026 Ga0157370_10166724
1027 Ga0157370_10170945
1028 Ga0157369_10009083
1029 Ga0157369_10030197
1030 Ga0157369_10064219
1031 Ga0157369_11268232
1032 Ga0157374_10008802
1033 Ga0157374_10027181
1034 Ga0157374_10137876
1035 Ga0157374_10182966
1036 Ga0157374_10420638
1037 Ga0157374_10537427
1038 Ga0157374_12280875
1039 Ga0157378_10011051
1040 Ga0157378_10022058
1041 Ga0157378_10199073
1042 Ga0157378_10237076
1043 Ga0157378_10439418
1044 Ga0157378_10906581
1045 Ga0157378_11150171
1046 Ga0163162_10019416
1047 Ga0163162_10026218
1048 Ga0163162_10034614
1049 Ga0163162_10093233
1050 Ga0163162_10124962
1051 Ga0163162_10204595
1052 Ga0163162_10301734
1053 Ga0163162_10676330
1054 Ga0163162_10743235
1055 Ga0163162_10794787
1056 Ga0163162_10914492
1057 Ga0163162_11037318
1058 Ga0163162_11266750
1059 Ga0163162_12286148
1060 Ga0163162_12352130
1061 Ga0157372_10149650
1062 Ga0157372_10251303
1063 Ga0157372_10353004
1064 Ga0157372_11560919
1065 Ga0157372_11699701
1066 Ga0157372_12590426
1067 Ga0157372_12690523
1068 Ga0157372_12991807
1069 Ga0157375_10006773
1070 Ga0157375_10057411
1071 Ga0157375_10079911
1072 Ga0157375_10082143
1073 Ga0157375_10092904
1074 Ga0157375_10126295
1075 Ga0157375_10140620
1076 Ga0157375_10200943
1077 Ga0157375_10322326
1078 Ga0157375_10697142
1079 Ga0157375_10814958
1080 Ga0157375_11220379
1081 Ga0157375_12344968
1082 Ga0163163_10001981
1083 Ga0163163_10514137
1084 Ga0163163_10673108
1085 Ga0163163_11514557
1086 Ga0163163_12147433
1087 Ga0163163_12178397
1088 Ga0163163_12992740
1089 Ga0157380_10014307
1090 Ga0157380_10018408
1091 Ga0157380_10098483
1092 Ga0157380_10861281
1093 Ga0157380_10953870
1094 Ga0157380_11059303
1095 Ga0157380_11294363
1096 Ga0157380_11843938
1097 Ga0157380_11901490
1098 Ga0157377_10013851
1099 Ga0157377_10071880
1100 Ga0157377_10101437
1101 Ga0157377_11135217
1102 Ga0157377_11337023
1103 Ga0157379_10016773
1104 Ga0157379_10168872
1105 Ga0157379_10186779
1106 Ga0157379_10635773
1107 Ga0157379_10809923
1108 Ga0157379_10984598
1109 Ga0157376_10091666
1110 Ga0157376_10264607
1111 Ga0157376_10565587
1112 Ga0157376_11098384
1113 Ga0157376_11736848
1114 Ga0157376_12998747
1115 Ga0182006_1002176
1116 Ga0182007_10180118
1117 Ga0163161_10000026
1118 Ga0163161_10139905
1119 Ga0163161_10153991
1120 Ga0163161_10211944
1121 Ga0163161_10429485
1122 Ga0163161_10931595
1123 Ga0207697_10107638
1124 Ga0207655_1000008
1125 Ga0207713_1163087
1126 Ga0207713_1247042
1127 Ga0207682_10029013
1128 Ga0207642_10212513
1129 Ga0207642_10667951
1130 Ga0207710_10015279
1131 Ga0207688_10110660
1132 Ga0207680_10072531
1133 Ga0207680_10088068
1134 Ga0207680_11016188
1135 Ga0207647_10042205
1136 Ga0207647_10222973
1137 Ga0207645_10011823
1138 Ga0207645_10692343
1139 Ga0207643_10400214
1140 Ga0207643_10923180
1141 Ga0207705_10689300
1142 Ga0207684_11352300
1143 Ga0207654_10833869
1144 Ga0207662_10020618
1145 Ga0207662_10459852
1146 Ga0207657_10168828
1147 Ga0207649_10133661
1148 Ga0207649_10428961
1149 Ga0207652_10816856
1150 Ga0207646_10194660
1151 Ga0207681_10140828
1152 Ga0207681_11018178
1153 Ga0207681_11816878
1154 Ga0207650_10035597
1155 Ga0207650_10118760
1156 Ga0207650_10265935
1157 Ga0207650_10316727
1158 Ga0207650_11107185
1159 Ga0207650_11260871
1160 Ga0207650_11332689
1161 Ga0207659_10055394
1162 Ga0207659_10221808
1163 Ga0207659_10416583
1164 Ga0207659_11279398
1165 Ga0207659_11419690
1166 Ga0207659_11692003
1167 Ga0207700_11050547
1168 Ga0207644_10212241
1169 Ga0207644_10433401
1170 Ga0207706_10045661
1171 Ga0207706_10074986
1172 Ga0207706_10267209
1173 Ga0207706_10449222
1174 Ga0207706_10696234
1175 Ga0207686_10000200
1176 Ga0207686_11263386
1177 Ga0207709_11240362
1178 Ga0207670_10103846
1179 Ga0207670_10163574
1180 Ga0207670_10284640
1181 Ga0207670_11505317
1182 Ga0207669_10653424
1183 Ga0207669_10976950
1184 Ga0207669_11112106
1185 Ga0207669_11137177
1186 Ga0207704_10658840
1187 Ga0207704_10780080
1188 Ga0207665_10600284
1189 Ga0207691_10090554
1190 Ga0207691_10401557
1191 Ga0207691_11145204
1192 Ga0207691_11667356
1193 Ga0207711_11242231
1194 Ga0207689_10039743
1195 Ga0207689_10169171
1196 Ga0207689_10209134
1197 Ga0207689_10260045
1198 Ga0207689_10374793
1199 Ga0207689_10770283
1200 Ga0207661_10030202
1201 Ga0207661_10226925
1202 Ga0207679_10178810
1203 Ga0207679_10469833
1204 Ga0207667_10749876
1205 Ga0207651_10384443
1206 Ga0207712_10002897
1207 Ga0207712_10004281
1208 Ga0207712_10077710
1209 Ga0207712_10134125
1210 Ga0207712_10826164
1211 Ga0207712_10899806
1212 Ga0207712_11963244
1213 Ga0207668_10087974
1214 Ga0207668_10202832
1215 Ga0207668_11799895
1216 Ga0207640_10447548
1217 Ga0207640_10482078
1218 Ga0207640_11266351
1219 Ga0207658_10068775
1220 Ga0207658_10363666
1221 Ga0207658_10403600
1222 Ga0207658_10762058
1223 Ga0207658_11583956
1224 Ga0207677_10033907
1225 Ga0207677_10313291
1226 Ga0207677_10458983
1227 Ga0207677_12140386
1228 Ga0207703_10304457
1229 Ga0207703_10404519
1230 Ga0207703_10795798
1231 Ga0207639_10576649
1232 Ga0207639_10918954
1233 Ga0207639_11990037
1234 Ga0207678_10054197
1235 Ga0207678_10325103
1236 Ga0207702_10983318
1237 Ga0207702_10984363
1238 Ga0207641_10020162
1239 Ga0207641_10041489
1240 Ga0207641_11046125
1241 Ga0207641_11328397
1242 Ga0207648_10047106
1243 Ga0207648_10055161
1244 Ga0207648_10057539
1245 Ga0207648_10181197
1246 Ga0207648_10315820
1247 Ga0207648_10532132
1248 Ga0207648_11332845
1249 Ga0207648_11436195
1250 Ga0207676_10129917
1251 Ga0207676_10156593
1252 Ga0207676_10157440
1253 Ga0207676_10729483
1254 Ga0207674_10019713
1255 Ga0207674_10062109
1256 Ga0207674_10180762
1257 Ga0207674_10909694
1258 Ga0207674_11261776
1259 Ga0207675_100010610
1260 Ga0207675_100034120
1261 Ga0207675_100270961
1262 Ga0207675_100363355
1263 Ga0207675_100632873
1264 Ga0207675_101079257
1265 Ga0207675_101653731
1266 Ga0207675_102247055
1267 Ga0207683_10991110
1268 Ga0207683_11012352
1269 Ga0207698_10372018
1270 Ga0207698_10674453
1271 Ga0207698_10971600
1272 Ga0207698_11074522
1273 Ga0207698_12342274
1274 Ga0209995_1027606
1275 Ga0207428_10672672
1276 Ga0207428_11301296
1277 Ga0268266_10277028
1278 Ga0268266_10323399
1279 Ga0268266_10468923
1280 Ga0268265_10234832
1281 Ga0268265_10291949
1282 Ga0268265_11009699
1283 Ga0268265_11232908
1284 Ga0268265_11847226
1285 Ga0268264_10005626
1286 Ga0268264_10042733
1287 Ga0268264_10077236
1288 Ga0268264_10156577
1289 Ga0268264_11074970
1290 Ga0268264_11170489
1291 Ga0268264_11616869
1292 Ga0307515_10000380
1293 Ga0307515_10006611
1294 Ga0307509_10487751
1295 Ga0307408_100020641
1296 Ga0316576_10263168
1297 Ga0307413_10598496
1298 Ga0307413_10819778
1299 Ga0307410_10000071
1300 Ga0307406_10000037
1301 Ga0307407_10006810
1302 Ga0307409_102310819
1303 Ga0307416_102686002
1304 Ga0307414_10000012
1305 Ga0307414_10874760
1306 Ga0307411_10399037
1307 Ga0307411_10800353
1308 Ga0307411_11281402
1309 Ga0373929_0044557
1310 Ga0373934_0220285
1311 Ga0373952_0029310
1312 Ga0373955_0325662
1313 Ga0316574_0243033
1314 Ga0373924_0221624
1315 Ga0373937_0067380
1316 Ga0316584_0517844
1317 Ga0395900_1769213
1318 Ga0395905_0179469
1319 Ga0436365_0729052
1320 Ga0436365_0843457
1321 Ga0436365_0853306
1322 Ga0436365_1151340
1323 Ga0436365_1758907
1324 Ga0439447_147320
1325 Ga0439461_0093789
1326 Ga0439466_0022583
1327 Ga0439466_0152692
1328 Ga0451800_0578341
1329 Ga0451802_0144258
1330 Ga0451802_0831830
1331 Ga0451807_1994737
1332 Ga0451833_1296905
1333 Ga0451839_0785002
1334 Ga0451843_0767574
1335 Ga0451853_3843889
1336 Ga0439431_0233793
1337 Ga0439445_0117259
1338 Ga0439444_0039841
1339 Ga0439444_0200902
1340 Ga0439460_0169504
1341 Ga0451577_0001044
1342 Ga0451577_0266645
1343 Ga0451577_0526212
1344 Ga0453683_0000005
1345 Ga0453683_0000792
1346 Ga0453683_0007079
1347 Ga0453683_0009838
1348 Ga0453683_0135617
1349 Ga0453683_0523355
1350 Ga0453683_1053705
1351 Ga0453683_1127602
1352 Ga0453684_0000610
1353 Ga0453684_0037330
1354 Ga0453684_0041845
1355 Ga0453684_0073834
1356 Ga0453684_0187867
1357 Ga0453684_0261375
1358 Ga0453684_0310964
1359 Ga0453684_0358626
1360 Ga0453684_0730654
1361 Ga0451576_0000193
1362 Ga0451576_0006040
1363 Ga0451576_0006802
1364 Ga0451576_0011516
1365 Ga0451576_0238042
1366 Ga0451576_0858618
1367 Ga0451576_1095975
1368 Ga0495592_0445143
1369 Ga0495638_0027584
1370 Ga0495638_0309182
1371 Ga0495606_0000021
1372 Ga0495610_0000279
1373 Ga0495610_0001345
1374 Ga0495628_0299785
1375 Ga0495632_0296989
1376 Ga0495637_0088822
1377 Ga0495643_0255454
1378 Ga0495587_0129525
1379 Ga0495598_0148551
1380 Ga0495621_0304944
1381 Ga0495645_0143842
1382 Ga0495633_0005737
1383 Ga0495667_0106133
1384 Ga0495668_0000097
1385 Ga0495668_0013869
1386 Ga0495661_0022788
1387 Ga0495613_0533742
1388 Ga0495671_0314262
1389 Ga0495581_0643331
1390 Ga0495604_0288924
1391 Ga0495674_0838556
1392 Ga0495672_0395622
1393 Ga0495680_0259306
1394 Ga0495686_0000625
1395 Ga0496100_0514093
1396 Ga0496104_0943806
1397 Ga0496110_0220839
1398 Ga0496110_1696769
1399 Ga0496111_0086257
1400 Ga0496111_0180514
1401 Ga0496112_1227484
1402 Ga0496112_1500157
1403 Ga0496113_0896284
1404 Ga0496114_0062136
1405 Ga0496116_0000032
1406 Ga0496121_0233147
1407 Ga0496124_0299158
1408 Ga0496125_0000111
1409 Ga0496126_0004578
1410 Ga0496126_0167088
1411 Ga0501290_062370
1412 Ga0501038_0086325
1413 Ga0501238_000090
1414 Ga0501249_043346
1415 Ga0501266_016963
1416 Ga0501280_001826
1417 nmdc:mga07m45_686929_c1
1418 nmdc:mga05p37_231810_c1
1419 nmdc:mga05p37_439472_c1
1420 nmdc:mga05p37_46311_c1
1421 nmdc:mga09592_208367_c1
1422 nmdc:mga09592_375511_c1
1423 nmdc:mga0qj67_1193098_c1
1424 nmdc:mga06r32_1072593_c1
1425 nmdc:mga06r32_360646_c1
1426 nmdc:mga08y16_1495192_c1
1427 nmdc:mga08y16_1640127_c1
1428 nmdc:mga08y16_285380_c1
1429 nmdc:mga08y16_771138_c1
1430 nmdc:mga08y16_897432_c1
1431 nmdc:mga0n895_179543_c1
1432 Ga0500635_0082404
1433 Ga0500644_0166812
1434 Ga0500646_0136625
1435 Ga0500647_0085727
1436 Ga0500583_0154170
1437 Ga0500641_0000020
1438 Ga0500642_0007034
1439 Ga0500573_0352650
1440 Ga0500604_0011813
1441 Ga0500616_0033668
1442 Ga0500627_0002345
1443 Ga0500584_040179
1444 Ga0500611_000020
1445 2644369708
1446 2644642420
1447 2644685066
1448 2738732096
1449 2738764661
1450 2739213676
1451 2802653989
1452 2857615976
1453 2904422169
1454 2904560054
1455 2929153209
1456 2977269901

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

22

135

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8811 2 66
3zec-assembly1.cif.gz_A fic protein from shewanella oneidensis (e73g mutant) in complex with amppnp 0.872 13 67
1sd6-assembly1.cif.gz_B crystal structure of native meci at 2.65 a 0.8605 1 116
2mh2-assembly1.cif.gz_A structural insights into the dna recognition and protein interaction domains reveal fundamental homologous dna pairing properties of hop2 0.8602 8 66
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.857 2 66
ID Description Score Start End Superfamily
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9047 4 65 1.10.10.10
2xigA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8983 6 68 1.10.10.10
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.8857 18 66 3.30.230.130
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8804 5 67 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8775 4 65 1.10.10.10
ID Description Score Start End GO Terms
AF-H1DIA1-F1-model_v4 Penicillinase repressor 0.9788 1 74 GO:0003677
GO:0005737
GO:0045892
AF-A0A519RYD7-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9766 2 118 GO:0003677
GO:0005737
GO:0045892
AF-A0A1M5N177-F1-model_v4 Predicted transcriptional regulator 0.9736 1 118 GO:0003677
GO:0005737
GO:0045892
AF-A0A7J7AZU7-F1-model_v4 deleted 0.9684 1 78
AF-A0A1F3P524-F1-model_v4 Transcriptional regulator 0.9679 1 78 GO:0003677
GO:0005737
GO:0045892

Map