F477802
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 728 | 434 | 1454 | 123 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10123030|Ga0182008_101230302 |
| Length | 146 |
| Sequence | LVRARLVAHPATAQFSEERHVARIAGVNVPSQKPIWIALTYIFGIGQTTSRKILNEVQIPLQRRTAELTEAELSRIRDKIDREYKVEGDLRRDVAMSIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKGKARPIAGKKKATKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 2 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 14 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 15 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 16 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 68 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 104 | 3300019161 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 105 | 3300019192 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 106 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 110 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 116 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 117 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 118 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300023536 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 122 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 123 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 129 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 188 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 190 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 191 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 194 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 199 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 201 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 203 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 205 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 206 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 207 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 208 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 210 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 211 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 212 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 213 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 214 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032120 | Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 216 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 218 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 224 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 225 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 227 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 233 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 235 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 238 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 239 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 242 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 243 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 244 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300036535 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 249 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 250 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 251 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 252 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 253 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 254 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 255 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 256 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 257 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 258 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 259 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 260 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 262 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 263 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 264 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 265 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 266 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 267 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 270 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 325 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 326 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 327 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 328 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 329 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 331 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 355 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 356 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 357 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 358 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 359 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 360 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 361 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 362 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 363 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 364 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 367 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 370 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 373 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 374 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 375 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 376 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 377 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 378 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 379 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 380 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 381 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 382 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 383 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 384 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 397 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 398 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 399 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 400 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 401 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 402 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 403 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 404 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 405 | 3300059625 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 406 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 407 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 408 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 409 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059656 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 2522572158 | Azospirillum halopraeferens DSM 3675 | Isolate | Unclassified |
| 423 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 424 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 425 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 426 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 427 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 428 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 429 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 430 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 431 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 432 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 433 | 2909399089 | Nguyenibacter vanlangensis LMG 31431 | Isolate | Unclassified |
| 434 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.34 |
| Metatranscriptomes | 13.87 |
| Isolates | 1.79 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.32 |
| Nodule | 0 |
| Rhizoplane | 4.53 |
| Rhizosphere | 83.24 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182008_10123030 | 3300014497 | Bacteria | 1290 |
| 2 | JGI24735J21928_10180060 | 3300002067 | Bacteria | 612 |
| 3 | JGI25156J39149_1048087 | 3300002705 | Bacteria | 567 |
| 4 | JGI25154J39366_1000593 | 3300002738 | Bacteria | 17447 |
| 5 | JGI25157J39369_1001134 | 3300002741 | Bacteria | 11672 |
| 6 | Ga0007410J51695_1090156 | 3300003574 | Bacteria | 691 |
| 7 | Ga0007416J51690_1044706 | 3300003577 | Bacteria | 700 |
| 8 | Ga0055539_1002928 | 3300003752 | Bacteria | 2478 |
| 9 | Ga0055533_1000043 | 3300003756 | Bacteria | 229262 |
| 10 | Ga0055525_1000641 | 3300003759 | Bacteria | 14040 |
| 11 | Ga0055535_1000420 | 3300003761 | Bacteria | 39880 |
| 12 | Ga0055529_1000322 | 3300003763 | Bacteria | 54232 |
| 13 | JGI25405J52794_10006418 | 3300003911 | Bacteria | 2149 |
| 14 | Ga0058859_11395877 | 3300004798 | Bacteria | 861 |
| 15 | Ga0058859_11499848 | 3300004798 | Bacteria | 1131 |
| 16 | Ga0058861_11919994 | 3300004800 | Bacteria | 1104 |
| 17 | Ga0058860_12155775 | 3300004801 | Bacteria | 1240 |
| 18 | Ga0070658_10660472 | 3300005327 | Bacteria | 907 |
| 19 | Ga0070683_102333734 | 3300005329 | Bacteria | 513 |
| 20 | Ga0070690_100111170 | 3300005330 | Bacteria | 1828 |
| 21 | Ga0070670_100171189 | 3300005331 | Bacteria | 1883 |
| 22 | Ga0068869_100100346 | 3300005334 | Bacteria | 2189 |
| 23 | Ga0068869_101805685 | 3300005334 | Bacteria | 547 |
| 24 | Ga0070666_10086429 | 3300005335 | Bacteria | 2149 |
| 25 | Ga0070680_101578527 | 3300005336 | Bacteria | 568 |
| 26 | Ga0068868_100616452 | 3300005338 | Bacteria | 963 |
| 27 | Ga0070689_100198876 | 3300005340 | Bacteria | 1635 |
| 28 | Ga0070691_10257636 | 3300005341 | Bacteria | 938 |
| 29 | Ga0070687_100028209 | 3300005343 | Bacteria | 2720 |
| 30 | Ga0070687_101046781 | 3300005343 | Bacteria | 594 |
| 31 | Ga0070661_100211043 | 3300005344 | Bacteria | 1486 |
| 32 | Ga0070675_100605768 | 3300005354 | Bacteria | 994 |
| 33 | Ga0070671_100003486 | 3300005355 | Bacteria | 12276 |
| 34 | Ga0070673_100110053 | 3300005364 | Bacteria | 2283 |
| 35 | Ga0070688_100330669 | 3300005365 | Bacteria | 1110 |
| 36 | Ga0070659_100203963 | 3300005366 | Bacteria | 1628 |
| 37 | Ga0070659_100721941 | 3300005366 | Bacteria | 863 |
| 38 | Ga0070709_10015699 | 3300005434 | Bacteria | 4313 |
| 39 | Ga0070709_10572376 | 3300005434 | Bacteria | 867 |
| 40 | Ga0070714_100024965 | 3300005435 | Bacteria | 4928 |
| 41 | Ga0070713_100011844 | 3300005436 | Bacteria | 6372 |
| 42 | Ga0070710_10003492 | 3300005437 | Bacteria | 7449 |
| 43 | Ga0070710_10078215 | 3300005437 | Bacteria | 1924 |
| 44 | Ga0070711_100028081 | 3300005439 | Bacteria | 3699 |
| 45 | Ga0070711_100302792 | 3300005439 | Bacteria | 1272 |
| 46 | Ga0070694_100052832 | 3300005444 | Bacteria | 2748 |
| 47 | Ga0070663_100757558 | 3300005455 | Bacteria | 829 |
| 48 | Ga0070662_100102710 | 3300005457 | Bacteria | 2167 |
| 49 | Ga0070662_101647757 | 3300005457 | Bacteria | 554 |
| 50 | Ga0068867_100484225 | 3300005459 | Bacteria | 1061 |
| 51 | Ga0070685_10615579 | 3300005466 | Bacteria | 783 |
| 52 | Ga0070679_100269034 | 3300005530 | Bacteria | 1658 |
| 53 | Ga0070684_100516613 | 3300005535 | Bacteria | 1107 |
| 54 | Ga0070684_100721945 | 3300005535 | Bacteria | 929 |
| 55 | Ga0070684_101169908 | 3300005535 | Bacteria | 723 |
| 56 | Ga0068853_100293022 | 3300005539 | Bacteria | 1502 |
| 57 | Ga0070672_100558846 | 3300005543 | Bacteria | 994 |
| 58 | Ga0070672_101453073 | 3300005543 | Bacteria | 614 |
| 59 | Ga0070686_100447851 | 3300005544 | Bacteria | 992 |
| 60 | Ga0070686_101297527 | 3300005544 | Bacteria | 608 |
| 61 | Ga0070695_100021458 | 3300005545 | Bacteria | 3953 |
| 62 | Ga0070696_100582636 | 3300005546 | Bacteria | 900 |
| 63 | Ga0070696_101733063 | 3300005546 | Bacteria | 539 |
| 64 | Ga0070693_100589413 | 3300005547 | Bacteria | 801 |
| 65 | Ga0068855_100534661 | 3300005563 | Bacteria | 1270 |
| 66 | Ga0070664_100235185 | 3300005564 | Bacteria | 1643 |
| 67 | Ga0068854_100023136 | 3300005578 | Bacteria | 4241 |
| 68 | Ga0068856_100149077 | 3300005614 | Bacteria | 2347 |
| 69 | Ga0068856_100256499 | 3300005614 | Bacteria | 1764 |
| 70 | Ga0070702_100277676 | 3300005615 | Bacteria | 1149 |
| 71 | Ga0068864_100714314 | 3300005618 | Bacteria | 980 |
| 72 | Ga0068864_100991110 | 3300005618 | Bacteria | 833 |
| 73 | Ga0068861_100152994 | 3300005719 | Bacteria | 1895 |
| 74 | Ga0068851_10162545 | 3300005834 | Bacteria | 1227 |
| 75 | Ga0068863_100662454 | 3300005841 | Bacteria | 1036 |
| 76 | Ga0068858_100848223 | 3300005842 | Bacteria | 892 |
| 77 | Ga0068860_100217691 | 3300005843 | Bacteria | 1854 |
| 78 | Ga0068860_100671474 | 3300005843 | Bacteria | 1045 |
| 79 | Ga0081538_10120554 | 3300005981 | Bacteria | 1261 |
| 80 | Ga0081540_1003020 | 3300005983 | Bacteria | 13478 |
| 81 | Ga0081539_10046287 | 3300005985 | Bacteria | 2494 |
| 82 | Ga0070717_10166904 | 3300006028 | Bacteria | 1912 |
| 83 | Ga0075363_100028810 | 3300006048 | Bacteria | 2861 |
| 84 | Ga0075364_10020585 | 3300006051 | Bacteria | 4150 |
| 85 | Ga0075364_10324752 | 3300006051 | Bacteria | 1048 |
| 86 | Ga0070715_10014729 | 3300006163 | Bacteria | 2902 |
| 87 | Ga0070715_10304664 | 3300006163 | Bacteria | 854 |
| 88 | Ga0070716_100038933 | 3300006173 | Bacteria | 2635 |
| 89 | Ga0070716_101106925 | 3300006173 | Bacteria | 632 |
| 90 | Ga0070712_100004635 | 3300006175 | Bacteria | 8499 |
| 91 | Ga0070712_100013564 | 3300006175 | Bacteria | 5211 |
| 92 | Ga0070712_100197997 | 3300006175 | Bacteria | 1576 |
| 93 | Ga0075367_10660157 | 3300006178 | Bacteria | 665 |
| 94 | Ga0075366_10000795 | 3300006195 | Bacteria | 15124 |
| 95 | Ga0075366_10018750 | 3300006195 | Bacteria | 3997 |
| 96 | Ga0075366_10211595 | 3300006195 | Bacteria | 1180 |
| 97 | Ga0097621_100289575 | 3300006237 | Bacteria | 1444 |
| 98 | Ga0075370_10011014 | 3300006353 | Bacteria | 4743 |
| 99 | Ga0068871_100165726 | 3300006358 | Bacteria | 1891 |
| 100 | Ga0075428_100601252 | 3300006844 | Bacteria | 1175 |
| 101 | Ga0075429_100137036 | 3300006880 | Bacteria | 2142 |
| 102 | Ga0068865_102092155 | 3300006881 | Bacteria | 514 |
| 103 | Ga0075436_100109455 | 3300006914 | Bacteria | 1928 |
| 104 | Ga0105250_10257088 | 3300009092 | Bacteria | 747 |
| 105 | Ga0105240_11571470 | 3300009093 | Bacteria | 689 |
| 106 | Ga0105240_11739249 | 3300009093 | Bacteria | 650 |
| 107 | Ga0111539_10077885 | 3300009094 | Bacteria | 3901 |
| 108 | Ga0111539_10340819 | 3300009094 | Bacteria | 1745 |
| 109 | Ga0105245_10580509 | 3300009098 | Bacteria | 1145 |
| 110 | Ga0114129_10722753 | 3300009147 | Bacteria | 1278 |
| 111 | Ga0105243_10249883 | 3300009148 | Bacteria | 1583 |
| 112 | Ga0105241_10079232 | 3300009174 | Bacteria | 2568 |
| 113 | Ga0105241_10288877 | 3300009174 | Bacteria | 1403 |
| 114 | Ga0105242_11364451 | 3300009176 | Bacteria | 735 |
| 115 | Ga0105248_11347305 | 3300009177 | Bacteria | 807 |
| 116 | Ga0105248_11835400 | 3300009177 | Bacteria | 688 |
| 117 | Ga0105237_10051839 | 3300009545 | Bacteria | 4121 |
| 118 | Ga0105237_10211706 | 3300009545 | Bacteria | 1938 |
| 119 | Ga0105237_10390119 | 3300009545 | Bacteria | 1397 |
| 120 | Ga0105237_10895092 | 3300009545 | Bacteria | 894 |
| 121 | Ga0105237_12247333 | 3300009545 | Bacteria | 555 |
| 122 | Ga0105238_10205025 | 3300009551 | Bacteria | 1948 |
| 123 | Ga0105238_10237854 | 3300009551 | Bacteria | 1798 |
| 124 | Ga0105238_10957271 | 3300009551 | Bacteria | 876 |
| 125 | Ga0105249_10323671 | 3300009553 | Bacteria | 1553 |
| 126 | Ga0105249_10648792 | 3300009553 | Bacteria | 1113 |
| 127 | Ga0105249_12672687 | 3300009553 | Bacteria | 571 |
| 128 | Ga0105239_10623881 | 3300010375 | Bacteria | 1230 |
| 129 | Ga0105239_11647301 | 3300010375 | Bacteria | 742 |
| 130 | Ga0105239_11768370 | 3300010375 | Bacteria | 716 |
| 131 | Ga0105239_12212956 | 3300010375 | Bacteria | 639 |
| 132 | Ga0105246_11610726 | 3300011119 | Bacteria | 614 |
| 133 | Ga0157369_10034850 | 3300013105 | Bacteria | 5521 |
| 134 | Ga0157369_10388715 | 3300013105 | Bacteria | 1448 |
| 135 | Ga0157369_10885588 | 3300013105 | Bacteria | 916 |
| 136 | Ga0157374_10036137 | 3300013296 | Bacteria | 4523 |
| 137 | Ga0157374_11702013 | 3300013296 | Bacteria | 655 |
| 138 | Ga0157378_10129245 | 3300013297 | Bacteria | 2337 |
| 139 | Ga0157378_12931055 | 3300013297 | Bacteria | 529 |
| 140 | Ga0163162_10411533 | 3300013306 | Bacteria | 1485 |
| 141 | Ga0163162_11598988 | 3300013306 | Bacteria | 743 |
| 142 | Ga0157372_10189020 | 3300013307 | Bacteria | 2385 |
| 143 | Ga0157372_10950203 | 3300013307 | Bacteria | 996 |
| 144 | Ga0157372_11272619 | 3300013307 | Bacteria | 849 |
| 145 | Ga0163163_10477985 | 3300014325 | Bacteria | 1307 |
| 146 | Ga0182008_10155033 | 3300014497 | Bacteria | 1150 |
| 147 | Ga0182008_10202882 | 3300014497 | Bacteria | 1009 |
| 148 | Ga0182008_10445012 | 3300014497 | Bacteria | 703 |
| 149 | Ga0157379_10056467 | 3300014968 | Bacteria | 3508 |
| 150 | Ga0157379_10241188 | 3300014968 | Bacteria | 1640 |
| 151 | Ga0157376_10622730 | 3300014969 | Bacteria | 1077 |
| 152 | Ga0182006_1173195 | 3300015261 | Bacteria | 722 |
| 153 | Ga0184602_128378 | 3300019161 | Bacteria | 807 |
| 154 | Ga0184603_115845 | 3300019192 | Bacteria | 731 |
| 155 | Ga0197907_11204008 | 3300020069 | Bacteria | 760 |
| 156 | Ga0206356_10333002 | 3300020070 | Bacteria | 527 |
| 157 | Ga0206356_10880351 | 3300020070 | Bacteria | 1354 |
| 158 | Ga0206356_10973081 | 3300020070 | Bacteria | 821 |
| 159 | Ga0206349_1471409 | 3300020075 | Bacteria | 587 |
| 160 | Ga0206355_1182367 | 3300020076 | Bacteria | 1317 |
| 161 | Ga0206355_1569053 | 3300020076 | Bacteria | 559 |
| 162 | Ga0206351_10919874 | 3300020077 | Bacteria | 590 |
| 163 | Ga0206352_10996423 | 3300020078 | Bacteria | 824 |
| 164 | Ga0206350_10273521 | 3300020080 | Bacteria | 522 |
| 165 | Ga0206354_10721124 | 3300020081 | Bacteria | 693 |
| 166 | Ga0206354_11216635 | 3300020081 | Bacteria | 653 |
| 167 | Ga0206353_11465831 | 3300020082 | Bacteria | 563 |
| 168 | Ga0154015_1148978 | 3300020610 | Bacteria | 557 |
| 169 | Ga0154015_1457285 | 3300020610 | Bacteria | 747 |
| 170 | Ga0213872_10135020 | 3300021361 | Bacteria | 1085 |
| 171 | Ga0213872_10302772 | 3300021361 | Bacteria | 663 |
| 172 | Ga0213874_10160717 | 3300021377 | Bacteria | 789 |
| 173 | Ga0213874_10196931 | 3300021377 | Bacteria | 723 |
| 174 | Ga0213874_10248759 | 3300021377 | Bacteria | 655 |
| 175 | Ga0213876_10420360 | 3300021384 | Bacteria | 711 |
| 176 | Ga0213875_10455529 | 3300021388 | Bacteria | 612 |
| 177 | Ga0224712_10020260 | 3300022467 | Bacteria | 2254 |
| 178 | Ga0224712_10453857 | 3300022467 | Bacteria | 616 |
| 179 | Ga0224712_10485922 | 3300022467 | Bacteria | 596 |
| 180 | Ga0247552_101829 | 3300023536 | Bacteria | 655 |
| 181 | Ga0228598_1000416 | 3300024227 | Bacteria | 8639 |
| 182 | Ga0209674_100067 | 3300025226 | Bacteria | 253824 |
| 183 | Ga0209672_106433 | 3300025228 | Bacteria | 1909 |
| 184 | Ga0209563_100068 | 3300025230 | Bacteria | 254802 |
| 185 | Ga0207427_100260 | 3300025231 | Bacteria | 41435 |
| 186 | Ga0209258_100342 | 3300025242 | Bacteria | 68390 |
| 187 | Ga0209258_100554 | 3300025242 | Bacteria | 33123 |
| 188 | Ga0209646_1000127 | 3300025246 | Bacteria | 131920 |
| 189 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 190 | Ga0209677_100201 | 3300025253 | Bacteria | 47899 |
| 191 | Ga0209148_1005675 | 3300025254 | Bacteria | 2815 |
| 192 | Ga0209759_1000129 | 3300025256 | Bacteria | 131961 |
| 193 | Ga0209759_1027374 | 3300025256 | Bacteria | 1178 |
| 194 | Ga0209455_1000083 | 3300025272 | Bacteria | 255660 |
| 195 | Ga0209676_1000092 | 3300025292 | Bacteria | 250453 |
| 196 | Ga0209050_1007590 | 3300025298 | Bacteria | 6028 |
| 197 | Ga0207692_10020862 | 3300025898 | Bacteria | 2988 |
| 198 | Ga0207647_10143184 | 3300025904 | Bacteria | 1400 |
| 199 | Ga0207685_10014999 | 3300025905 | Bacteria | 2443 |
| 200 | Ga0207685_10330104 | 3300025905 | Bacteria | 763 |
| 201 | Ga0207685_10372724 | 3300025905 | Bacteria | 725 |
| 202 | Ga0207685_10390681 | 3300025905 | Bacteria | 711 |
| 203 | Ga0207699_10005995 | 3300025906 | Bacteria | 5850 |
| 204 | Ga0207699_10440398 | 3300025906 | Bacteria | 933 |
| 205 | Ga0207699_11094209 | 3300025906 | Bacteria | 590 |
| 206 | Ga0207645_10289237 | 3300025907 | Bacteria | 1089 |
| 207 | Ga0207705_10381815 | 3300025909 | Bacteria | 1088 |
| 208 | Ga0207654_10132215 | 3300025911 | Bacteria | 1581 |
| 209 | Ga0207707_10408317 | 3300025912 | Bacteria | 1165 |
| 210 | Ga0207695_10105714 | 3300025913 | Bacteria | 2802 |
| 211 | Ga0207695_10712542 | 3300025913 | Bacteria | 884 |
| 212 | Ga0207671_10051341 | 3300025914 | Bacteria | 3056 |
| 213 | Ga0207671_10338814 | 3300025914 | Bacteria | 1191 |
| 214 | Ga0207693_10018098 | 3300025915 | Bacteria | 5614 |
| 215 | Ga0207693_10021188 | 3300025915 | Bacteria | 5167 |
| 216 | Ga0207693_10027985 | 3300025915 | Bacteria | 4456 |
| 217 | Ga0207693_10251745 | 3300025915 | Bacteria | 1386 |
| 218 | Ga0207693_10394248 | 3300025915 | Bacteria | 1082 |
| 219 | Ga0207663_10114880 | 3300025916 | Bacteria | 1833 |
| 220 | Ga0207663_10206117 | 3300025916 | Bacteria | 1422 |
| 221 | Ga0207663_10712037 | 3300025916 | Bacteria | 795 |
| 222 | Ga0207660_11275158 | 3300025917 | Bacteria | 597 |
| 223 | Ga0207662_10031400 | 3300025918 | Bacteria | 3086 |
| 224 | Ga0207662_11309525 | 3300025918 | Bacteria | 515 |
| 225 | Ga0207657_11494476 | 3300025919 | Bacteria | 505 |
| 226 | Ga0207649_10312084 | 3300025920 | Bacteria | 1153 |
| 227 | Ga0207652_10375413 | 3300025921 | Bacteria | 1283 |
| 228 | Ga0207681_11431145 | 3300025923 | Bacteria | 580 |
| 229 | Ga0207694_10083671 | 3300025924 | Bacteria | 2509 |
| 230 | Ga0207694_10205510 | 3300025924 | Bacteria | 1603 |
| 231 | Ga0207694_10830323 | 3300025924 | Bacteria | 781 |
| 232 | Ga0207694_10943332 | 3300025924 | Bacteria | 730 |
| 233 | Ga0207659_10042382 | 3300025926 | Bacteria | 3191 |
| 234 | Ga0207659_10825108 | 3300025926 | Bacteria | 797 |
| 235 | Ga0207687_10197952 | 3300025927 | Bacteria | 1568 |
| 236 | Ga0207687_10344140 | 3300025927 | Bacteria | 1213 |
| 237 | Ga0207700_10239003 | 3300025928 | Bacteria | 1547 |
| 238 | Ga0207700_10572137 | 3300025928 | Bacteria | 1004 |
| 239 | Ga0207664_10044723 | 3300025929 | Bacteria | 3469 |
| 240 | Ga0207664_10298575 | 3300025929 | Bacteria | 1417 |
| 241 | Ga0207644_10006009 | 3300025931 | Bacteria | 7913 |
| 242 | Ga0207644_11365041 | 3300025931 | Bacteria | 595 |
| 243 | Ga0207690_10059045 | 3300025932 | Bacteria | 2598 |
| 244 | Ga0207690_10082583 | 3300025932 | Bacteria | 2248 |
| 245 | Ga0207706_10191401 | 3300025933 | Bacteria | 1796 |
| 246 | Ga0207706_11658156 | 3300025933 | Bacteria | 516 |
| 247 | Ga0207686_10618594 | 3300025934 | Bacteria | 854 |
| 248 | Ga0207709_10715401 | 3300025935 | Bacteria | 802 |
| 249 | Ga0207670_10079487 | 3300025936 | Bacteria | 2289 |
| 250 | Ga0207670_11169556 | 3300025936 | Bacteria | 651 |
| 251 | Ga0207665_10012672 | 3300025939 | Bacteria | 5544 |
| 252 | Ga0207665_10305191 | 3300025939 | Bacteria | 1191 |
| 253 | Ga0207691_10087732 | 3300025940 | Bacteria | 2791 |
| 254 | Ga0207711_10951667 | 3300025941 | Bacteria | 798 |
| 255 | Ga0207711_11101606 | 3300025941 | Bacteria | 735 |
| 256 | Ga0207689_10025393 | 3300025942 | Bacteria | 4965 |
| 257 | Ga0207661_10370299 | 3300025944 | Bacteria | 1295 |
| 258 | Ga0207679_10040130 | 3300025945 | Bacteria | 3348 |
| 259 | Ga0207667_10588076 | 3300025949 | Bacteria | 1123 |
| 260 | Ga0207651_10019963 | 3300025960 | Bacteria | 4031 |
| 261 | Ga0207640_10023477 | 3300025981 | Bacteria | 3706 |
| 262 | Ga0207677_11237641 | 3300026023 | Bacteria | 684 |
| 263 | Ga0207639_10449647 | 3300026041 | Bacteria | 1169 |
| 264 | Ga0207639_10804740 | 3300026041 | Bacteria | 876 |
| 265 | Ga0207678_10143467 | 3300026067 | Bacteria | 2038 |
| 266 | Ga0207678_11432391 | 3300026067 | Bacteria | 610 |
| 267 | Ga0207702_10001875 | 3300026078 | Bacteria | 20626 |
| 268 | Ga0207702_10237817 | 3300026078 | Bacteria | 1705 |
| 269 | Ga0207641_10020044 | 3300026088 | Bacteria | 5491 |
| 270 | Ga0207641_11133079 | 3300026088 | Bacteria | 781 |
| 271 | Ga0207676_10876069 | 3300026095 | Bacteria | 879 |
| 272 | Ga0207676_11006898 | 3300026095 | Bacteria | 821 |
| 273 | Ga0207674_10004293 | 3300026116 | Bacteria | 17188 |
| 274 | Ga0207675_100219937 | 3300026118 | Bacteria | 1830 |
| 275 | Ga0207698_10064301 | 3300026142 | Bacteria | 2875 |
| 276 | Ga0210000_1053731 | 3300027462 | Bacteria | 648 |
| 277 | Ga0207428_10271194 | 3300027907 | Bacteria | 1261 |
| 278 | Ga0268264_10182306 | 3300028381 | Bacteria | 1908 |
| 279 | Ga0268264_10829898 | 3300028381 | Bacteria | 925 |
| 280 | Ga0265319_1077434 | 3300028563 | Bacteria | 1059 |
| 281 | Ga0265319_1138665 | 3300028563 | Bacteria | 755 |
| 282 | Ga0265319_1152469 | 3300028563 | Bacteria | 715 |
| 283 | Ga0265334_10120299 | 3300028573 | Bacteria | 939 |
| 284 | Ga0265318_10000273 | 3300028577 | Bacteria | 43832 |
| 285 | Ga0265318_10001387 | 3300028577 | Bacteria | 14390 |
| 286 | Ga0265318_10028950 | 3300028577 | Bacteria | 2162 |
| 287 | Ga0265322_10230541 | 3300028654 | Bacteria | 531 |
| 288 | Ga0265336_10000028 | 3300028666 | Bacteria | 179201 |
| 289 | Ga0307515_10450121 | 3300028794 | Bacteria | 903 |
| 290 | Ga0265338_10145149 | 3300028800 | Bacteria | 1852 |
| 291 | Ga0307511_10051346 | 3300030521 | Bacteria | 3308 |
| 292 | Ga0265769_101828 | 3300030888 | Bacteria | 1062 |
| 293 | Ga0265760_10080711 | 3300031090 | Bacteria | 1007 |
| 294 | Ga0265330_10000998 | 3300031235 | Bacteria | 17255 |
| 295 | Ga0265330_10059999 | 3300031235 | Bacteria | 1656 |
| 296 | Ga0265330_10279046 | 3300031235 | Bacteria | 704 |
| 297 | Ga0265330_10286466 | 3300031235 | Bacteria | 694 |
| 298 | Ga0265332_10000280 | 3300031238 | Bacteria | 40175 |
| 299 | Ga0265332_10002691 | 3300031238 | Bacteria | 8896 |
| 300 | Ga0265332_10214300 | 3300031238 | Bacteria | 799 |
| 301 | Ga0265328_10010978 | 3300031239 | Bacteria | 3631 |
| 302 | Ga0265328_10016001 | 3300031239 | Bacteria | 2927 |
| 303 | Ga0265328_10032488 | 3300031239 | Bacteria | 1937 |
| 304 | Ga0265328_10032994 | 3300031239 | Bacteria | 1920 |
| 305 | Ga0265328_10127622 | 3300031239 | Bacteria | 951 |
| 306 | Ga0265320_10000485 | 3300031240 | Bacteria | 31127 |
| 307 | Ga0265320_10054588 | 3300031240 | Bacteria | 1927 |
| 308 | Ga0265320_10141966 | 3300031240 | Bacteria | 1087 |
| 309 | Ga0265320_10406698 | 3300031240 | Bacteria | 601 |
| 310 | Ga0265325_10001575 | 3300031241 | Bacteria | 15904 |
| 311 | Ga0265325_10061357 | 3300031241 | Bacteria | 1907 |
| 312 | Ga0265325_10410898 | 3300031241 | Bacteria | 592 |
| 313 | Ga0265329_10000013 | 3300031242 | Bacteria | 70645 |
| 314 | Ga0265329_10028096 | 3300031242 | Bacteria | 1846 |
| 315 | Ga0265329_10054803 | 3300031242 | Bacteria | 1266 |
| 316 | Ga0265340_10000189 | 3300031247 | Bacteria | 31156 |
| 317 | Ga0265340_10002589 | 3300031247 | Bacteria | 10274 |
| 318 | Ga0265340_10004541 | 3300031247 | Bacteria | 7738 |
| 319 | Ga0265340_10016859 | 3300031247 | Bacteria | 3779 |
| 320 | Ga0265340_10019984 | 3300031247 | Bacteria | 3445 |
| 321 | Ga0265340_10219713 | 3300031247 | Bacteria | 851 |
| 322 | Ga0265340_10310168 | 3300031247 | Bacteria | 699 |
| 323 | Ga0265339_10008773 | 3300031249 | Bacteria | 6404 |
| 324 | Ga0265339_10017456 | 3300031249 | Bacteria | 4251 |
| 325 | Ga0265339_10092846 | 3300031249 | Bacteria | 1580 |
| 326 | Ga0265339_10229158 | 3300031249 | Bacteria | 906 |
| 327 | Ga0265339_10242742 | 3300031249 | Bacteria | 874 |
| 328 | Ga0265331_10002207 | 3300031250 | Bacteria | 13369 |
| 329 | Ga0265331_10012161 | 3300031250 | Bacteria | 4675 |
| 330 | Ga0265331_10059653 | 3300031250 | Bacteria | 1804 |
| 331 | Ga0265327_10001331 | 3300031251 | Bacteria | 32073 |
| 332 | Ga0265316_10001048 | 3300031344 | Bacteria | 29962 |
| 333 | Ga0265316_10002957 | 3300031344 | Bacteria | 17386 |
| 334 | Ga0265316_10063600 | 3300031344 | Bacteria | 2861 |
| 335 | Ga0265316_10082839 | 3300031344 | Bacteria | 2458 |
| 336 | Ga0307509_10186769 | 3300031507 | Bacteria | 1930 |
| 337 | Ga0265313_10000463 | 3300031595 | Bacteria | 42820 |
| 338 | Ga0265313_10001355 | 3300031595 | Bacteria | 23078 |
| 339 | Ga0265313_10163343 | 3300031595 | Bacteria | 945 |
| 340 | Ga0265313_10349525 | 3300031595 | Bacteria | 586 |
| 341 | Ga0316575_10318071 | 3300031665 | Bacteria | 660 |
| 342 | Ga0265314_10002804 | 3300031711 | Bacteria | 17395 |
| 343 | Ga0265314_10026291 | 3300031711 | Bacteria | 4374 |
| 344 | Ga0265314_10046503 | 3300031711 | Bacteria | 3061 |
| 345 | Ga0265342_10000448 | 3300031712 | Bacteria | 44982 |
| 346 | Ga0265342_10000471 | 3300031712 | Bacteria | 43707 |
| 347 | Ga0265342_10414017 | 3300031712 | Bacteria | 695 |
| 348 | Ga0316576_10013287 | 3300031727 | Bacteria | 5465 |
| 349 | Ga0316576_10015660 | 3300031727 | Bacteria | 5095 |
| 350 | Ga0316576_10239576 | 3300031727 | Bacteria | 1363 |
| 351 | Ga0316576_10544142 | 3300031727 | Bacteria | 851 |
| 352 | Ga0307516_10005443 | 3300031730 | Bacteria | 15230 |
| 353 | Ga0307516_10647953 | 3300031730 | Bacteria | 711 |
| 354 | Ga0307407_10499792 | 3300031903 | Bacteria | 891 |
| 355 | Ga0316053_102602 | 3300032120 | Bacteria | 1032 |
| 356 | Ga0316593_10000059 | 3300032168 | Bacteria | 12661 |
| 357 | Ga0316593_10004223 | 3300032168 | Bacteria | 3666 |
| 358 | Ga0316593_10060312 | 3300032168 | Unclassified | 1296 |
| 359 | Ga0316593_10103206 | 3300032168 | Bacteria | 1013 |
| 360 | Ga0307507_10228329 | 3300033179 | Bacteria | 1239 |
| 361 | Ga0316592_1001046 | 3300033524 | Bacteria | 4313 |
| 362 | Ga0316592_1014236 | 3300033524 | Bacteria | 1647 |
| 363 | Ga0316586_1043276 | 3300033527 | Bacteria | 796 |
| 364 | Ga0316588_1000022 | 3300033528 | Bacteria | 11194 |
| 365 | Ga0316587_1069510 | 3300033529 | Unclassified | 658 |
| 366 | Ga0316596_1031277 | 3300033541 | Bacteria | 1382 |
| 367 | Ga0373930_0201709 | 3300034816 | Bacteria | 518 |
| 368 | Ga0373948_0070889 | 3300034817 | Bacteria | 781 |
| 369 | Ga0373959_0003714 | 3300034820 | Bacteria | 2441 |
| 370 | Ga0373926_0132953 | 3300035083 | Bacteria | 943 |
| 371 | Ga0373926_0165608 | 3300035083 | Bacteria | 845 |
| 372 | Ga0373926_0379546 | 3300035083 | Bacteria | 557 |
| 373 | Ga0373934_0067801 | 3300035086 | Bacteria | 1425 |
| 374 | Ga0373934_0091807 | 3300035086 | Bacteria | 1224 |
| 375 | Ga0373944_0068621 | 3300035089 | Bacteria | 1151 |
| 376 | Ga0373951_0142609 | 3300035091 | Bacteria | 666 |
| 377 | Ga0373923_0017522 | 3300035111 | Bacteria | 2741 |
| 378 | Ga0373953_0276069 | 3300035117 | Bacteria | 732 |
| 379 | Ga0373954_0002392 | 3300035118 | Bacteria | 7857 |
| 380 | Ga0373954_0520581 | 3300035118 | Bacteria | 589 |
| 381 | Ga0373956_0064316 | 3300035119 | Bacteria | 1665 |
| 382 | Ga0373956_0099252 | 3300035119 | Bacteria | 1349 |
| 383 | Ga0373943_0142436 | 3300035170 | Bacteria | 1293 |
| 384 | Ga0373943_0150267 | 3300035170 | Bacteria | 1261 |
| 385 | Ga0373955_0018642 | 3300035172 | Bacteria | 3456 |
| 386 | Ga0373955_0061959 | 3300035172 | Bacteria | 2067 |
| 387 | Ga0373942_0182146 | 3300035207 | Bacteria | 689 |
| 388 | Ga0316574_0039406 | 3300035398 | Bacteria | 2905 |
| 389 | Ga0373924_0021925 | 3300035410 | Bacteria | 2493 |
| 390 | Ga0373931_0028385 | 3300035691 | Bacteria | 2865 |
| 391 | Ga0373935_0018778 | 3300035692 | Bacteria | 4212 |
| 392 | Ga0373935_0125338 | 3300035692 | Bacteria | 1720 |
| 393 | Ga0373935_0517305 | 3300035692 | Bacteria | 868 |
| 394 | Ga0373935_0564651 | 3300035692 | Bacteria | 830 |
| 395 | Ga0373935_0613347 | 3300035692 | Bacteria | 796 |
| 396 | Ga0373927_0017276 | 3300035695 | Bacteria | 4749 |
| 397 | Ga0373927_0195899 | 3300035695 | Bacteria | 1326 |
| 398 | Ga0373927_0364974 | 3300035695 | Bacteria | 952 |
| 399 | Ga0373927_0618975 | 3300035695 | Bacteria | 716 |
| 400 | Ga0373927_0765615 | 3300035695 | Bacteria | 638 |
| 401 | Ga0373927_0921002 | 3300035695 | Bacteria | 577 |
| 402 | Ga0373933_0000858 | 3300035724 | Bacteria | 18640 |
| 403 | Ga0373947_0029627 | 3300035725 | Bacteria | 3212 |
| 404 | Ga0373947_0043754 | 3300035725 | Bacteria | 2675 |
| 405 | Ga0373937_0001081 | 3300036401 | Bacteria | 22992 |
| 406 | Ga0373937_0258653 | 3300036401 | Bacteria | 1641 |
| 407 | Ga0373937_0533962 | 3300036401 | Bacteria | 1114 |
| 408 | Ga0265778_045829 | 3300036457 | Bacteria | 590 |
| 409 | Ga0310110_031531 | 3300036535 | Bacteria | 687 |
| 410 | Ga0373925_0016615 | 3300037068 | Bacteria | 5332 |
| 411 | Ga0373925_0095779 | 3300037068 | Bacteria | 2274 |
| 412 | Ga0373925_0096148 | 3300037068 | Bacteria | 2270 |
| 413 | Ga0395899_0177124 | 3300037312 | Bacteria | 1499 |
| 414 | Ga0395900_0734024 | 3300037418 | Bacteria | 919 |
| 415 | Ga0395898_0012209 | 3300037466 | Bacteria | 8885 |
| 416 | Ga0395905_0000084 | 3300037471 | Bacteria | 158046 |
| 417 | Ga0395905_0416315 | 3300037471 | Bacteria | 1240 |
| 418 | Ga0436364_0156715 | 3300037853 | Bacteria | 2706 |
| 419 | Ga0436364_1142589 | 3300037853 | Bacteria | 645 |
| 420 | Ga0395901_0001925 | 3300038443 | Bacteria | 21375 |
| 421 | Ga0400483_040814 | 3300039062 | Bacteria | 1182 |
| 422 | Ga0436365_0348356 | 3300039437 | Bacteria | 1215 |
| 423 | Ga0436360_0492388 | 3300039438 | Bacteria | 890 |
| 424 | Ga0436360_0819959 | 3300039438 | Bacteria | 860 |
| 425 | Ga0436361_0086433 | 3300039447 | Bacteria | 825 |
| 426 | Ga0436361_0472363 | 3300039447 | Bacteria | 1001 |
| 427 | Ga0436363_0172872 | 3300039450 | Bacteria | 603 |
| 428 | Ga0436363_0554297 | 3300039450 | Bacteria | 1181 |
| 429 | Ga0436363_0960112 | 3300039450 | Bacteria | 612 |
| 430 | Ga0436363_1459501 | 3300039450 | Bacteria | 739 |
| 431 | Ga0436362_1093814 | 3300039453 | Bacteria | 709 |
| 432 | Ga0436362_1216827 | 3300039453 | Bacteria | 522 |
| 433 | Ga0451802_0089247 | 3300041460 | Bacteria | 562 |
| 434 | Ga0451805_064365 | 3300041461 | Bacteria | 1016 |
| 435 | Ga0451841_0097283 | 3300041498 | Bacteria | 704 |
| 436 | Ga0451851_0274901 | 3300041507 | Bacteria | 545 |
| 437 | Ga0439448_0019235 | 3300042005 | Bacteria | 2100 |
| 438 | Ga0451577_0000033 | 3300042876 | Bacteria | 378714 |
| 439 | Ga0451577_0006345 | 3300042876 | Bacteria | 11810 |
| 440 | Ga0451577_0011735 | 3300042876 | Bacteria | 8270 |
| 441 | Ga0451577_0021568 | 3300042876 | Bacteria | 5892 |
| 442 | Ga0451577_0022979 | 3300042876 | Bacteria | 5691 |
| 443 | Ga0451577_0101691 | 3300042876 | Bacteria | 2568 |
| 444 | Ga0451577_1026423 | 3300042876 | Unclassified | 740 |
| 445 | Ga0451577_1335591 | 3300042876 | Bacteria | 637 |
| 446 | Ga0466972_0434709 | 3300044658 | Bacteria | 616 |
| 447 | Ga0453683_0009861 | 3300044673 | Bacteria | 6363 |
| 448 | Ga0453683_0022862 | 3300044673 | Bacteria | 3986 |
| 449 | Ga0453683_0342980 | 3300044673 | Bacteria | 959 |
| 450 | Ga0453683_0451383 | 3300044673 | Bacteria | 831 |
| 451 | Ga0466963_0560019 | 3300044694 | Bacteria | 807 |
| 452 | Ga0466963_1063492 | 3300044694 | Bacteria | 569 |
| 453 | Ga0453684_0000109 | 3300044712 | Bacteria | 361015 |
| 454 | Ga0453684_0007468 | 3300044712 | Bacteria | 20074 |
| 455 | Ga0453684_0021766 | 3300044712 | Bacteria | 9554 |
| 456 | Ga0453684_0030174 | 3300044712 | Bacteria | 7667 |
| 457 | Ga0453684_0045078 | 3300044712 | Bacteria | 5887 |
| 458 | Ga0453684_0057007 | 3300044712 | Bacteria | 5063 |
| 459 | Ga0453684_0086711 | 3300044712 | Bacteria | 3883 |
| 460 | Ga0453684_0114376 | 3300044712 | Bacteria | 3271 |
| 461 | Ga0453684_0175765 | 3300044712 | Bacteria | 2518 |
| 462 | Ga0453684_0178772 | 3300044712 | Bacteria | 2493 |
| 463 | Ga0453684_0321389 | 3300044712 | Bacteria | 1753 |
| 464 | Ga0453684_0600656 | 3300044712 | Bacteria | 1206 |
| 465 | Ga0453684_0991941 | 3300044712 | Bacteria | 894 |
| 466 | Ga0453684_1228363 | 3300044712 | Bacteria | 785 |
| 467 | Ga0453684_2036605 | 3300044712 | Bacteria | 577 |
| 468 | Ga0453684_2053855 | 3300044712 | Unclassified | 574 |
| 469 | Ga0451576_0005411 | 3300045051 | Bacteria | 16028 |
| 470 | Ga0451576_0042025 | 3300045051 | Bacteria | 4827 |
| 471 | Ga0451576_0116782 | 3300045051 | Bacteria | 2777 |
| 472 | Ga0451576_0507389 | 3300045051 | Bacteria | 1267 |
| 473 | Ga0466967_0859254 | 3300045976 | Bacteria | 902 |
| 474 | Ga0495592_0004065 | 3300046454 | Bacteria | 10637 |
| 475 | Ga0495592_0191353 | 3300046454 | Bacteria | 1386 |
| 476 | Ga0495603_0130614 | 3300046455 | Bacteria | 1463 |
| 477 | Ga0495603_0402195 | 3300046455 | Bacteria | 785 |
| 478 | Ga0495629_0027091 | 3300046459 | Bacteria | 4071 |
| 479 | Ga0495629_0105735 | 3300046459 | Bacteria | 1963 |
| 480 | Ga0495651_0001400 | 3300046462 | Bacteria | 18698 |
| 481 | Ga0495651_0095409 | 3300046462 | Bacteria | 2224 |
| 482 | Ga0495653_0000370 | 3300046463 | Bacteria | 36284 |
| 483 | Ga0495650_0030570 | 3300046471 | Bacteria | 2437 |
| 484 | Ga0495582_0084464 | 3300046473 | Bacteria | 1765 |
| 485 | Ga0495639_0013602 | 3300046475 | Bacteria | 3518 |
| 486 | Ga0495662_0130214 | 3300046476 | Bacteria | 1237 |
| 487 | Ga0495662_0285430 | 3300046476 | Bacteria | 812 |
| 488 | Ga0495664_0154882 | 3300046477 | Bacteria | 1390 |
| 489 | Ga0495664_0177335 | 3300046477 | Bacteria | 1292 |
| 490 | Ga0495583_0000510 | 3300046506 | Bacteria | 55787 |
| 491 | Ga0495606_0057236 | 3300046507 | Bacteria | 2511 |
| 492 | Ga0495608_0077646 | 3300046511 | Bacteria | 2161 |
| 493 | Ga0495608_0476609 | 3300046511 | Bacteria | 757 |
| 494 | Ga0495618_0015533 | 3300046514 | Bacteria | 4647 |
| 495 | Ga0495628_0014171 | 3300046516 | Bacteria | 6691 |
| 496 | Ga0495628_0028002 | 3300046516 | Bacteria | 4582 |
| 497 | Ga0495628_0547848 | 3300046516 | Bacteria | 831 |
| 498 | Ga0495666_0087692 | 3300046526 | Bacteria | 1470 |
| 499 | Ga0495666_0288961 | 3300046526 | Bacteria | 743 |
| 500 | Ga0495652_0004294 | 3300046529 | Bacteria | 13663 |
| 501 | Ga0495652_0058795 | 3300046529 | Bacteria | 3254 |
| 502 | Ga0495652_0121026 | 3300046529 | Bacteria | 2088 |
| 503 | Ga0495665_0098170 | 3300046531 | Bacteria | 1538 |
| 504 | Ga0495640_0000769 | 3300046533 | Bacteria | 24154 |
| 505 | Ga0495640_0286422 | 3300046533 | Bacteria | 1025 |
| 506 | Ga0495586_0432835 | 3300046535 | Bacteria | 758 |
| 507 | Ga0495586_0566406 | 3300046535 | Bacteria | 656 |
| 508 | Ga0495587_0001283 | 3300046536 | Bacteria | 16691 |
| 509 | Ga0495587_0076302 | 3300046536 | Bacteria | 1946 |
| 510 | Ga0495587_0667780 | 3300046536 | Bacteria | 571 |
| 511 | Ga0495645_0121611 | 3300046543 | Bacteria | 1837 |
| 512 | Ga0495645_0462489 | 3300046543 | Bacteria | 798 |
| 513 | Ga0495622_0142980 | 3300046557 | Bacteria | 1086 |
| 514 | Ga0495667_0001440 | 3300046559 | Bacteria | 15673 |
| 515 | Ga0495667_0077165 | 3300046559 | Bacteria | 2167 |
| 516 | Ga0495668_0076671 | 3300046616 | Bacteria | 1835 |
| 517 | Ga0495625_0071349 | 3300046660 | Bacteria | 2437 |
| 518 | Ga0495635_0030116 | 3300046663 | Bacteria | 3772 |
| 519 | Ga0495635_0206185 | 3300046663 | Bacteria | 1332 |
| 520 | Ga0495635_0680112 | 3300046663 | Bacteria | 668 |
| 521 | Ga0495657_0069542 | 3300046675 | Bacteria | 2303 |
| 522 | Ga0495657_0073076 | 3300046675 | Bacteria | 2235 |
| 523 | Ga0495599_0071441 | 3300046678 | Bacteria | 2166 |
| 524 | Ga0495599_0118080 | 3300046678 | Bacteria | 1649 |
| 525 | Ga0495623_0013044 | 3300046679 | Bacteria | 5382 |
| 526 | Ga0495623_0056886 | 3300046679 | Bacteria | 2461 |
| 527 | Ga0495623_0165314 | 3300046679 | Bacteria | 1297 |
| 528 | Ga0495646_0010752 | 3300046680 | Bacteria | 5814 |
| 529 | Ga0495646_0076284 | 3300046680 | Bacteria | 1963 |
| 530 | Ga0495646_0199053 | 3300046680 | Bacteria | 1092 |
| 531 | Ga0495647_0182064 | 3300046681 | Bacteria | 914 |
| 532 | Ga0495658_0164017 | 3300046683 | Bacteria | 1372 |
| 533 | Ga0495669_0068959 | 3300046684 | Bacteria | 1609 |
| 534 | Ga0495613_0053483 | 3300046689 | Bacteria | 2971 |
| 535 | Ga0495613_0242482 | 3300046689 | Bacteria | 1260 |
| 536 | Ga0495624_0056635 | 3300046690 | Bacteria | 2466 |
| 537 | Ga0495671_0070435 | 3300046692 | Bacteria | 1718 |
| 538 | Ga0495649_0000961 | 3300046694 | Bacteria | 22764 |
| 539 | Ga0495589_0004694 | 3300046794 | Bacteria | 7256 |
| 540 | Ga0495600_0000422 | 3300046809 | Bacteria | 21824 |
| 541 | Ga0495600_0073413 | 3300046809 | Bacteria | 2234 |
| 542 | Ga0495604_0000406 | 3300047317 | Bacteria | 38847 |
| 543 | Ga0495604_0200999 | 3300047317 | Bacteria | 1382 |
| 544 | Ga0495674_0023413 | 3300047319 | Bacteria | 5692 |
| 545 | Ga0495674_0382073 | 3300047319 | Bacteria | 1139 |
| 546 | Ga0495676_0071144 | 3300047321 | Bacteria | 2675 |
| 547 | Ga0495680_0001477 | 3300047322 | Bacteria | 25369 |
| 548 | Ga0495680_0751124 | 3300047322 | Bacteria | 640 |
| 549 | Ga0495683_0084411 | 3300047323 | Bacteria | 1545 |
| 550 | Ga0495675_0036422 | 3300047444 | Bacteria | 3138 |
| 551 | Ga0495675_0038770 | 3300047444 | Bacteria | 3034 |
| 552 | Ga0495684_0002545 | 3300047471 | Bacteria | 14510 |
| 553 | Ga0495684_0332917 | 3300047471 | Bacteria | 1082 |
| 554 | Ga0495686_0024589 | 3300047472 | Bacteria | 3955 |
| 555 | Ga0495593_0035738 | 3300047673 | Bacteria | 2696 |
| 556 | Ga0495602_0010292 | 3300048088 | Bacteria | 9709 |
| 557 | Ga0495602_0193078 | 3300048088 | Bacteria | 1559 |
| 558 | Ga0495602_0947697 | 3300048088 | Bacteria | 570 |
| 559 | Ga0496100_1463114 | 3300048903 | Bacteria | 539 |
| 560 | Ga0496101_0013828 | 3300048904 | Bacteria | 5418 |
| 561 | Ga0496101_0620526 | 3300048904 | Bacteria | 855 |
| 562 | Ga0496102_0099626 | 3300048905 | Bacteria | 2698 |
| 563 | Ga0496104_0056453 | 3300048907 | Bacteria | 3713 |
| 564 | Ga0496104_0207951 | 3300048907 | Bacteria | 1869 |
| 565 | Ga0496105_0091241 | 3300048908 | Bacteria | 2516 |
| 566 | Ga0496105_0454067 | 3300048908 | Bacteria | 1011 |
| 567 | Ga0496105_1138649 | 3300048908 | Bacteria | 577 |
| 568 | Ga0496106_0013846 | 3300048909 | Bacteria | 5960 |
| 569 | Ga0496106_0380462 | 3300048909 | Bacteria | 1134 |
| 570 | Ga0496106_0407526 | 3300048909 | Bacteria | 1093 |
| 571 | Ga0496107_0355208 | 3300048910 | Bacteria | 1090 |
| 572 | Ga0496107_0935655 | 3300048910 | Bacteria | 631 |
| 573 | Ga0496108_0310980 | 3300048911 | Bacteria | 1373 |
| 574 | Ga0496108_0495908 | 3300048911 | Bacteria | 1067 |
| 575 | Ga0496108_0537383 | 3300048911 | Bacteria | 1020 |
| 576 | Ga0496108_1570015 | 3300048911 | Bacteria | 545 |
| 577 | Ga0496109_0334595 | 3300048912 | Bacteria | 1430 |
| 578 | Ga0496109_0709928 | 3300048912 | Bacteria | 943 |
| 579 | Ga0496109_0789501 | 3300048912 | Bacteria | 888 |
| 580 | Ga0496109_0946357 | 3300048912 | Bacteria | 799 |
| 581 | Ga0496109_1767454 | 3300048912 | Bacteria | 552 |
| 582 | Ga0496110_0275586 | 3300048913 | Bacteria | 1532 |
| 583 | Ga0496110_1484199 | 3300048913 | Bacteria | 588 |
| 584 | Ga0496112_0880532 | 3300048915 | Bacteria | 818 |
| 585 | Ga0496113_1515888 | 3300048916 | Bacteria | 517 |
| 586 | Ga0496114_0043566 | 3300048917 | Bacteria | 3721 |
| 587 | Ga0496114_0831067 | 3300048917 | Bacteria | 803 |
| 588 | Ga0496115_0073725 | 3300048918 | Bacteria | 2771 |
| 589 | Ga0496115_0214760 | 3300048918 | Bacteria | 1588 |
| 590 | Ga0496119_0007636 | 3300048922 | Bacteria | 9698 |
| 591 | Ga0496126_0153375 | 3300048929 | Bacteria | 1973 |
| 592 | Ga0496126_0402361 | 3300048929 | Bacteria | 1110 |
| 593 | Ga0501306_074159 | 3300049127 | Bacteria | 578 |
| 594 | Ga0501312_124053 | 3300049528 | Bacteria | 502 |
| 595 | Ga0501034_0011194 | 3300049571 | Bacteria | 9312 |
| 596 | Ga0501034_0062111 | 3300049571 | Bacteria | 3751 |
| 597 | Ga0501034_0213455 | 3300049571 | Bacteria | 1884 |
| 598 | Ga0501034_0929856 | 3300049571 | Bacteria | 756 |
| 599 | Ga0501067_0012140 | 3300049583 | Bacteria | 4776 |
| 600 | Ga0501067_0040594 | 3300049583 | Bacteria | 2584 |
| 601 | Ga0501068_0011298 | 3300049584 | Bacteria | 5038 |
| 602 | Ga0501068_0124575 | 3300049584 | Bacteria | 1608 |
| 603 | Ga0501069_0120381 | 3300049585 | Bacteria | 1499 |
| 604 | Ga0501071_0750483 | 3300049587 | Bacteria | 752 |
| 605 | Ga0501072_1008839 | 3300049588 | Bacteria | 649 |
| 606 | Ga0501073_0094048 | 3300049589 | Bacteria | 2082 |
| 607 | Ga0501073_0109680 | 3300049589 | Bacteria | 1914 |
| 608 | Ga0501073_0690583 | 3300049589 | Bacteria | 704 |
| 609 | Ga0501074_0092370 | 3300049590 | Bacteria | 2167 |
| 610 | Ga0501079_0982197 | 3300049741 | Bacteria | 665 |
| 611 | Ga0501080_0068177 | 3300049742 | Bacteria | 3309 |
| 612 | Ga0501080_0970474 | 3300049742 | Bacteria | 738 |
| 613 | Ga0501081_0048650 | 3300049743 | Bacteria | 2918 |
| 614 | Ga0501083_0086310 | 3300049744 | Bacteria | 2075 |
| 615 | Ga0501035_0318618 | 3300049822 | Bacteria | 1307 |
| 616 | Ga0501044_0242091 | 3300049823 | Bacteria | 1747 |
| 617 | Ga0501044_0275193 | 3300049823 | Bacteria | 1618 |
| 618 | Ga0501044_0653553 | 3300049823 | Bacteria | 940 |
| 619 | nmdc:mga03683_154212_c1 | 3300050489 | Bacteria | 1038 |
| 620 | nmdc:mga00v17_550791_c1 | 3300050491 | Bacteria | 746 |
| 621 | nmdc:mga0k408_17468_c1 | 3300050493 | Bacteria | 3997 |
| 622 | nmdc:mga0k408_18793_c1 | 3300050493 | Bacteria | 3859 |
| 623 | nmdc:mga0k408_3994_c1 | 3300050493 | Bacteria | 7820 |
| 624 | nmdc:mga07m45_2618_c1 | 3300050496 | Bacteria | 8478 |
| 625 | nmdc:mga05p37_1557282_c1 | 3300050507 | Bacteria | 654 |
| 626 | nmdc:mga09592_418985_c1 | 3300050508 | Bacteria | 1157 |
| 627 | nmdc:mga0qj67_773324_c1 | 3300050509 | Bacteria | 761 |
| 628 | nmdc:mga08y16_112266_c1 | 3300050511 | Bacteria | 2837 |
| 629 | nmdc:mga08y16_918900_c1 | 3300050511 | Bacteria | 860 |
| 630 | nmdc:mga0n895_324307_c1 | 3300050512 | Bacteria | 1561 |
| 631 | nmdc:mga0rr50_119161_c1 | 3300050513 | Bacteria | 2098 |
| 632 | nmdc:mga08x19_81325_c1 | 3300050514 | Bacteria | 2127 |
| 633 | nmdc:mga0a205_1230022_c1 | 3300050515 | Bacteria | 597 |
| 634 | nmdc:mga0sz30_58732_c1 | 3300050516 | Bacteria | 1640 |
| 635 | Ga0495601_0013011 | 3300053077 | Bacteria | 4998 |
| 636 | Ga0495601_0288764 | 3300053077 | Bacteria | 1069 |
| 637 | Ga0495601_0779406 | 3300053077 | Bacteria | 607 |
| 638 | Ga0495612_0001890 | 3300053078 | Bacteria | 8615 |
| 639 | Ga0495612_0182693 | 3300053078 | Bacteria | 922 |
| 640 | Ga0500635_0000036 | 3300053080 | Bacteria | 94740 |
| 641 | Ga0495595_0000821 | 3300053084 | Bacteria | 11875 |
| 642 | Ga0495595_0019353 | 3300053084 | Bacteria | 2953 |
| 643 | Ga0495619_0000352 | 3300053085 | Bacteria | 32130 |
| 644 | Ga0495619_0444844 | 3300053085 | Bacteria | 893 |
| 645 | Ga0495619_1028864 | 3300053085 | Bacteria | 550 |
| 646 | Ga0500651_0272510 | 3300053093 | Bacteria | 978 |
| 647 | Ga0500641_0033682 | 3300053096 | Bacteria | 2035 |
| 648 | Ga0500594_0012196 | 3300053118 | Bacteria | 2021 |
| 649 | Ga0500607_134777 | 3300053121 | Bacteria | 1172 |
| 650 | Ga0500608_273900 | 3300053122 | Bacteria | 643 |
| 651 | Ga0500559_0110294 | 3300053136 | Bacteria | 1274 |
| 652 | Ga0500589_148106 | 3300053147 | Bacteria | 959 |
| 653 | Ga0500604_0327222 | 3300053151 | Bacteria | 532 |
| 654 | Ga0500630_193628 | 3300053159 | Bacteria | 801 |
| 655 | Ga0500638_161624 | 3300053162 | Bacteria | 985 |
| 656 | Ga0500639_339252 | 3300053163 | Bacteria | 539 |
| 657 | Ga0500636_0105188 | 3300053177 | Bacteria | 1600 |
| 658 | Ga0500636_0230069 | 3300053177 | Bacteria | 960 |
| 659 | Ga0587084_005438 | 3300059477 | Bacteria | 1508 |
| 660 | Ga0587084_139095 | 3300059477 | Bacteria | 525 |
| 661 | Ga0587093_010602 | 3300059478 | Bacteria | 1090 |
| 662 | Ga0587066_006963 | 3300059490 | Bacteria | 1514 |
| 663 | Ga0587066_060549 | 3300059490 | Bacteria | 771 |
| 664 | Ga0587070_003113 | 3300059491 | Bacteria | 1958 |
| 665 | Ga0587070_198311 | 3300059491 | Bacteria | 532 |
| 666 | Ga0587073_0001947 | 3300059492 | Bacteria | 2553 |
| 667 | Ga0587073_0101802 | 3300059492 | Bacteria | 748 |
| 668 | Ga0587073_0250411 | 3300059492 | Bacteria | 555 |
| 669 | Ga0587077_124834 | 3300059493 | Bacteria | 646 |
| 670 | Ga0587080_004286 | 3300059503 | Bacteria | 1841 |
| 671 | Ga0587080_159338 | 3300059503 | Bacteria | 528 |
| 672 | Ga0587082_032816 | 3300059504 | Bacteria | 914 |
| 673 | Ga0587082_129963 | 3300059504 | Bacteria | 578 |
| 674 | Ga0587083_0000179 | 3300059505 | Bacteria | 4486 |
| 675 | Ga0587083_0073253 | 3300059505 | Bacteria | 800 |
| 676 | Ga0587083_0240818 | 3300059505 | Bacteria | 535 |
| 677 | Ga0587085_034481 | 3300059506 | Bacteria | 850 |
| 678 | Ga0587086_055568 | 3300059507 | Bacteria | 648 |
| 679 | Ga0587088_043631 | 3300059508 | Bacteria | 854 |
| 680 | Ga0587088_079546 | 3300059508 | Bacteria | 699 |
| 681 | Ga0587088_096516 | 3300059508 | Bacteria | 655 |
| 682 | Ga0587089_012402 | 3300059509 | Bacteria | 1088 |
| 683 | Ga0587089_070146 | 3300059509 | Bacteria | 594 |
| 684 | Ga0587090_020013 | 3300059510 | Bacteria | 1038 |
| 685 | Ga0587090_115900 | 3300059510 | Bacteria | 576 |
| 686 | Ga0587090_168558 | 3300059510 | Bacteria | 506 |
| 687 | Ga0587092_009469 | 3300059512 | Bacteria | 1311 |
| 688 | Ga0587094_012127 | 3300059513 | Bacteria | 1146 |
| 689 | Ga0587098_024966 | 3300059604 | Bacteria | 787 |
| 690 | Ga0587106_055892 | 3300059605 | Bacteria | 712 |
| 691 | Ga0587125_020912 | 3300059607 | Bacteria | 772 |
| 692 | Ga0587099_014844 | 3300059622 | Bacteria | 826 |
| 693 | Ga0587109_009123 | 3300059624 | Bacteria | 1550 |
| 694 | Ga0587109_015181 | 3300059624 | Bacteria | 1303 |
| 695 | Ga0587113_018370 | 3300059625 | Bacteria | 716 |
| 696 | Ga0587128_000534 | 3300059630 | Bacteria | 2891 |
| 697 | Ga0587062_025654 | 3300059639 | Bacteria | 869 |
| 698 | Ga0587067_000404 | 3300059640 | Bacteria | 3694 |
| 699 | Ga0587068_023032 | 3300059641 | Bacteria | 1035 |
| 700 | Ga0587068_129323 | 3300059641 | Bacteria | 555 |
| 701 | Ga0587072_001614 | 3300059643 | Bacteria | 2844 |
| 702 | Ga0587076_009651 | 3300059645 | Bacteria | 1375 |
| 703 | Ga0587078_003507 | 3300059646 | Bacteria | 1595 |
| 704 | Ga0587100_005857 | 3300059648 | Bacteria | 929 |
| 705 | Ga0587102_010689 | 3300059649 | Bacteria | 911 |
| 706 | Ga0587104_004395 | 3300059650 | Bacteria | 901 |
| 707 | Ga0587105_001974 | 3300059651 | Bacteria | 1127 |
| 708 | Ga0587107_000941 | 3300059652 | Bacteria | 2179 |
| 709 | Ga0587107_007297 | 3300059652 | Bacteria | 1240 |
| 710 | Ga0587116_12521 | 3300059656 | Bacteria | 588 |
| 711 | Ga0587118_01471 | 3300059657 | Bacteria | 1427 |
| 712 | Ga0587124_019230 | 3300059660 | Bacteria | 686 |
| 713 | Ga0587071_004987 | 3300060344 | Bacteria | 2008 |
| 714 | Ga0587071_070077 | 3300060344 | Bacteria | 762 |
| 715 | 2523107254 | 2522572158 | Bacteria | 6514390 |
| 716 | 2643746677 | 2643221544 | Bacteria | 5886209 |
| 717 | 2644131946 | 2643221623 | Bacteria | 5239945 |
| 718 | 2644256830 | 2643221646 | Bacteria | 6433402 |
| 719 | 2723879664 | 2721755763 | Bacteria | 4464185 |
| 720 | 2739309064 | 2738543024 | Bacteria | 5603683 |
| 721 | 2837679884 | 2837678835 | Bacteria | 5252418 |
| 722 | 2889793650 | 2889790730 | Bacteria | 5689708 |
| 723 | 2889919552 | 2889914905 | Bacteria | 5702301 |
| 724 | 2891050840 | 2891048133 | Bacteria | 4447501 |
| 725 | 2891092405 | 2891088606 | Bacteria | 4762464 |
| 726 | 2909400002 | 2909399089 | Bacteria | 3922598 |
| 727 | 8002061420 | 8002060224 | Bacteria | 4026565 |
| 728 | Ga0182008_10123030 | |||
| 729 | JGI24735J21928_10180060 | |||
| 730 | JGI25156J39149_1048087 | |||
| 731 | JGI25154J39366_1000593 | |||
| 732 | JGI25157J39369_1001134 | |||
| 733 | Ga0007410J51695_1090156 | |||
| 734 | Ga0007416J51690_1044706 | |||
| 735 | Ga0055539_1002928 | |||
| 736 | Ga0055533_1000043 | |||
| 737 | Ga0055525_1000641 | |||
| 738 | Ga0055535_1000420 | |||
| 739 | Ga0055529_1000322 | |||
| 740 | JGI25405J52794_10006418 | |||
| 741 | Ga0058859_11395877 | |||
| 742 | Ga0058859_11499848 | |||
| 743 | Ga0058861_11919994 | |||
| 744 | Ga0058860_12155775 | |||
| 745 | Ga0070658_10660472 | |||
| 746 | Ga0070683_102333734 | |||
| 747 | Ga0070690_100111170 | |||
| 748 | Ga0070670_100171189 | |||
| 749 | Ga0068869_100100346 | |||
| 750 | Ga0068869_101805685 | |||
| 751 | Ga0070666_10086429 | |||
| 752 | Ga0070680_101578527 | |||
| 753 | Ga0068868_100616452 | |||
| 754 | Ga0070689_100198876 | |||
| 755 | Ga0070691_10257636 | |||
| 756 | Ga0070687_100028209 | |||
| 757 | Ga0070687_101046781 | |||
| 758 | Ga0070661_100211043 | |||
| 759 | Ga0070675_100605768 | |||
| 760 | Ga0070671_100003486 | |||
| 761 | Ga0070673_100110053 | |||
| 762 | Ga0070688_100330669 | |||
| 763 | Ga0070659_100203963 | |||
| 764 | Ga0070659_100721941 | |||
| 765 | Ga0070709_10015699 | |||
| 766 | Ga0070709_10572376 | |||
| 767 | Ga0070714_100024965 | |||
| 768 | Ga0070713_100011844 | |||
| 769 | Ga0070710_10003492 | |||
| 770 | Ga0070710_10078215 | |||
| 771 | Ga0070711_100028081 | |||
| 772 | Ga0070711_100302792 | |||
| 773 | Ga0070694_100052832 | |||
| 774 | Ga0070663_100757558 | |||
| 775 | Ga0070662_100102710 | |||
| 776 | Ga0070662_101647757 | |||
| 777 | Ga0068867_100484225 | |||
| 778 | Ga0070685_10615579 | |||
| 779 | Ga0070679_100269034 | |||
| 780 | Ga0070684_100516613 | |||
| 781 | Ga0070684_100721945 | |||
| 782 | Ga0070684_101169908 | |||
| 783 | Ga0068853_100293022 | |||
| 784 | Ga0070672_100558846 | |||
| 785 | Ga0070672_101453073 | |||
| 786 | Ga0070686_100447851 | |||
| 787 | Ga0070686_101297527 | |||
| 788 | Ga0070695_100021458 | |||
| 789 | Ga0070696_100582636 | |||
| 790 | Ga0070696_101733063 | |||
| 791 | Ga0070693_100589413 | |||
| 792 | Ga0068855_100534661 | |||
| 793 | Ga0070664_100235185 | |||
| 794 | Ga0068854_100023136 | |||
| 795 | Ga0068856_100149077 | |||
| 796 | Ga0068856_100256499 | |||
| 797 | Ga0070702_100277676 | |||
| 798 | Ga0068864_100714314 | |||
| 799 | Ga0068864_100991110 | |||
| 800 | Ga0068861_100152994 | |||
| 801 | Ga0068851_10162545 | |||
| 802 | Ga0068863_100662454 | |||
| 803 | Ga0068858_100848223 | |||
| 804 | Ga0068860_100217691 | |||
| 805 | Ga0068860_100671474 | |||
| 806 | Ga0081538_10120554 | |||
| 807 | Ga0081540_1003020 | |||
| 808 | Ga0081539_10046287 | |||
| 809 | Ga0070717_10166904 | |||
| 810 | Ga0075363_100028810 | |||
| 811 | Ga0075364_10020585 | |||
| 812 | Ga0075364_10324752 | |||
| 813 | Ga0070715_10014729 | |||
| 814 | Ga0070715_10304664 | |||
| 815 | Ga0070716_100038933 | |||
| 816 | Ga0070716_101106925 | |||
| 817 | Ga0070712_100004635 | |||
| 818 | Ga0070712_100013564 | |||
| 819 | Ga0070712_100197997 | |||
| 820 | Ga0075367_10660157 | |||
| 821 | Ga0075366_10000795 | |||
| 822 | Ga0075366_10018750 | |||
| 823 | Ga0075366_10211595 | |||
| 824 | Ga0097621_100289575 | |||
| 825 | Ga0075370_10011014 | |||
| 826 | Ga0068871_100165726 | |||
| 827 | Ga0075428_100601252 | |||
| 828 | Ga0075429_100137036 | |||
| 829 | Ga0068865_102092155 | |||
| 830 | Ga0075436_100109455 | |||
| 831 | Ga0105250_10257088 | |||
| 832 | Ga0105240_11571470 | |||
| 833 | Ga0105240_11739249 | |||
| 834 | Ga0111539_10077885 | |||
| 835 | Ga0111539_10340819 | |||
| 836 | Ga0105245_10580509 | |||
| 837 | Ga0114129_10722753 | |||
| 838 | Ga0105243_10249883 | |||
| 839 | Ga0105241_10079232 | |||
| 840 | Ga0105241_10288877 | |||
| 841 | Ga0105242_11364451 | |||
| 842 | Ga0105248_11347305 | |||
| 843 | Ga0105248_11835400 | |||
| 844 | Ga0105237_10051839 | |||
| 845 | Ga0105237_10211706 | |||
| 846 | Ga0105237_10390119 | |||
| 847 | Ga0105237_10895092 | |||
| 848 | Ga0105237_12247333 | |||
| 849 | Ga0105238_10205025 | |||
| 850 | Ga0105238_10237854 | |||
| 851 | Ga0105238_10957271 | |||
| 852 | Ga0105249_10323671 | |||
| 853 | Ga0105249_10648792 | |||
| 854 | Ga0105249_12672687 | |||
| 855 | Ga0105239_10623881 | |||
| 856 | Ga0105239_11647301 | |||
| 857 | Ga0105239_11768370 | |||
| 858 | Ga0105239_12212956 | |||
| 859 | Ga0105246_11610726 | |||
| 860 | Ga0157369_10034850 | |||
| 861 | Ga0157369_10388715 | |||
| 862 | Ga0157369_10885588 | |||
| 863 | Ga0157374_10036137 | |||
| 864 | Ga0157374_11702013 | |||
| 865 | Ga0157378_10129245 | |||
| 866 | Ga0157378_12931055 | |||
| 867 | Ga0163162_10411533 | |||
| 868 | Ga0163162_11598988 | |||
| 869 | Ga0157372_10189020 | |||
| 870 | Ga0157372_10950203 | |||
| 871 | Ga0157372_11272619 | |||
| 872 | Ga0163163_10477985 | |||
| 873 | Ga0182008_10155033 | |||
| 874 | Ga0182008_10202882 | |||
| 875 | Ga0182008_10445012 | |||
| 876 | Ga0157379_10056467 | |||
| 877 | Ga0157379_10241188 | |||
| 878 | Ga0157376_10622730 | |||
| 879 | Ga0182006_1173195 | |||
| 880 | Ga0184602_128378 | |||
| 881 | Ga0184603_115845 | |||
| 882 | Ga0197907_11204008 | |||
| 883 | Ga0206356_10333002 | |||
| 884 | Ga0206356_10880351 | |||
| 885 | Ga0206356_10973081 | |||
| 886 | Ga0206349_1471409 | |||
| 887 | Ga0206355_1182367 | |||
| 888 | Ga0206355_1569053 | |||
| 889 | Ga0206351_10919874 | |||
| 890 | Ga0206352_10996423 | |||
| 891 | Ga0206350_10273521 | |||
| 892 | Ga0206354_10721124 | |||
| 893 | Ga0206354_11216635 | |||
| 894 | Ga0206353_11465831 | |||
| 895 | Ga0154015_1148978 | |||
| 896 | Ga0154015_1457285 | |||
| 897 | Ga0213872_10135020 | |||
| 898 | Ga0213872_10302772 | |||
| 899 | Ga0213874_10160717 | |||
| 900 | Ga0213874_10196931 | |||
| 901 | Ga0213874_10248759 | |||
| 902 | Ga0213876_10420360 | |||
| 903 | Ga0213875_10455529 | |||
| 904 | Ga0224712_10020260 | |||
| 905 | Ga0224712_10453857 | |||
| 906 | Ga0224712_10485922 | |||
| 907 | Ga0247552_101829 | |||
| 908 | Ga0228598_1000416 | |||
| 909 | Ga0209674_100067 | |||
| 910 | Ga0209672_106433 | |||
| 911 | Ga0209563_100068 | |||
| 912 | Ga0207427_100260 | |||
| 913 | Ga0209258_100342 | |||
| 914 | Ga0209258_100554 | |||
| 915 | Ga0209646_1000127 | |||
| 916 | Ga0209026_1000004 | |||
| 917 | Ga0209677_100201 | |||
| 918 | Ga0209148_1005675 | |||
| 919 | Ga0209759_1000129 | |||
| 920 | Ga0209759_1027374 | |||
| 921 | Ga0209455_1000083 | |||
| 922 | Ga0209676_1000092 | |||
| 923 | Ga0209050_1007590 | |||
| 924 | Ga0207692_10020862 | |||
| 925 | Ga0207647_10143184 | |||
| 926 | Ga0207685_10014999 | |||
| 927 | Ga0207685_10330104 | |||
| 928 | Ga0207685_10372724 | |||
| 929 | Ga0207685_10390681 | |||
| 930 | Ga0207699_10005995 | |||
| 931 | Ga0207699_10440398 | |||
| 932 | Ga0207699_11094209 | |||
| 933 | Ga0207645_10289237 | |||
| 934 | Ga0207705_10381815 | |||
| 935 | Ga0207654_10132215 | |||
| 936 | Ga0207707_10408317 | |||
| 937 | Ga0207695_10105714 | |||
| 938 | Ga0207695_10712542 | |||
| 939 | Ga0207671_10051341 | |||
| 940 | Ga0207671_10338814 | |||
| 941 | Ga0207693_10018098 | |||
| 942 | Ga0207693_10021188 | |||
| 943 | Ga0207693_10027985 | |||
| 944 | Ga0207693_10251745 | |||
| 945 | Ga0207693_10394248 | |||
| 946 | Ga0207663_10114880 | |||
| 947 | Ga0207663_10206117 | |||
| 948 | Ga0207663_10712037 | |||
| 949 | Ga0207660_11275158 | |||
| 950 | Ga0207662_10031400 | |||
| 951 | Ga0207662_11309525 | |||
| 952 | Ga0207657_11494476 | |||
| 953 | Ga0207649_10312084 | |||
| 954 | Ga0207652_10375413 | |||
| 955 | Ga0207681_11431145 | |||
| 956 | Ga0207694_10083671 | |||
| 957 | Ga0207694_10205510 | |||
| 958 | Ga0207694_10830323 | |||
| 959 | Ga0207694_10943332 | |||
| 960 | Ga0207659_10042382 | |||
| 961 | Ga0207659_10825108 | |||
| 962 | Ga0207687_10197952 | |||
| 963 | Ga0207687_10344140 | |||
| 964 | Ga0207700_10239003 | |||
| 965 | Ga0207700_10572137 | |||
| 966 | Ga0207664_10044723 | |||
| 967 | Ga0207664_10298575 | |||
| 968 | Ga0207644_10006009 | |||
| 969 | Ga0207644_11365041 | |||
| 970 | Ga0207690_10059045 | |||
| 971 | Ga0207690_10082583 | |||
| 972 | Ga0207706_10191401 | |||
| 973 | Ga0207706_11658156 | |||
| 974 | Ga0207686_10618594 | |||
| 975 | Ga0207709_10715401 | |||
| 976 | Ga0207670_10079487 | |||
| 977 | Ga0207670_11169556 | |||
| 978 | Ga0207665_10012672 | |||
| 979 | Ga0207665_10305191 | |||
| 980 | Ga0207691_10087732 | |||
| 981 | Ga0207711_10951667 | |||
| 982 | Ga0207711_11101606 | |||
| 983 | Ga0207689_10025393 | |||
| 984 | Ga0207661_10370299 | |||
| 985 | Ga0207679_10040130 | |||
| 986 | Ga0207667_10588076 | |||
| 987 | Ga0207651_10019963 | |||
| 988 | Ga0207640_10023477 | |||
| 989 | Ga0207677_11237641 | |||
| 990 | Ga0207639_10449647 | |||
| 991 | Ga0207639_10804740 | |||
| 992 | Ga0207678_10143467 | |||
| 993 | Ga0207678_11432391 | |||
| 994 | Ga0207702_10001875 | |||
| 995 | Ga0207702_10237817 | |||
| 996 | Ga0207641_10020044 | |||
| 997 | Ga0207641_11133079 | |||
| 998 | Ga0207676_10876069 | |||
| 999 | Ga0207676_11006898 | |||
| 1000 | Ga0207674_10004293 | |||
| 1001 | Ga0207675_100219937 | |||
| 1002 | Ga0207698_10064301 | |||
| 1003 | Ga0210000_1053731 | |||
| 1004 | Ga0207428_10271194 | |||
| 1005 | Ga0268264_10182306 | |||
| 1006 | Ga0268264_10829898 | |||
| 1007 | Ga0265319_1077434 | |||
| 1008 | Ga0265319_1138665 | |||
| 1009 | Ga0265319_1152469 | |||
| 1010 | Ga0265334_10120299 | |||
| 1011 | Ga0265318_10000273 | |||
| 1012 | Ga0265318_10001387 | |||
| 1013 | Ga0265318_10028950 | |||
| 1014 | Ga0265322_10230541 | |||
| 1015 | Ga0265336_10000028 | |||
| 1016 | Ga0307515_10450121 | |||
| 1017 | Ga0265338_10145149 | |||
| 1018 | Ga0307511_10051346 | |||
| 1019 | Ga0265769_101828 | |||
| 1020 | Ga0265760_10080711 | |||
| 1021 | Ga0265330_10000998 | |||
| 1022 | Ga0265330_10059999 | |||
| 1023 | Ga0265330_10279046 | |||
| 1024 | Ga0265330_10286466 | |||
| 1025 | Ga0265332_10000280 | |||
| 1026 | Ga0265332_10002691 | |||
| 1027 | Ga0265332_10214300 | |||
| 1028 | Ga0265328_10010978 | |||
| 1029 | Ga0265328_10016001 | |||
| 1030 | Ga0265328_10032488 | |||
| 1031 | Ga0265328_10032994 | |||
| 1032 | Ga0265328_10127622 | |||
| 1033 | Ga0265320_10000485 | |||
| 1034 | Ga0265320_10054588 | |||
| 1035 | Ga0265320_10141966 | |||
| 1036 | Ga0265320_10406698 | |||
| 1037 | Ga0265325_10001575 | |||
| 1038 | Ga0265325_10061357 | |||
| 1039 | Ga0265325_10410898 | |||
| 1040 | Ga0265329_10000013 | |||
| 1041 | Ga0265329_10028096 | |||
| 1042 | Ga0265329_10054803 | |||
| 1043 | Ga0265340_10000189 | |||
| 1044 | Ga0265340_10002589 | |||
| 1045 | Ga0265340_10004541 | |||
| 1046 | Ga0265340_10016859 | |||
| 1047 | Ga0265340_10019984 | |||
| 1048 | Ga0265340_10219713 | |||
| 1049 | Ga0265340_10310168 | |||
| 1050 | Ga0265339_10008773 | |||
| 1051 | Ga0265339_10017456 | |||
| 1052 | Ga0265339_10092846 | |||
| 1053 | Ga0265339_10229158 | |||
| 1054 | Ga0265339_10242742 | |||
| 1055 | Ga0265331_10002207 | |||
| 1056 | Ga0265331_10012161 | |||
| 1057 | Ga0265331_10059653 | |||
| 1058 | Ga0265327_10001331 | |||
| 1059 | Ga0265316_10001048 | |||
| 1060 | Ga0265316_10002957 | |||
| 1061 | Ga0265316_10063600 | |||
| 1062 | Ga0265316_10082839 | |||
| 1063 | Ga0307509_10186769 | |||
| 1064 | Ga0265313_10000463 | |||
| 1065 | Ga0265313_10001355 | |||
| 1066 | Ga0265313_10163343 | |||
| 1067 | Ga0265313_10349525 | |||
| 1068 | Ga0316575_10318071 | |||
| 1069 | Ga0265314_10002804 | |||
| 1070 | Ga0265314_10026291 | |||
| 1071 | Ga0265314_10046503 | |||
| 1072 | Ga0265342_10000448 | |||
| 1073 | Ga0265342_10000471 | |||
| 1074 | Ga0265342_10414017 | |||
| 1075 | Ga0316576_10013287 | |||
| 1076 | Ga0316576_10015660 | |||
| 1077 | Ga0316576_10239576 | |||
| 1078 | Ga0316576_10544142 | |||
| 1079 | Ga0307516_10005443 | |||
| 1080 | Ga0307516_10647953 | |||
| 1081 | Ga0307407_10499792 | |||
| 1082 | Ga0316053_102602 | |||
| 1083 | Ga0316593_10000059 | |||
| 1084 | Ga0316593_10004223 | |||
| 1085 | Ga0316593_10060312 | |||
| 1086 | Ga0316593_10103206 | |||
| 1087 | Ga0307507_10228329 | |||
| 1088 | Ga0316592_1001046 | |||
| 1089 | Ga0316592_1014236 | |||
| 1090 | Ga0316586_1043276 | |||
| 1091 | Ga0316588_1000022 | |||
| 1092 | Ga0316587_1069510 | |||
| 1093 | Ga0316596_1031277 | |||
| 1094 | Ga0373930_0201709 | |||
| 1095 | Ga0373948_0070889 | |||
| 1096 | Ga0373959_0003714 | |||
| 1097 | Ga0373926_0132953 | |||
| 1098 | Ga0373926_0165608 | |||
| 1099 | Ga0373926_0379546 | |||
| 1100 | Ga0373934_0067801 | |||
| 1101 | Ga0373934_0091807 | |||
| 1102 | Ga0373944_0068621 | |||
| 1103 | Ga0373951_0142609 | |||
| 1104 | Ga0373923_0017522 | |||
| 1105 | Ga0373953_0276069 | |||
| 1106 | Ga0373954_0002392 | |||
| 1107 | Ga0373954_0520581 | |||
| 1108 | Ga0373956_0064316 | |||
| 1109 | Ga0373956_0099252 | |||
| 1110 | Ga0373943_0142436 | |||
| 1111 | Ga0373943_0150267 | |||
| 1112 | Ga0373955_0018642 | |||
| 1113 | Ga0373955_0061959 | |||
| 1114 | Ga0373942_0182146 | |||
| 1115 | Ga0316574_0039406 | |||
| 1116 | Ga0373924_0021925 | |||
| 1117 | Ga0373931_0028385 | |||
| 1118 | Ga0373935_0018778 | |||
| 1119 | Ga0373935_0125338 | |||
| 1120 | Ga0373935_0517305 | |||
| 1121 | Ga0373935_0564651 | |||
| 1122 | Ga0373935_0613347 | |||
| 1123 | Ga0373927_0017276 | |||
| 1124 | Ga0373927_0195899 | |||
| 1125 | Ga0373927_0364974 | |||
| 1126 | Ga0373927_0618975 | |||
| 1127 | Ga0373927_0765615 | |||
| 1128 | Ga0373927_0921002 | |||
| 1129 | Ga0373933_0000858 | |||
| 1130 | Ga0373947_0029627 | |||
| 1131 | Ga0373947_0043754 | |||
| 1132 | Ga0373937_0001081 | |||
| 1133 | Ga0373937_0258653 | |||
| 1134 | Ga0373937_0533962 | |||
| 1135 | Ga0265778_045829 | |||
| 1136 | Ga0310110_031531 | |||
| 1137 | Ga0373925_0016615 | |||
| 1138 | Ga0373925_0095779 | |||
| 1139 | Ga0373925_0096148 | |||
| 1140 | Ga0395899_0177124 | |||
| 1141 | Ga0395900_0734024 | |||
| 1142 | Ga0395898_0012209 | |||
| 1143 | Ga0395905_0000084 | |||
| 1144 | Ga0395905_0416315 | |||
| 1145 | Ga0436364_0156715 | |||
| 1146 | Ga0436364_1142589 | |||
| 1147 | Ga0395901_0001925 | |||
| 1148 | Ga0400483_040814 | |||
| 1149 | Ga0436365_0348356 | |||
| 1150 | Ga0436360_0492388 | |||
| 1151 | Ga0436360_0819959 | |||
| 1152 | Ga0436361_0086433 | |||
| 1153 | Ga0436361_0472363 | |||
| 1154 | Ga0436363_0172872 | |||
| 1155 | Ga0436363_0554297 | |||
| 1156 | Ga0436363_0960112 | |||
| 1157 | Ga0436363_1459501 | |||
| 1158 | Ga0436362_1093814 | |||
| 1159 | Ga0436362_1216827 | |||
| 1160 | Ga0451802_0089247 | |||
| 1161 | Ga0451805_064365 | |||
| 1162 | Ga0451841_0097283 | |||
| 1163 | Ga0451851_0274901 | |||
| 1164 | Ga0439448_0019235 | |||
| 1165 | Ga0451577_0000033 | |||
| 1166 | Ga0451577_0006345 | |||
| 1167 | Ga0451577_0011735 | |||
| 1168 | Ga0451577_0021568 | |||
| 1169 | Ga0451577_0022979 | |||
| 1170 | Ga0451577_0101691 | |||
| 1171 | Ga0451577_1026423 | |||
| 1172 | Ga0451577_1335591 | |||
| 1173 | Ga0466972_0434709 | |||
| 1174 | Ga0453683_0009861 | |||
| 1175 | Ga0453683_0022862 | |||
| 1176 | Ga0453683_0342980 | |||
| 1177 | Ga0453683_0451383 | |||
| 1178 | Ga0466963_0560019 | |||
| 1179 | Ga0466963_1063492 | |||
| 1180 | Ga0453684_0000109 | |||
| 1181 | Ga0453684_0007468 | |||
| 1182 | Ga0453684_0021766 | |||
| 1183 | Ga0453684_0030174 | |||
| 1184 | Ga0453684_0045078 | |||
| 1185 | Ga0453684_0057007 | |||
| 1186 | Ga0453684_0086711 | |||
| 1187 | Ga0453684_0114376 | |||
| 1188 | Ga0453684_0175765 | |||
| 1189 | Ga0453684_0178772 | |||
| 1190 | Ga0453684_0321389 | |||
| 1191 | Ga0453684_0600656 | |||
| 1192 | Ga0453684_0991941 | |||
| 1193 | Ga0453684_1228363 | |||
| 1194 | Ga0453684_2036605 | |||
| 1195 | Ga0453684_2053855 | |||
| 1196 | Ga0451576_0005411 | |||
| 1197 | Ga0451576_0042025 | |||
| 1198 | Ga0451576_0116782 | |||
| 1199 | Ga0451576_0507389 | |||
| 1200 | Ga0466967_0859254 | |||
| 1201 | Ga0495592_0004065 | |||
| 1202 | Ga0495592_0191353 | |||
| 1203 | Ga0495603_0130614 | |||
| 1204 | Ga0495603_0402195 | |||
| 1205 | Ga0495629_0027091 | |||
| 1206 | Ga0495629_0105735 | |||
| 1207 | Ga0495651_0001400 | |||
| 1208 | Ga0495651_0095409 | |||
| 1209 | Ga0495653_0000370 | |||
| 1210 | Ga0495650_0030570 | |||
| 1211 | Ga0495582_0084464 | |||
| 1212 | Ga0495639_0013602 | |||
| 1213 | Ga0495662_0130214 | |||
| 1214 | Ga0495662_0285430 | |||
| 1215 | Ga0495664_0154882 | |||
| 1216 | Ga0495664_0177335 | |||
| 1217 | Ga0495583_0000510 | |||
| 1218 | Ga0495606_0057236 | |||
| 1219 | Ga0495608_0077646 | |||
| 1220 | Ga0495608_0476609 | |||
| 1221 | Ga0495618_0015533 | |||
| 1222 | Ga0495628_0014171 | |||
| 1223 | Ga0495628_0028002 | |||
| 1224 | Ga0495628_0547848 | |||
| 1225 | Ga0495666_0087692 | |||
| 1226 | Ga0495666_0288961 | |||
| 1227 | Ga0495652_0004294 | |||
| 1228 | Ga0495652_0058795 | |||
| 1229 | Ga0495652_0121026 | |||
| 1230 | Ga0495665_0098170 | |||
| 1231 | Ga0495640_0000769 | |||
| 1232 | Ga0495640_0286422 | |||
| 1233 | Ga0495586_0432835 | |||
| 1234 | Ga0495586_0566406 | |||
| 1235 | Ga0495587_0001283 | |||
| 1236 | Ga0495587_0076302 | |||
| 1237 | Ga0495587_0667780 | |||
| 1238 | Ga0495645_0121611 | |||
| 1239 | Ga0495645_0462489 | |||
| 1240 | Ga0495622_0142980 | |||
| 1241 | Ga0495667_0001440 | |||
| 1242 | Ga0495667_0077165 | |||
| 1243 | Ga0495668_0076671 | |||
| 1244 | Ga0495625_0071349 | |||
| 1245 | Ga0495635_0030116 | |||
| 1246 | Ga0495635_0206185 | |||
| 1247 | Ga0495635_0680112 | |||
| 1248 | Ga0495657_0069542 | |||
| 1249 | Ga0495657_0073076 | |||
| 1250 | Ga0495599_0071441 | |||
| 1251 | Ga0495599_0118080 | |||
| 1252 | Ga0495623_0013044 | |||
| 1253 | Ga0495623_0056886 | |||
| 1254 | Ga0495623_0165314 | |||
| 1255 | Ga0495646_0010752 | |||
| 1256 | Ga0495646_0076284 | |||
| 1257 | Ga0495646_0199053 | |||
| 1258 | Ga0495647_0182064 | |||
| 1259 | Ga0495658_0164017 | |||
| 1260 | Ga0495669_0068959 | |||
| 1261 | Ga0495613_0053483 | |||
| 1262 | Ga0495613_0242482 | |||
| 1263 | Ga0495624_0056635 | |||
| 1264 | Ga0495671_0070435 | |||
| 1265 | Ga0495649_0000961 | |||
| 1266 | Ga0495589_0004694 | |||
| 1267 | Ga0495600_0000422 | |||
| 1268 | Ga0495600_0073413 | |||
| 1269 | Ga0495604_0000406 | |||
| 1270 | Ga0495604_0200999 | |||
| 1271 | Ga0495674_0023413 | |||
| 1272 | Ga0495674_0382073 | |||
| 1273 | Ga0495676_0071144 | |||
| 1274 | Ga0495680_0001477 | |||
| 1275 | Ga0495680_0751124 | |||
| 1276 | Ga0495683_0084411 | |||
| 1277 | Ga0495675_0036422 | |||
| 1278 | Ga0495675_0038770 | |||
| 1279 | Ga0495684_0002545 | |||
| 1280 | Ga0495684_0332917 | |||
| 1281 | Ga0495686_0024589 | |||
| 1282 | Ga0495593_0035738 | |||
| 1283 | Ga0495602_0010292 | |||
| 1284 | Ga0495602_0193078 | |||
| 1285 | Ga0495602_0947697 | |||
| 1286 | Ga0496100_1463114 | |||
| 1287 | Ga0496101_0013828 | |||
| 1288 | Ga0496101_0620526 | |||
| 1289 | Ga0496102_0099626 | |||
| 1290 | Ga0496104_0056453 | |||
| 1291 | Ga0496104_0207951 | |||
| 1292 | Ga0496105_0091241 | |||
| 1293 | Ga0496105_0454067 | |||
| 1294 | Ga0496105_1138649 | |||
| 1295 | Ga0496106_0013846 | |||
| 1296 | Ga0496106_0380462 | |||
| 1297 | Ga0496106_0407526 | |||
| 1298 | Ga0496107_0355208 | |||
| 1299 | Ga0496107_0935655 | |||
| 1300 | Ga0496108_0310980 | |||
| 1301 | Ga0496108_0495908 | |||
| 1302 | Ga0496108_0537383 | |||
| 1303 | Ga0496108_1570015 | |||
| 1304 | Ga0496109_0334595 | |||
| 1305 | Ga0496109_0709928 | |||
| 1306 | Ga0496109_0789501 | |||
| 1307 | Ga0496109_0946357 | |||
| 1308 | Ga0496109_1767454 | |||
| 1309 | Ga0496110_0275586 | |||
| 1310 | Ga0496110_1484199 | |||
| 1311 | Ga0496112_0880532 | |||
| 1312 | Ga0496113_1515888 | |||
| 1313 | Ga0496114_0043566 | |||
| 1314 | Ga0496114_0831067 | |||
| 1315 | Ga0496115_0073725 | |||
| 1316 | Ga0496115_0214760 | |||
| 1317 | Ga0496119_0007636 | |||
| 1318 | Ga0496126_0153375 | |||
| 1319 | Ga0496126_0402361 | |||
| 1320 | Ga0501306_074159 | |||
| 1321 | Ga0501312_124053 | |||
| 1322 | Ga0501034_0011194 | |||
| 1323 | Ga0501034_0062111 | |||
| 1324 | Ga0501034_0213455 | |||
| 1325 | Ga0501034_0929856 | |||
| 1326 | Ga0501067_0012140 | |||
| 1327 | Ga0501067_0040594 | |||
| 1328 | Ga0501068_0011298 | |||
| 1329 | Ga0501068_0124575 | |||
| 1330 | Ga0501069_0120381 | |||
| 1331 | Ga0501071_0750483 | |||
| 1332 | Ga0501072_1008839 | |||
| 1333 | Ga0501073_0094048 | |||
| 1334 | Ga0501073_0109680 | |||
| 1335 | Ga0501073_0690583 | |||
| 1336 | Ga0501074_0092370 | |||
| 1337 | Ga0501079_0982197 | |||
| 1338 | Ga0501080_0068177 | |||
| 1339 | Ga0501080_0970474 | |||
| 1340 | Ga0501081_0048650 | |||
| 1341 | Ga0501083_0086310 | |||
| 1342 | Ga0501035_0318618 | |||
| 1343 | Ga0501044_0242091 | |||
| 1344 | Ga0501044_0275193 | |||
| 1345 | Ga0501044_0653553 | |||
| 1346 | nmdc:mga03683_154212_c1 | |||
| 1347 | nmdc:mga00v17_550791_c1 | |||
| 1348 | nmdc:mga0k408_17468_c1 | |||
| 1349 | nmdc:mga0k408_18793_c1 | |||
| 1350 | nmdc:mga0k408_3994_c1 | |||
| 1351 | nmdc:mga07m45_2618_c1 | |||
| 1352 | nmdc:mga05p37_1557282_c1 | |||
| 1353 | nmdc:mga09592_418985_c1 | |||
| 1354 | nmdc:mga0qj67_773324_c1 | |||
| 1355 | nmdc:mga08y16_112266_c1 | |||
| 1356 | nmdc:mga08y16_918900_c1 | |||
| 1357 | nmdc:mga0n895_324307_c1 | |||
| 1358 | nmdc:mga0rr50_119161_c1 | |||
| 1359 | nmdc:mga08x19_81325_c1 | |||
| 1360 | nmdc:mga0a205_1230022_c1 | |||
| 1361 | nmdc:mga0sz30_58732_c1 | |||
| 1362 | Ga0495601_0013011 | |||
| 1363 | Ga0495601_0288764 | |||
| 1364 | Ga0495601_0779406 | |||
| 1365 | Ga0495612_0001890 | |||
| 1366 | Ga0495612_0182693 | |||
| 1367 | Ga0500635_0000036 | |||
| 1368 | Ga0495595_0000821 | |||
| 1369 | Ga0495595_0019353 | |||
| 1370 | Ga0495619_0000352 | |||
| 1371 | Ga0495619_0444844 | |||
| 1372 | Ga0495619_1028864 | |||
| 1373 | Ga0500651_0272510 | |||
| 1374 | Ga0500641_0033682 | |||
| 1375 | Ga0500594_0012196 | |||
| 1376 | Ga0500607_134777 | |||
| 1377 | Ga0500608_273900 | |||
| 1378 | Ga0500559_0110294 | |||
| 1379 | Ga0500589_148106 | |||
| 1380 | Ga0500604_0327222 | |||
| 1381 | Ga0500630_193628 | |||
| 1382 | Ga0500638_161624 | |||
| 1383 | Ga0500639_339252 | |||
| 1384 | Ga0500636_0105188 | |||
| 1385 | Ga0500636_0230069 | |||
| 1386 | Ga0587084_005438 | |||
| 1387 | Ga0587084_139095 | |||
| 1388 | Ga0587093_010602 | |||
| 1389 | Ga0587066_006963 | |||
| 1390 | Ga0587066_060549 | |||
| 1391 | Ga0587070_003113 | |||
| 1392 | Ga0587070_198311 | |||
| 1393 | Ga0587073_0001947 | |||
| 1394 | Ga0587073_0101802 | |||
| 1395 | Ga0587073_0250411 | |||
| 1396 | Ga0587077_124834 | |||
| 1397 | Ga0587080_004286 | |||
| 1398 | Ga0587080_159338 | |||
| 1399 | Ga0587082_032816 | |||
| 1400 | Ga0587082_129963 | |||
| 1401 | Ga0587083_0000179 | |||
| 1402 | Ga0587083_0073253 | |||
| 1403 | Ga0587083_0240818 | |||
| 1404 | Ga0587085_034481 | |||
| 1405 | Ga0587086_055568 | |||
| 1406 | Ga0587088_043631 | |||
| 1407 | Ga0587088_079546 | |||
| 1408 | Ga0587088_096516 | |||
| 1409 | Ga0587089_012402 | |||
| 1410 | Ga0587089_070146 | |||
| 1411 | Ga0587090_020013 | |||
| 1412 | Ga0587090_115900 | |||
| 1413 | Ga0587090_168558 | |||
| 1414 | Ga0587092_009469 | |||
| 1415 | Ga0587094_012127 | |||
| 1416 | Ga0587098_024966 | |||
| 1417 | Ga0587106_055892 | |||
| 1418 | Ga0587125_020912 | |||
| 1419 | Ga0587099_014844 | |||
| 1420 | Ga0587109_009123 | |||
| 1421 | Ga0587109_015181 | |||
| 1422 | Ga0587113_018370 | |||
| 1423 | Ga0587128_000534 | |||
| 1424 | Ga0587062_025654 | |||
| 1425 | Ga0587067_000404 | |||
| 1426 | Ga0587068_023032 | |||
| 1427 | Ga0587068_129323 | |||
| 1428 | Ga0587072_001614 | |||
| 1429 | Ga0587076_009651 | |||
| 1430 | Ga0587078_003507 | |||
| 1431 | Ga0587100_005857 | |||
| 1432 | Ga0587102_010689 | |||
| 1433 | Ga0587104_004395 | |||
| 1434 | Ga0587105_001974 | |||
| 1435 | Ga0587107_000941 | |||
| 1436 | Ga0587107_007297 | |||
| 1437 | Ga0587116_12521 | |||
| 1438 | Ga0587118_01471 | |||
| 1439 | Ga0587124_019230 | |||
| 1440 | Ga0587071_004987 | |||
| 1441 | Ga0587071_070077 | |||
| 1442 | 2523107254 | |||
| 1443 | 2643746677 | |||
| 1444 | 2644131946 | |||
| 1445 | 2644256830 | |||
| 1446 | 2723879664 | |||
| 1447 | 2739309064 | |||
| 1448 | 2837679884 | |||
| 1449 | 2889793650 | |||
| 1450 | 2889919552 | |||
| 1451 | 2891050840 | |||
| 1452 | 2891092405 | |||
| 1453 | 2909400002 | |||
| 1454 | 8002061420 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7mqa-assembly1.cif.gz_L3 | cryo-em structure of the human ssu processome, state post-a1 | 0.9713 | 3 | 61 |
| 6zqf-assembly1.cif.gz_DS | cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-b (poly-ala) | 0.9668 | 3 | 61 |
| 6zqg-assembly1.cif.gz_DS | cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-c | 0.9413 | 3 | 61 |
| 6rbd-assembly1.cif.gz_S | state 1 of yeast tsr1-tap rps20-deltaloop pre-40s particles | 0.934 | 3 | 61 |
| 1l1z-assembly1.cif.gz_A | mutm (fpg) covalent-dna intermediate | 0.9202 | 30 | 58 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P54019_1_77_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9786 | 3 | 61 | 1.10.8.50 |
| af_A0A1D8PQQ5_1_82_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9747 | 3 | 61 | 1.10.8.50 |
| af_Q8HCP0_1_71_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9693 | 4 | 70 | 1.10.8.50 |
| 1i94M01 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.9669 | 14 | 63 | 1.10.8.50 |
| af_Q2FW30_1_70_1.10.8.50 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; | 0.966 | 1 | 70 | 1.10.8.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A436DSH1-F1-model_v4 | 30S ribosomal protein S13 | 1.003 | 1 | 66 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |
| AF-A0A533J219-F1-model_v4 | deleted | 0.9937 | 1 | 58 |
|
| AF-A0A7C1JM66-F1-model_v4 | 30S ribosomal protein S13 | 0.9927 | 1 | 60 |
GO:0003723
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A6B0CFM2-F1-model_v4 | 30S ribosomal protein S13 | 0.9919 | 1 | 60 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7C4MPL7-F1-model_v4 | 30S ribosomal protein S13 | 0.9879 | 1 | 66 |
GO:0003723
GO:0003735 GO:0005829 GO:0006412 GO:0015935 |