F477802

General Info

Members Datasets Scaffolds Average Seq Length
728 434 1454 123

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10123030|Ga0182008_101230302
Length 146
Sequence LVRARLVAHPATAQFSEERHVARIAGVNVPSQKPIWIALTYIFGIGQTTSRKILNEVQIPLQRRTAELTEAELSRIRDKIDREYKVEGDLRRDVAMSIKRLMDLGCYRGLRHRRGLPVRGQRTHTNARTRKGKARPIAGKKKATKK

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
10 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
11 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300019161 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
110 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300023536 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
123 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
129 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
130 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
187 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
190 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
191 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
194 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
197 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
198 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
199 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
200 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
201 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
202 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
203 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
204 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
205 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
206 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
207 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
208 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
209 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
212 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
215 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
216 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
218 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
224 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
225 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
228 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
229 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
232 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
233 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
234 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
235 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
236 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
237 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
238 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300036535 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU6 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
249 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
250 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
251 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
252 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
255 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
256 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
257 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
258 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
259 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
260 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
261 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
262 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
263 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
264 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
265 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
266 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
267 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
270 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
276 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
280 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
281 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
282 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
283 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
284 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
285 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
286 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
287 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
290 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
291 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
292 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
297 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
298 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
299 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
300 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
303 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
304 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
305 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
310 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
311 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
319 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
324 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
325 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
326 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
327 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
328 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
329 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
330 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
331 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
332 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
333 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
334 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
335 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
336 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
342 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
343 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
344 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
351 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
354 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
355 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
356 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
357 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
358 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
359 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
360 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
361 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
362 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
363 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
364 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
365 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
366 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
367 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
368 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
369 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
370 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
373 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
374 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
375 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
376 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
377 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
378 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
379 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
380 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
381 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
382 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
383 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
384 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
397 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
398 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
399 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
400 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
401 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
402 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
403 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
404 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
405 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
406 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
408 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
409 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
423 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
424 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
425 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
426 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
427 2738543024 Aminobacter sp. AP02 Isolate Unclassified
428 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
429 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
430 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
431 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
432 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
433 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
434 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.34
Metatranscriptomes 13.87
Isolates 1.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.32
Nodule 0
Rhizoplane 4.53
Rhizosphere 83.24
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10123030 3300014497 Bacteria 1290
2 JGI24735J21928_10180060 3300002067 Bacteria 612
3 JGI25156J39149_1048087 3300002705 Bacteria 567
4 JGI25154J39366_1000593 3300002738 Bacteria 17447
5 JGI25157J39369_1001134 3300002741 Bacteria 11672
6 Ga0007410J51695_1090156 3300003574 Bacteria 691
7 Ga0007416J51690_1044706 3300003577 Bacteria 700
8 Ga0055539_1002928 3300003752 Bacteria 2478
9 Ga0055533_1000043 3300003756 Bacteria 229262
10 Ga0055525_1000641 3300003759 Bacteria 14040
11 Ga0055535_1000420 3300003761 Bacteria 39880
12 Ga0055529_1000322 3300003763 Bacteria 54232
13 JGI25405J52794_10006418 3300003911 Bacteria 2149
14 Ga0058859_11395877 3300004798 Bacteria 861
15 Ga0058859_11499848 3300004798 Bacteria 1131
16 Ga0058861_11919994 3300004800 Bacteria 1104
17 Ga0058860_12155775 3300004801 Bacteria 1240
18 Ga0070658_10660472 3300005327 Bacteria 907
19 Ga0070683_102333734 3300005329 Bacteria 513
20 Ga0070690_100111170 3300005330 Bacteria 1828
21 Ga0070670_100171189 3300005331 Bacteria 1883
22 Ga0068869_100100346 3300005334 Bacteria 2189
23 Ga0068869_101805685 3300005334 Bacteria 547
24 Ga0070666_10086429 3300005335 Bacteria 2149
25 Ga0070680_101578527 3300005336 Bacteria 568
26 Ga0068868_100616452 3300005338 Bacteria 963
27 Ga0070689_100198876 3300005340 Bacteria 1635
28 Ga0070691_10257636 3300005341 Bacteria 938
29 Ga0070687_100028209 3300005343 Bacteria 2720
30 Ga0070687_101046781 3300005343 Bacteria 594
31 Ga0070661_100211043 3300005344 Bacteria 1486
32 Ga0070675_100605768 3300005354 Bacteria 994
33 Ga0070671_100003486 3300005355 Bacteria 12276
34 Ga0070673_100110053 3300005364 Bacteria 2283
35 Ga0070688_100330669 3300005365 Bacteria 1110
36 Ga0070659_100203963 3300005366 Bacteria 1628
37 Ga0070659_100721941 3300005366 Bacteria 863
38 Ga0070709_10015699 3300005434 Bacteria 4313
39 Ga0070709_10572376 3300005434 Bacteria 867
40 Ga0070714_100024965 3300005435 Bacteria 4928
41 Ga0070713_100011844 3300005436 Bacteria 6372
42 Ga0070710_10003492 3300005437 Bacteria 7449
43 Ga0070710_10078215 3300005437 Bacteria 1924
44 Ga0070711_100028081 3300005439 Bacteria 3699
45 Ga0070711_100302792 3300005439 Bacteria 1272
46 Ga0070694_100052832 3300005444 Bacteria 2748
47 Ga0070663_100757558 3300005455 Bacteria 829
48 Ga0070662_100102710 3300005457 Bacteria 2167
49 Ga0070662_101647757 3300005457 Bacteria 554
50 Ga0068867_100484225 3300005459 Bacteria 1061
51 Ga0070685_10615579 3300005466 Bacteria 783
52 Ga0070679_100269034 3300005530 Bacteria 1658
53 Ga0070684_100516613 3300005535 Bacteria 1107
54 Ga0070684_100721945 3300005535 Bacteria 929
55 Ga0070684_101169908 3300005535 Bacteria 723
56 Ga0068853_100293022 3300005539 Bacteria 1502
57 Ga0070672_100558846 3300005543 Bacteria 994
58 Ga0070672_101453073 3300005543 Bacteria 614
59 Ga0070686_100447851 3300005544 Bacteria 992
60 Ga0070686_101297527 3300005544 Bacteria 608
61 Ga0070695_100021458 3300005545 Bacteria 3953
62 Ga0070696_100582636 3300005546 Bacteria 900
63 Ga0070696_101733063 3300005546 Bacteria 539
64 Ga0070693_100589413 3300005547 Bacteria 801
65 Ga0068855_100534661 3300005563 Bacteria 1270
66 Ga0070664_100235185 3300005564 Bacteria 1643
67 Ga0068854_100023136 3300005578 Bacteria 4241
68 Ga0068856_100149077 3300005614 Bacteria 2347
69 Ga0068856_100256499 3300005614 Bacteria 1764
70 Ga0070702_100277676 3300005615 Bacteria 1149
71 Ga0068864_100714314 3300005618 Bacteria 980
72 Ga0068864_100991110 3300005618 Bacteria 833
73 Ga0068861_100152994 3300005719 Bacteria 1895
74 Ga0068851_10162545 3300005834 Bacteria 1227
75 Ga0068863_100662454 3300005841 Bacteria 1036
76 Ga0068858_100848223 3300005842 Bacteria 892
77 Ga0068860_100217691 3300005843 Bacteria 1854
78 Ga0068860_100671474 3300005843 Bacteria 1045
79 Ga0081538_10120554 3300005981 Bacteria 1261
80 Ga0081540_1003020 3300005983 Bacteria 13478
81 Ga0081539_10046287 3300005985 Bacteria 2494
82 Ga0070717_10166904 3300006028 Bacteria 1912
83 Ga0075363_100028810 3300006048 Bacteria 2861
84 Ga0075364_10020585 3300006051 Bacteria 4150
85 Ga0075364_10324752 3300006051 Bacteria 1048
86 Ga0070715_10014729 3300006163 Bacteria 2902
87 Ga0070715_10304664 3300006163 Bacteria 854
88 Ga0070716_100038933 3300006173 Bacteria 2635
89 Ga0070716_101106925 3300006173 Bacteria 632
90 Ga0070712_100004635 3300006175 Bacteria 8499
91 Ga0070712_100013564 3300006175 Bacteria 5211
92 Ga0070712_100197997 3300006175 Bacteria 1576
93 Ga0075367_10660157 3300006178 Bacteria 665
94 Ga0075366_10000795 3300006195 Bacteria 15124
95 Ga0075366_10018750 3300006195 Bacteria 3997
96 Ga0075366_10211595 3300006195 Bacteria 1180
97 Ga0097621_100289575 3300006237 Bacteria 1444
98 Ga0075370_10011014 3300006353 Bacteria 4743
99 Ga0068871_100165726 3300006358 Bacteria 1891
100 Ga0075428_100601252 3300006844 Bacteria 1175
101 Ga0075429_100137036 3300006880 Bacteria 2142
102 Ga0068865_102092155 3300006881 Bacteria 514
103 Ga0075436_100109455 3300006914 Bacteria 1928
104 Ga0105250_10257088 3300009092 Bacteria 747
105 Ga0105240_11571470 3300009093 Bacteria 689
106 Ga0105240_11739249 3300009093 Bacteria 650
107 Ga0111539_10077885 3300009094 Bacteria 3901
108 Ga0111539_10340819 3300009094 Bacteria 1745
109 Ga0105245_10580509 3300009098 Bacteria 1145
110 Ga0114129_10722753 3300009147 Bacteria 1278
111 Ga0105243_10249883 3300009148 Bacteria 1583
112 Ga0105241_10079232 3300009174 Bacteria 2568
113 Ga0105241_10288877 3300009174 Bacteria 1403
114 Ga0105242_11364451 3300009176 Bacteria 735
115 Ga0105248_11347305 3300009177 Bacteria 807
116 Ga0105248_11835400 3300009177 Bacteria 688
117 Ga0105237_10051839 3300009545 Bacteria 4121
118 Ga0105237_10211706 3300009545 Bacteria 1938
119 Ga0105237_10390119 3300009545 Bacteria 1397
120 Ga0105237_10895092 3300009545 Bacteria 894
121 Ga0105237_12247333 3300009545 Bacteria 555
122 Ga0105238_10205025 3300009551 Bacteria 1948
123 Ga0105238_10237854 3300009551 Bacteria 1798
124 Ga0105238_10957271 3300009551 Bacteria 876
125 Ga0105249_10323671 3300009553 Bacteria 1553
126 Ga0105249_10648792 3300009553 Bacteria 1113
127 Ga0105249_12672687 3300009553 Bacteria 571
128 Ga0105239_10623881 3300010375 Bacteria 1230
129 Ga0105239_11647301 3300010375 Bacteria 742
130 Ga0105239_11768370 3300010375 Bacteria 716
131 Ga0105239_12212956 3300010375 Bacteria 639
132 Ga0105246_11610726 3300011119 Bacteria 614
133 Ga0157369_10034850 3300013105 Bacteria 5521
134 Ga0157369_10388715 3300013105 Bacteria 1448
135 Ga0157369_10885588 3300013105 Bacteria 916
136 Ga0157374_10036137 3300013296 Bacteria 4523
137 Ga0157374_11702013 3300013296 Bacteria 655
138 Ga0157378_10129245 3300013297 Bacteria 2337
139 Ga0157378_12931055 3300013297 Bacteria 529
140 Ga0163162_10411533 3300013306 Bacteria 1485
141 Ga0163162_11598988 3300013306 Bacteria 743
142 Ga0157372_10189020 3300013307 Bacteria 2385
143 Ga0157372_10950203 3300013307 Bacteria 996
144 Ga0157372_11272619 3300013307 Bacteria 849
145 Ga0163163_10477985 3300014325 Bacteria 1307
146 Ga0182008_10155033 3300014497 Bacteria 1150
147 Ga0182008_10202882 3300014497 Bacteria 1009
148 Ga0182008_10445012 3300014497 Bacteria 703
149 Ga0157379_10056467 3300014968 Bacteria 3508
150 Ga0157379_10241188 3300014968 Bacteria 1640
151 Ga0157376_10622730 3300014969 Bacteria 1077
152 Ga0182006_1173195 3300015261 Bacteria 722
153 Ga0184602_128378 3300019161 Bacteria 807
154 Ga0184603_115845 3300019192 Bacteria 731
155 Ga0197907_11204008 3300020069 Bacteria 760
156 Ga0206356_10333002 3300020070 Bacteria 527
157 Ga0206356_10880351 3300020070 Bacteria 1354
158 Ga0206356_10973081 3300020070 Bacteria 821
159 Ga0206349_1471409 3300020075 Bacteria 587
160 Ga0206355_1182367 3300020076 Bacteria 1317
161 Ga0206355_1569053 3300020076 Bacteria 559
162 Ga0206351_10919874 3300020077 Bacteria 590
163 Ga0206352_10996423 3300020078 Bacteria 824
164 Ga0206350_10273521 3300020080 Bacteria 522
165 Ga0206354_10721124 3300020081 Bacteria 693
166 Ga0206354_11216635 3300020081 Bacteria 653
167 Ga0206353_11465831 3300020082 Bacteria 563
168 Ga0154015_1148978 3300020610 Bacteria 557
169 Ga0154015_1457285 3300020610 Bacteria 747
170 Ga0213872_10135020 3300021361 Bacteria 1085
171 Ga0213872_10302772 3300021361 Bacteria 663
172 Ga0213874_10160717 3300021377 Bacteria 789
173 Ga0213874_10196931 3300021377 Bacteria 723
174 Ga0213874_10248759 3300021377 Bacteria 655
175 Ga0213876_10420360 3300021384 Bacteria 711
176 Ga0213875_10455529 3300021388 Bacteria 612
177 Ga0224712_10020260 3300022467 Bacteria 2254
178 Ga0224712_10453857 3300022467 Bacteria 616
179 Ga0224712_10485922 3300022467 Bacteria 596
180 Ga0247552_101829 3300023536 Bacteria 655
181 Ga0228598_1000416 3300024227 Bacteria 8639
182 Ga0209674_100067 3300025226 Bacteria 253824
183 Ga0209672_106433 3300025228 Bacteria 1909
184 Ga0209563_100068 3300025230 Bacteria 254802
185 Ga0207427_100260 3300025231 Bacteria 41435
186 Ga0209258_100342 3300025242 Bacteria 68390
187 Ga0209258_100554 3300025242 Bacteria 33123
188 Ga0209646_1000127 3300025246 Bacteria 131920
189 Ga0209026_1000004 3300025250 Bacteria 949012
190 Ga0209677_100201 3300025253 Bacteria 47899
191 Ga0209148_1005675 3300025254 Bacteria 2815
192 Ga0209759_1000129 3300025256 Bacteria 131961
193 Ga0209759_1027374 3300025256 Bacteria 1178
194 Ga0209455_1000083 3300025272 Bacteria 255660
195 Ga0209676_1000092 3300025292 Bacteria 250453
196 Ga0209050_1007590 3300025298 Bacteria 6028
197 Ga0207692_10020862 3300025898 Bacteria 2988
198 Ga0207647_10143184 3300025904 Bacteria 1400
199 Ga0207685_10014999 3300025905 Bacteria 2443
200 Ga0207685_10330104 3300025905 Bacteria 763
201 Ga0207685_10372724 3300025905 Bacteria 725
202 Ga0207685_10390681 3300025905 Bacteria 711
203 Ga0207699_10005995 3300025906 Bacteria 5850
204 Ga0207699_10440398 3300025906 Bacteria 933
205 Ga0207699_11094209 3300025906 Bacteria 590
206 Ga0207645_10289237 3300025907 Bacteria 1089
207 Ga0207705_10381815 3300025909 Bacteria 1088
208 Ga0207654_10132215 3300025911 Bacteria 1581
209 Ga0207707_10408317 3300025912 Bacteria 1165
210 Ga0207695_10105714 3300025913 Bacteria 2802
211 Ga0207695_10712542 3300025913 Bacteria 884
212 Ga0207671_10051341 3300025914 Bacteria 3056
213 Ga0207671_10338814 3300025914 Bacteria 1191
214 Ga0207693_10018098 3300025915 Bacteria 5614
215 Ga0207693_10021188 3300025915 Bacteria 5167
216 Ga0207693_10027985 3300025915 Bacteria 4456
217 Ga0207693_10251745 3300025915 Bacteria 1386
218 Ga0207693_10394248 3300025915 Bacteria 1082
219 Ga0207663_10114880 3300025916 Bacteria 1833
220 Ga0207663_10206117 3300025916 Bacteria 1422
221 Ga0207663_10712037 3300025916 Bacteria 795
222 Ga0207660_11275158 3300025917 Bacteria 597
223 Ga0207662_10031400 3300025918 Bacteria 3086
224 Ga0207662_11309525 3300025918 Bacteria 515
225 Ga0207657_11494476 3300025919 Bacteria 505
226 Ga0207649_10312084 3300025920 Bacteria 1153
227 Ga0207652_10375413 3300025921 Bacteria 1283
228 Ga0207681_11431145 3300025923 Bacteria 580
229 Ga0207694_10083671 3300025924 Bacteria 2509
230 Ga0207694_10205510 3300025924 Bacteria 1603
231 Ga0207694_10830323 3300025924 Bacteria 781
232 Ga0207694_10943332 3300025924 Bacteria 730
233 Ga0207659_10042382 3300025926 Bacteria 3191
234 Ga0207659_10825108 3300025926 Bacteria 797
235 Ga0207687_10197952 3300025927 Bacteria 1568
236 Ga0207687_10344140 3300025927 Bacteria 1213
237 Ga0207700_10239003 3300025928 Bacteria 1547
238 Ga0207700_10572137 3300025928 Bacteria 1004
239 Ga0207664_10044723 3300025929 Bacteria 3469
240 Ga0207664_10298575 3300025929 Bacteria 1417
241 Ga0207644_10006009 3300025931 Bacteria 7913
242 Ga0207644_11365041 3300025931 Bacteria 595
243 Ga0207690_10059045 3300025932 Bacteria 2598
244 Ga0207690_10082583 3300025932 Bacteria 2248
245 Ga0207706_10191401 3300025933 Bacteria 1796
246 Ga0207706_11658156 3300025933 Bacteria 516
247 Ga0207686_10618594 3300025934 Bacteria 854
248 Ga0207709_10715401 3300025935 Bacteria 802
249 Ga0207670_10079487 3300025936 Bacteria 2289
250 Ga0207670_11169556 3300025936 Bacteria 651
251 Ga0207665_10012672 3300025939 Bacteria 5544
252 Ga0207665_10305191 3300025939 Bacteria 1191
253 Ga0207691_10087732 3300025940 Bacteria 2791
254 Ga0207711_10951667 3300025941 Bacteria 798
255 Ga0207711_11101606 3300025941 Bacteria 735
256 Ga0207689_10025393 3300025942 Bacteria 4965
257 Ga0207661_10370299 3300025944 Bacteria 1295
258 Ga0207679_10040130 3300025945 Bacteria 3348
259 Ga0207667_10588076 3300025949 Bacteria 1123
260 Ga0207651_10019963 3300025960 Bacteria 4031
261 Ga0207640_10023477 3300025981 Bacteria 3706
262 Ga0207677_11237641 3300026023 Bacteria 684
263 Ga0207639_10449647 3300026041 Bacteria 1169
264 Ga0207639_10804740 3300026041 Bacteria 876
265 Ga0207678_10143467 3300026067 Bacteria 2038
266 Ga0207678_11432391 3300026067 Bacteria 610
267 Ga0207702_10001875 3300026078 Bacteria 20626
268 Ga0207702_10237817 3300026078 Bacteria 1705
269 Ga0207641_10020044 3300026088 Bacteria 5491
270 Ga0207641_11133079 3300026088 Bacteria 781
271 Ga0207676_10876069 3300026095 Bacteria 879
272 Ga0207676_11006898 3300026095 Bacteria 821
273 Ga0207674_10004293 3300026116 Bacteria 17188
274 Ga0207675_100219937 3300026118 Bacteria 1830
275 Ga0207698_10064301 3300026142 Bacteria 2875
276 Ga0210000_1053731 3300027462 Bacteria 648
277 Ga0207428_10271194 3300027907 Bacteria 1261
278 Ga0268264_10182306 3300028381 Bacteria 1908
279 Ga0268264_10829898 3300028381 Bacteria 925
280 Ga0265319_1077434 3300028563 Bacteria 1059
281 Ga0265319_1138665 3300028563 Bacteria 755
282 Ga0265319_1152469 3300028563 Bacteria 715
283 Ga0265334_10120299 3300028573 Bacteria 939
284 Ga0265318_10000273 3300028577 Bacteria 43832
285 Ga0265318_10001387 3300028577 Bacteria 14390
286 Ga0265318_10028950 3300028577 Bacteria 2162
287 Ga0265322_10230541 3300028654 Bacteria 531
288 Ga0265336_10000028 3300028666 Bacteria 179201
289 Ga0307515_10450121 3300028794 Bacteria 903
290 Ga0265338_10145149 3300028800 Bacteria 1852
291 Ga0307511_10051346 3300030521 Bacteria 3308
292 Ga0265769_101828 3300030888 Bacteria 1062
293 Ga0265760_10080711 3300031090 Bacteria 1007
294 Ga0265330_10000998 3300031235 Bacteria 17255
295 Ga0265330_10059999 3300031235 Bacteria 1656
296 Ga0265330_10279046 3300031235 Bacteria 704
297 Ga0265330_10286466 3300031235 Bacteria 694
298 Ga0265332_10000280 3300031238 Bacteria 40175
299 Ga0265332_10002691 3300031238 Bacteria 8896
300 Ga0265332_10214300 3300031238 Bacteria 799
301 Ga0265328_10010978 3300031239 Bacteria 3631
302 Ga0265328_10016001 3300031239 Bacteria 2927
303 Ga0265328_10032488 3300031239 Bacteria 1937
304 Ga0265328_10032994 3300031239 Bacteria 1920
305 Ga0265328_10127622 3300031239 Bacteria 951
306 Ga0265320_10000485 3300031240 Bacteria 31127
307 Ga0265320_10054588 3300031240 Bacteria 1927
308 Ga0265320_10141966 3300031240 Bacteria 1087
309 Ga0265320_10406698 3300031240 Bacteria 601
310 Ga0265325_10001575 3300031241 Bacteria 15904
311 Ga0265325_10061357 3300031241 Bacteria 1907
312 Ga0265325_10410898 3300031241 Bacteria 592
313 Ga0265329_10000013 3300031242 Bacteria 70645
314 Ga0265329_10028096 3300031242 Bacteria 1846
315 Ga0265329_10054803 3300031242 Bacteria 1266
316 Ga0265340_10000189 3300031247 Bacteria 31156
317 Ga0265340_10002589 3300031247 Bacteria 10274
318 Ga0265340_10004541 3300031247 Bacteria 7738
319 Ga0265340_10016859 3300031247 Bacteria 3779
320 Ga0265340_10019984 3300031247 Bacteria 3445
321 Ga0265340_10219713 3300031247 Bacteria 851
322 Ga0265340_10310168 3300031247 Bacteria 699
323 Ga0265339_10008773 3300031249 Bacteria 6404
324 Ga0265339_10017456 3300031249 Bacteria 4251
325 Ga0265339_10092846 3300031249 Bacteria 1580
326 Ga0265339_10229158 3300031249 Bacteria 906
327 Ga0265339_10242742 3300031249 Bacteria 874
328 Ga0265331_10002207 3300031250 Bacteria 13369
329 Ga0265331_10012161 3300031250 Bacteria 4675
330 Ga0265331_10059653 3300031250 Bacteria 1804
331 Ga0265327_10001331 3300031251 Bacteria 32073
332 Ga0265316_10001048 3300031344 Bacteria 29962
333 Ga0265316_10002957 3300031344 Bacteria 17386
334 Ga0265316_10063600 3300031344 Bacteria 2861
335 Ga0265316_10082839 3300031344 Bacteria 2458
336 Ga0307509_10186769 3300031507 Bacteria 1930
337 Ga0265313_10000463 3300031595 Bacteria 42820
338 Ga0265313_10001355 3300031595 Bacteria 23078
339 Ga0265313_10163343 3300031595 Bacteria 945
340 Ga0265313_10349525 3300031595 Bacteria 586
341 Ga0316575_10318071 3300031665 Bacteria 660
342 Ga0265314_10002804 3300031711 Bacteria 17395
343 Ga0265314_10026291 3300031711 Bacteria 4374
344 Ga0265314_10046503 3300031711 Bacteria 3061
345 Ga0265342_10000448 3300031712 Bacteria 44982
346 Ga0265342_10000471 3300031712 Bacteria 43707
347 Ga0265342_10414017 3300031712 Bacteria 695
348 Ga0316576_10013287 3300031727 Bacteria 5465
349 Ga0316576_10015660 3300031727 Bacteria 5095
350 Ga0316576_10239576 3300031727 Bacteria 1363
351 Ga0316576_10544142 3300031727 Bacteria 851
352 Ga0307516_10005443 3300031730 Bacteria 15230
353 Ga0307516_10647953 3300031730 Bacteria 711
354 Ga0307407_10499792 3300031903 Bacteria 891
355 Ga0316053_102602 3300032120 Bacteria 1032
356 Ga0316593_10000059 3300032168 Bacteria 12661
357 Ga0316593_10004223 3300032168 Bacteria 3666
358 Ga0316593_10060312 3300032168 Unclassified 1296
359 Ga0316593_10103206 3300032168 Bacteria 1013
360 Ga0307507_10228329 3300033179 Bacteria 1239
361 Ga0316592_1001046 3300033524 Bacteria 4313
362 Ga0316592_1014236 3300033524 Bacteria 1647
363 Ga0316586_1043276 3300033527 Bacteria 796
364 Ga0316588_1000022 3300033528 Bacteria 11194
365 Ga0316587_1069510 3300033529 Unclassified 658
366 Ga0316596_1031277 3300033541 Bacteria 1382
367 Ga0373930_0201709 3300034816 Bacteria 518
368 Ga0373948_0070889 3300034817 Bacteria 781
369 Ga0373959_0003714 3300034820 Bacteria 2441
370 Ga0373926_0132953 3300035083 Bacteria 943
371 Ga0373926_0165608 3300035083 Bacteria 845
372 Ga0373926_0379546 3300035083 Bacteria 557
373 Ga0373934_0067801 3300035086 Bacteria 1425
374 Ga0373934_0091807 3300035086 Bacteria 1224
375 Ga0373944_0068621 3300035089 Bacteria 1151
376 Ga0373951_0142609 3300035091 Bacteria 666
377 Ga0373923_0017522 3300035111 Bacteria 2741
378 Ga0373953_0276069 3300035117 Bacteria 732
379 Ga0373954_0002392 3300035118 Bacteria 7857
380 Ga0373954_0520581 3300035118 Bacteria 589
381 Ga0373956_0064316 3300035119 Bacteria 1665
382 Ga0373956_0099252 3300035119 Bacteria 1349
383 Ga0373943_0142436 3300035170 Bacteria 1293
384 Ga0373943_0150267 3300035170 Bacteria 1261
385 Ga0373955_0018642 3300035172 Bacteria 3456
386 Ga0373955_0061959 3300035172 Bacteria 2067
387 Ga0373942_0182146 3300035207 Bacteria 689
388 Ga0316574_0039406 3300035398 Bacteria 2905
389 Ga0373924_0021925 3300035410 Bacteria 2493
390 Ga0373931_0028385 3300035691 Bacteria 2865
391 Ga0373935_0018778 3300035692 Bacteria 4212
392 Ga0373935_0125338 3300035692 Bacteria 1720
393 Ga0373935_0517305 3300035692 Bacteria 868
394 Ga0373935_0564651 3300035692 Bacteria 830
395 Ga0373935_0613347 3300035692 Bacteria 796
396 Ga0373927_0017276 3300035695 Bacteria 4749
397 Ga0373927_0195899 3300035695 Bacteria 1326
398 Ga0373927_0364974 3300035695 Bacteria 952
399 Ga0373927_0618975 3300035695 Bacteria 716
400 Ga0373927_0765615 3300035695 Bacteria 638
401 Ga0373927_0921002 3300035695 Bacteria 577
402 Ga0373933_0000858 3300035724 Bacteria 18640
403 Ga0373947_0029627 3300035725 Bacteria 3212
404 Ga0373947_0043754 3300035725 Bacteria 2675
405 Ga0373937_0001081 3300036401 Bacteria 22992
406 Ga0373937_0258653 3300036401 Bacteria 1641
407 Ga0373937_0533962 3300036401 Bacteria 1114
408 Ga0265778_045829 3300036457 Bacteria 590
409 Ga0310110_031531 3300036535 Bacteria 687
410 Ga0373925_0016615 3300037068 Bacteria 5332
411 Ga0373925_0095779 3300037068 Bacteria 2274
412 Ga0373925_0096148 3300037068 Bacteria 2270
413 Ga0395899_0177124 3300037312 Bacteria 1499
414 Ga0395900_0734024 3300037418 Bacteria 919
415 Ga0395898_0012209 3300037466 Bacteria 8885
416 Ga0395905_0000084 3300037471 Bacteria 158046
417 Ga0395905_0416315 3300037471 Bacteria 1240
418 Ga0436364_0156715 3300037853 Bacteria 2706
419 Ga0436364_1142589 3300037853 Bacteria 645
420 Ga0395901_0001925 3300038443 Bacteria 21375
421 Ga0400483_040814 3300039062 Bacteria 1182
422 Ga0436365_0348356 3300039437 Bacteria 1215
423 Ga0436360_0492388 3300039438 Bacteria 890
424 Ga0436360_0819959 3300039438 Bacteria 860
425 Ga0436361_0086433 3300039447 Bacteria 825
426 Ga0436361_0472363 3300039447 Bacteria 1001
427 Ga0436363_0172872 3300039450 Bacteria 603
428 Ga0436363_0554297 3300039450 Bacteria 1181
429 Ga0436363_0960112 3300039450 Bacteria 612
430 Ga0436363_1459501 3300039450 Bacteria 739
431 Ga0436362_1093814 3300039453 Bacteria 709
432 Ga0436362_1216827 3300039453 Bacteria 522
433 Ga0451802_0089247 3300041460 Bacteria 562
434 Ga0451805_064365 3300041461 Bacteria 1016
435 Ga0451841_0097283 3300041498 Bacteria 704
436 Ga0451851_0274901 3300041507 Bacteria 545
437 Ga0439448_0019235 3300042005 Bacteria 2100
438 Ga0451577_0000033 3300042876 Bacteria 378714
439 Ga0451577_0006345 3300042876 Bacteria 11810
440 Ga0451577_0011735 3300042876 Bacteria 8270
441 Ga0451577_0021568 3300042876 Bacteria 5892
442 Ga0451577_0022979 3300042876 Bacteria 5691
443 Ga0451577_0101691 3300042876 Bacteria 2568
444 Ga0451577_1026423 3300042876 Unclassified 740
445 Ga0451577_1335591 3300042876 Bacteria 637
446 Ga0466972_0434709 3300044658 Bacteria 616
447 Ga0453683_0009861 3300044673 Bacteria 6363
448 Ga0453683_0022862 3300044673 Bacteria 3986
449 Ga0453683_0342980 3300044673 Bacteria 959
450 Ga0453683_0451383 3300044673 Bacteria 831
451 Ga0466963_0560019 3300044694 Bacteria 807
452 Ga0466963_1063492 3300044694 Bacteria 569
453 Ga0453684_0000109 3300044712 Bacteria 361015
454 Ga0453684_0007468 3300044712 Bacteria 20074
455 Ga0453684_0021766 3300044712 Bacteria 9554
456 Ga0453684_0030174 3300044712 Bacteria 7667
457 Ga0453684_0045078 3300044712 Bacteria 5887
458 Ga0453684_0057007 3300044712 Bacteria 5063
459 Ga0453684_0086711 3300044712 Bacteria 3883
460 Ga0453684_0114376 3300044712 Bacteria 3271
461 Ga0453684_0175765 3300044712 Bacteria 2518
462 Ga0453684_0178772 3300044712 Bacteria 2493
463 Ga0453684_0321389 3300044712 Bacteria 1753
464 Ga0453684_0600656 3300044712 Bacteria 1206
465 Ga0453684_0991941 3300044712 Bacteria 894
466 Ga0453684_1228363 3300044712 Bacteria 785
467 Ga0453684_2036605 3300044712 Bacteria 577
468 Ga0453684_2053855 3300044712 Unclassified 574
469 Ga0451576_0005411 3300045051 Bacteria 16028
470 Ga0451576_0042025 3300045051 Bacteria 4827
471 Ga0451576_0116782 3300045051 Bacteria 2777
472 Ga0451576_0507389 3300045051 Bacteria 1267
473 Ga0466967_0859254 3300045976 Bacteria 902
474 Ga0495592_0004065 3300046454 Bacteria 10637
475 Ga0495592_0191353 3300046454 Bacteria 1386
476 Ga0495603_0130614 3300046455 Bacteria 1463
477 Ga0495603_0402195 3300046455 Bacteria 785
478 Ga0495629_0027091 3300046459 Bacteria 4071
479 Ga0495629_0105735 3300046459 Bacteria 1963
480 Ga0495651_0001400 3300046462 Bacteria 18698
481 Ga0495651_0095409 3300046462 Bacteria 2224
482 Ga0495653_0000370 3300046463 Bacteria 36284
483 Ga0495650_0030570 3300046471 Bacteria 2437
484 Ga0495582_0084464 3300046473 Bacteria 1765
485 Ga0495639_0013602 3300046475 Bacteria 3518
486 Ga0495662_0130214 3300046476 Bacteria 1237
487 Ga0495662_0285430 3300046476 Bacteria 812
488 Ga0495664_0154882 3300046477 Bacteria 1390
489 Ga0495664_0177335 3300046477 Bacteria 1292
490 Ga0495583_0000510 3300046506 Bacteria 55787
491 Ga0495606_0057236 3300046507 Bacteria 2511
492 Ga0495608_0077646 3300046511 Bacteria 2161
493 Ga0495608_0476609 3300046511 Bacteria 757
494 Ga0495618_0015533 3300046514 Bacteria 4647
495 Ga0495628_0014171 3300046516 Bacteria 6691
496 Ga0495628_0028002 3300046516 Bacteria 4582
497 Ga0495628_0547848 3300046516 Bacteria 831
498 Ga0495666_0087692 3300046526 Bacteria 1470
499 Ga0495666_0288961 3300046526 Bacteria 743
500 Ga0495652_0004294 3300046529 Bacteria 13663
501 Ga0495652_0058795 3300046529 Bacteria 3254
502 Ga0495652_0121026 3300046529 Bacteria 2088
503 Ga0495665_0098170 3300046531 Bacteria 1538
504 Ga0495640_0000769 3300046533 Bacteria 24154
505 Ga0495640_0286422 3300046533 Bacteria 1025
506 Ga0495586_0432835 3300046535 Bacteria 758
507 Ga0495586_0566406 3300046535 Bacteria 656
508 Ga0495587_0001283 3300046536 Bacteria 16691
509 Ga0495587_0076302 3300046536 Bacteria 1946
510 Ga0495587_0667780 3300046536 Bacteria 571
511 Ga0495645_0121611 3300046543 Bacteria 1837
512 Ga0495645_0462489 3300046543 Bacteria 798
513 Ga0495622_0142980 3300046557 Bacteria 1086
514 Ga0495667_0001440 3300046559 Bacteria 15673
515 Ga0495667_0077165 3300046559 Bacteria 2167
516 Ga0495668_0076671 3300046616 Bacteria 1835
517 Ga0495625_0071349 3300046660 Bacteria 2437
518 Ga0495635_0030116 3300046663 Bacteria 3772
519 Ga0495635_0206185 3300046663 Bacteria 1332
520 Ga0495635_0680112 3300046663 Bacteria 668
521 Ga0495657_0069542 3300046675 Bacteria 2303
522 Ga0495657_0073076 3300046675 Bacteria 2235
523 Ga0495599_0071441 3300046678 Bacteria 2166
524 Ga0495599_0118080 3300046678 Bacteria 1649
525 Ga0495623_0013044 3300046679 Bacteria 5382
526 Ga0495623_0056886 3300046679 Bacteria 2461
527 Ga0495623_0165314 3300046679 Bacteria 1297
528 Ga0495646_0010752 3300046680 Bacteria 5814
529 Ga0495646_0076284 3300046680 Bacteria 1963
530 Ga0495646_0199053 3300046680 Bacteria 1092
531 Ga0495647_0182064 3300046681 Bacteria 914
532 Ga0495658_0164017 3300046683 Bacteria 1372
533 Ga0495669_0068959 3300046684 Bacteria 1609
534 Ga0495613_0053483 3300046689 Bacteria 2971
535 Ga0495613_0242482 3300046689 Bacteria 1260
536 Ga0495624_0056635 3300046690 Bacteria 2466
537 Ga0495671_0070435 3300046692 Bacteria 1718
538 Ga0495649_0000961 3300046694 Bacteria 22764
539 Ga0495589_0004694 3300046794 Bacteria 7256
540 Ga0495600_0000422 3300046809 Bacteria 21824
541 Ga0495600_0073413 3300046809 Bacteria 2234
542 Ga0495604_0000406 3300047317 Bacteria 38847
543 Ga0495604_0200999 3300047317 Bacteria 1382
544 Ga0495674_0023413 3300047319 Bacteria 5692
545 Ga0495674_0382073 3300047319 Bacteria 1139
546 Ga0495676_0071144 3300047321 Bacteria 2675
547 Ga0495680_0001477 3300047322 Bacteria 25369
548 Ga0495680_0751124 3300047322 Bacteria 640
549 Ga0495683_0084411 3300047323 Bacteria 1545
550 Ga0495675_0036422 3300047444 Bacteria 3138
551 Ga0495675_0038770 3300047444 Bacteria 3034
552 Ga0495684_0002545 3300047471 Bacteria 14510
553 Ga0495684_0332917 3300047471 Bacteria 1082
554 Ga0495686_0024589 3300047472 Bacteria 3955
555 Ga0495593_0035738 3300047673 Bacteria 2696
556 Ga0495602_0010292 3300048088 Bacteria 9709
557 Ga0495602_0193078 3300048088 Bacteria 1559
558 Ga0495602_0947697 3300048088 Bacteria 570
559 Ga0496100_1463114 3300048903 Bacteria 539
560 Ga0496101_0013828 3300048904 Bacteria 5418
561 Ga0496101_0620526 3300048904 Bacteria 855
562 Ga0496102_0099626 3300048905 Bacteria 2698
563 Ga0496104_0056453 3300048907 Bacteria 3713
564 Ga0496104_0207951 3300048907 Bacteria 1869
565 Ga0496105_0091241 3300048908 Bacteria 2516
566 Ga0496105_0454067 3300048908 Bacteria 1011
567 Ga0496105_1138649 3300048908 Bacteria 577
568 Ga0496106_0013846 3300048909 Bacteria 5960
569 Ga0496106_0380462 3300048909 Bacteria 1134
570 Ga0496106_0407526 3300048909 Bacteria 1093
571 Ga0496107_0355208 3300048910 Bacteria 1090
572 Ga0496107_0935655 3300048910 Bacteria 631
573 Ga0496108_0310980 3300048911 Bacteria 1373
574 Ga0496108_0495908 3300048911 Bacteria 1067
575 Ga0496108_0537383 3300048911 Bacteria 1020
576 Ga0496108_1570015 3300048911 Bacteria 545
577 Ga0496109_0334595 3300048912 Bacteria 1430
578 Ga0496109_0709928 3300048912 Bacteria 943
579 Ga0496109_0789501 3300048912 Bacteria 888
580 Ga0496109_0946357 3300048912 Bacteria 799
581 Ga0496109_1767454 3300048912 Bacteria 552
582 Ga0496110_0275586 3300048913 Bacteria 1532
583 Ga0496110_1484199 3300048913 Bacteria 588
584 Ga0496112_0880532 3300048915 Bacteria 818
585 Ga0496113_1515888 3300048916 Bacteria 517
586 Ga0496114_0043566 3300048917 Bacteria 3721
587 Ga0496114_0831067 3300048917 Bacteria 803
588 Ga0496115_0073725 3300048918 Bacteria 2771
589 Ga0496115_0214760 3300048918 Bacteria 1588
590 Ga0496119_0007636 3300048922 Bacteria 9698
591 Ga0496126_0153375 3300048929 Bacteria 1973
592 Ga0496126_0402361 3300048929 Bacteria 1110
593 Ga0501306_074159 3300049127 Bacteria 578
594 Ga0501312_124053 3300049528 Bacteria 502
595 Ga0501034_0011194 3300049571 Bacteria 9312
596 Ga0501034_0062111 3300049571 Bacteria 3751
597 Ga0501034_0213455 3300049571 Bacteria 1884
598 Ga0501034_0929856 3300049571 Bacteria 756
599 Ga0501067_0012140 3300049583 Bacteria 4776
600 Ga0501067_0040594 3300049583 Bacteria 2584
601 Ga0501068_0011298 3300049584 Bacteria 5038
602 Ga0501068_0124575 3300049584 Bacteria 1608
603 Ga0501069_0120381 3300049585 Bacteria 1499
604 Ga0501071_0750483 3300049587 Bacteria 752
605 Ga0501072_1008839 3300049588 Bacteria 649
606 Ga0501073_0094048 3300049589 Bacteria 2082
607 Ga0501073_0109680 3300049589 Bacteria 1914
608 Ga0501073_0690583 3300049589 Bacteria 704
609 Ga0501074_0092370 3300049590 Bacteria 2167
610 Ga0501079_0982197 3300049741 Bacteria 665
611 Ga0501080_0068177 3300049742 Bacteria 3309
612 Ga0501080_0970474 3300049742 Bacteria 738
613 Ga0501081_0048650 3300049743 Bacteria 2918
614 Ga0501083_0086310 3300049744 Bacteria 2075
615 Ga0501035_0318618 3300049822 Bacteria 1307
616 Ga0501044_0242091 3300049823 Bacteria 1747
617 Ga0501044_0275193 3300049823 Bacteria 1618
618 Ga0501044_0653553 3300049823 Bacteria 940
619 nmdc:mga03683_154212_c1 3300050489 Bacteria 1038
620 nmdc:mga00v17_550791_c1 3300050491 Bacteria 746
621 nmdc:mga0k408_17468_c1 3300050493 Bacteria 3997
622 nmdc:mga0k408_18793_c1 3300050493 Bacteria 3859
623 nmdc:mga0k408_3994_c1 3300050493 Bacteria 7820
624 nmdc:mga07m45_2618_c1 3300050496 Bacteria 8478
625 nmdc:mga05p37_1557282_c1 3300050507 Bacteria 654
626 nmdc:mga09592_418985_c1 3300050508 Bacteria 1157
627 nmdc:mga0qj67_773324_c1 3300050509 Bacteria 761
628 nmdc:mga08y16_112266_c1 3300050511 Bacteria 2837
629 nmdc:mga08y16_918900_c1 3300050511 Bacteria 860
630 nmdc:mga0n895_324307_c1 3300050512 Bacteria 1561
631 nmdc:mga0rr50_119161_c1 3300050513 Bacteria 2098
632 nmdc:mga08x19_81325_c1 3300050514 Bacteria 2127
633 nmdc:mga0a205_1230022_c1 3300050515 Bacteria 597
634 nmdc:mga0sz30_58732_c1 3300050516 Bacteria 1640
635 Ga0495601_0013011 3300053077 Bacteria 4998
636 Ga0495601_0288764 3300053077 Bacteria 1069
637 Ga0495601_0779406 3300053077 Bacteria 607
638 Ga0495612_0001890 3300053078 Bacteria 8615
639 Ga0495612_0182693 3300053078 Bacteria 922
640 Ga0500635_0000036 3300053080 Bacteria 94740
641 Ga0495595_0000821 3300053084 Bacteria 11875
642 Ga0495595_0019353 3300053084 Bacteria 2953
643 Ga0495619_0000352 3300053085 Bacteria 32130
644 Ga0495619_0444844 3300053085 Bacteria 893
645 Ga0495619_1028864 3300053085 Bacteria 550
646 Ga0500651_0272510 3300053093 Bacteria 978
647 Ga0500641_0033682 3300053096 Bacteria 2035
648 Ga0500594_0012196 3300053118 Bacteria 2021
649 Ga0500607_134777 3300053121 Bacteria 1172
650 Ga0500608_273900 3300053122 Bacteria 643
651 Ga0500559_0110294 3300053136 Bacteria 1274
652 Ga0500589_148106 3300053147 Bacteria 959
653 Ga0500604_0327222 3300053151 Bacteria 532
654 Ga0500630_193628 3300053159 Bacteria 801
655 Ga0500638_161624 3300053162 Bacteria 985
656 Ga0500639_339252 3300053163 Bacteria 539
657 Ga0500636_0105188 3300053177 Bacteria 1600
658 Ga0500636_0230069 3300053177 Bacteria 960
659 Ga0587084_005438 3300059477 Bacteria 1508
660 Ga0587084_139095 3300059477 Bacteria 525
661 Ga0587093_010602 3300059478 Bacteria 1090
662 Ga0587066_006963 3300059490 Bacteria 1514
663 Ga0587066_060549 3300059490 Bacteria 771
664 Ga0587070_003113 3300059491 Bacteria 1958
665 Ga0587070_198311 3300059491 Bacteria 532
666 Ga0587073_0001947 3300059492 Bacteria 2553
667 Ga0587073_0101802 3300059492 Bacteria 748
668 Ga0587073_0250411 3300059492 Bacteria 555
669 Ga0587077_124834 3300059493 Bacteria 646
670 Ga0587080_004286 3300059503 Bacteria 1841
671 Ga0587080_159338 3300059503 Bacteria 528
672 Ga0587082_032816 3300059504 Bacteria 914
673 Ga0587082_129963 3300059504 Bacteria 578
674 Ga0587083_0000179 3300059505 Bacteria 4486
675 Ga0587083_0073253 3300059505 Bacteria 800
676 Ga0587083_0240818 3300059505 Bacteria 535
677 Ga0587085_034481 3300059506 Bacteria 850
678 Ga0587086_055568 3300059507 Bacteria 648
679 Ga0587088_043631 3300059508 Bacteria 854
680 Ga0587088_079546 3300059508 Bacteria 699
681 Ga0587088_096516 3300059508 Bacteria 655
682 Ga0587089_012402 3300059509 Bacteria 1088
683 Ga0587089_070146 3300059509 Bacteria 594
684 Ga0587090_020013 3300059510 Bacteria 1038
685 Ga0587090_115900 3300059510 Bacteria 576
686 Ga0587090_168558 3300059510 Bacteria 506
687 Ga0587092_009469 3300059512 Bacteria 1311
688 Ga0587094_012127 3300059513 Bacteria 1146
689 Ga0587098_024966 3300059604 Bacteria 787
690 Ga0587106_055892 3300059605 Bacteria 712
691 Ga0587125_020912 3300059607 Bacteria 772
692 Ga0587099_014844 3300059622 Bacteria 826
693 Ga0587109_009123 3300059624 Bacteria 1550
694 Ga0587109_015181 3300059624 Bacteria 1303
695 Ga0587113_018370 3300059625 Bacteria 716
696 Ga0587128_000534 3300059630 Bacteria 2891
697 Ga0587062_025654 3300059639 Bacteria 869
698 Ga0587067_000404 3300059640 Bacteria 3694
699 Ga0587068_023032 3300059641 Bacteria 1035
700 Ga0587068_129323 3300059641 Bacteria 555
701 Ga0587072_001614 3300059643 Bacteria 2844
702 Ga0587076_009651 3300059645 Bacteria 1375
703 Ga0587078_003507 3300059646 Bacteria 1595
704 Ga0587100_005857 3300059648 Bacteria 929
705 Ga0587102_010689 3300059649 Bacteria 911
706 Ga0587104_004395 3300059650 Bacteria 901
707 Ga0587105_001974 3300059651 Bacteria 1127
708 Ga0587107_000941 3300059652 Bacteria 2179
709 Ga0587107_007297 3300059652 Bacteria 1240
710 Ga0587116_12521 3300059656 Bacteria 588
711 Ga0587118_01471 3300059657 Bacteria 1427
712 Ga0587124_019230 3300059660 Bacteria 686
713 Ga0587071_004987 3300060344 Bacteria 2008
714 Ga0587071_070077 3300060344 Bacteria 762
715 2523107254 2522572158 Bacteria 6514390
716 2643746677 2643221544 Bacteria 5886209
717 2644131946 2643221623 Bacteria 5239945
718 2644256830 2643221646 Bacteria 6433402
719 2723879664 2721755763 Bacteria 4464185
720 2739309064 2738543024 Bacteria 5603683
721 2837679884 2837678835 Bacteria 5252418
722 2889793650 2889790730 Bacteria 5689708
723 2889919552 2889914905 Bacteria 5702301
724 2891050840 2891048133 Bacteria 4447501
725 2891092405 2891088606 Bacteria 4762464
726 2909400002 2909399089 Bacteria 3922598
727 8002061420 8002060224 Bacteria 4026565
728 Ga0182008_10123030
729 JGI24735J21928_10180060
730 JGI25156J39149_1048087
731 JGI25154J39366_1000593
732 JGI25157J39369_1001134
733 Ga0007410J51695_1090156
734 Ga0007416J51690_1044706
735 Ga0055539_1002928
736 Ga0055533_1000043
737 Ga0055525_1000641
738 Ga0055535_1000420
739 Ga0055529_1000322
740 JGI25405J52794_10006418
741 Ga0058859_11395877
742 Ga0058859_11499848
743 Ga0058861_11919994
744 Ga0058860_12155775
745 Ga0070658_10660472
746 Ga0070683_102333734
747 Ga0070690_100111170
748 Ga0070670_100171189
749 Ga0068869_100100346
750 Ga0068869_101805685
751 Ga0070666_10086429
752 Ga0070680_101578527
753 Ga0068868_100616452
754 Ga0070689_100198876
755 Ga0070691_10257636
756 Ga0070687_100028209
757 Ga0070687_101046781
758 Ga0070661_100211043
759 Ga0070675_100605768
760 Ga0070671_100003486
761 Ga0070673_100110053
762 Ga0070688_100330669
763 Ga0070659_100203963
764 Ga0070659_100721941
765 Ga0070709_10015699
766 Ga0070709_10572376
767 Ga0070714_100024965
768 Ga0070713_100011844
769 Ga0070710_10003492
770 Ga0070710_10078215
771 Ga0070711_100028081
772 Ga0070711_100302792
773 Ga0070694_100052832
774 Ga0070663_100757558
775 Ga0070662_100102710
776 Ga0070662_101647757
777 Ga0068867_100484225
778 Ga0070685_10615579
779 Ga0070679_100269034
780 Ga0070684_100516613
781 Ga0070684_100721945
782 Ga0070684_101169908
783 Ga0068853_100293022
784 Ga0070672_100558846
785 Ga0070672_101453073
786 Ga0070686_100447851
787 Ga0070686_101297527
788 Ga0070695_100021458
789 Ga0070696_100582636
790 Ga0070696_101733063
791 Ga0070693_100589413
792 Ga0068855_100534661
793 Ga0070664_100235185
794 Ga0068854_100023136
795 Ga0068856_100149077
796 Ga0068856_100256499
797 Ga0070702_100277676
798 Ga0068864_100714314
799 Ga0068864_100991110
800 Ga0068861_100152994
801 Ga0068851_10162545
802 Ga0068863_100662454
803 Ga0068858_100848223
804 Ga0068860_100217691
805 Ga0068860_100671474
806 Ga0081538_10120554
807 Ga0081540_1003020
808 Ga0081539_10046287
809 Ga0070717_10166904
810 Ga0075363_100028810
811 Ga0075364_10020585
812 Ga0075364_10324752
813 Ga0070715_10014729
814 Ga0070715_10304664
815 Ga0070716_100038933
816 Ga0070716_101106925
817 Ga0070712_100004635
818 Ga0070712_100013564
819 Ga0070712_100197997
820 Ga0075367_10660157
821 Ga0075366_10000795
822 Ga0075366_10018750
823 Ga0075366_10211595
824 Ga0097621_100289575
825 Ga0075370_10011014
826 Ga0068871_100165726
827 Ga0075428_100601252
828 Ga0075429_100137036
829 Ga0068865_102092155
830 Ga0075436_100109455
831 Ga0105250_10257088
832 Ga0105240_11571470
833 Ga0105240_11739249
834 Ga0111539_10077885
835 Ga0111539_10340819
836 Ga0105245_10580509
837 Ga0114129_10722753
838 Ga0105243_10249883
839 Ga0105241_10079232
840 Ga0105241_10288877
841 Ga0105242_11364451
842 Ga0105248_11347305
843 Ga0105248_11835400
844 Ga0105237_10051839
845 Ga0105237_10211706
846 Ga0105237_10390119
847 Ga0105237_10895092
848 Ga0105237_12247333
849 Ga0105238_10205025
850 Ga0105238_10237854
851 Ga0105238_10957271
852 Ga0105249_10323671
853 Ga0105249_10648792
854 Ga0105249_12672687
855 Ga0105239_10623881
856 Ga0105239_11647301
857 Ga0105239_11768370
858 Ga0105239_12212956
859 Ga0105246_11610726
860 Ga0157369_10034850
861 Ga0157369_10388715
862 Ga0157369_10885588
863 Ga0157374_10036137
864 Ga0157374_11702013
865 Ga0157378_10129245
866 Ga0157378_12931055
867 Ga0163162_10411533
868 Ga0163162_11598988
869 Ga0157372_10189020
870 Ga0157372_10950203
871 Ga0157372_11272619
872 Ga0163163_10477985
873 Ga0182008_10155033
874 Ga0182008_10202882
875 Ga0182008_10445012
876 Ga0157379_10056467
877 Ga0157379_10241188
878 Ga0157376_10622730
879 Ga0182006_1173195
880 Ga0184602_128378
881 Ga0184603_115845
882 Ga0197907_11204008
883 Ga0206356_10333002
884 Ga0206356_10880351
885 Ga0206356_10973081
886 Ga0206349_1471409
887 Ga0206355_1182367
888 Ga0206355_1569053
889 Ga0206351_10919874
890 Ga0206352_10996423
891 Ga0206350_10273521
892 Ga0206354_10721124
893 Ga0206354_11216635
894 Ga0206353_11465831
895 Ga0154015_1148978
896 Ga0154015_1457285
897 Ga0213872_10135020
898 Ga0213872_10302772
899 Ga0213874_10160717
900 Ga0213874_10196931
901 Ga0213874_10248759
902 Ga0213876_10420360
903 Ga0213875_10455529
904 Ga0224712_10020260
905 Ga0224712_10453857
906 Ga0224712_10485922
907 Ga0247552_101829
908 Ga0228598_1000416
909 Ga0209674_100067
910 Ga0209672_106433
911 Ga0209563_100068
912 Ga0207427_100260
913 Ga0209258_100342
914 Ga0209258_100554
915 Ga0209646_1000127
916 Ga0209026_1000004
917 Ga0209677_100201
918 Ga0209148_1005675
919 Ga0209759_1000129
920 Ga0209759_1027374
921 Ga0209455_1000083
922 Ga0209676_1000092
923 Ga0209050_1007590
924 Ga0207692_10020862
925 Ga0207647_10143184
926 Ga0207685_10014999
927 Ga0207685_10330104
928 Ga0207685_10372724
929 Ga0207685_10390681
930 Ga0207699_10005995
931 Ga0207699_10440398
932 Ga0207699_11094209
933 Ga0207645_10289237
934 Ga0207705_10381815
935 Ga0207654_10132215
936 Ga0207707_10408317
937 Ga0207695_10105714
938 Ga0207695_10712542
939 Ga0207671_10051341
940 Ga0207671_10338814
941 Ga0207693_10018098
942 Ga0207693_10021188
943 Ga0207693_10027985
944 Ga0207693_10251745
945 Ga0207693_10394248
946 Ga0207663_10114880
947 Ga0207663_10206117
948 Ga0207663_10712037
949 Ga0207660_11275158
950 Ga0207662_10031400
951 Ga0207662_11309525
952 Ga0207657_11494476
953 Ga0207649_10312084
954 Ga0207652_10375413
955 Ga0207681_11431145
956 Ga0207694_10083671
957 Ga0207694_10205510
958 Ga0207694_10830323
959 Ga0207694_10943332
960 Ga0207659_10042382
961 Ga0207659_10825108
962 Ga0207687_10197952
963 Ga0207687_10344140
964 Ga0207700_10239003
965 Ga0207700_10572137
966 Ga0207664_10044723
967 Ga0207664_10298575
968 Ga0207644_10006009
969 Ga0207644_11365041
970 Ga0207690_10059045
971 Ga0207690_10082583
972 Ga0207706_10191401
973 Ga0207706_11658156
974 Ga0207686_10618594
975 Ga0207709_10715401
976 Ga0207670_10079487
977 Ga0207670_11169556
978 Ga0207665_10012672
979 Ga0207665_10305191
980 Ga0207691_10087732
981 Ga0207711_10951667
982 Ga0207711_11101606
983 Ga0207689_10025393
984 Ga0207661_10370299
985 Ga0207679_10040130
986 Ga0207667_10588076
987 Ga0207651_10019963
988 Ga0207640_10023477
989 Ga0207677_11237641
990 Ga0207639_10449647
991 Ga0207639_10804740
992 Ga0207678_10143467
993 Ga0207678_11432391
994 Ga0207702_10001875
995 Ga0207702_10237817
996 Ga0207641_10020044
997 Ga0207641_11133079
998 Ga0207676_10876069
999 Ga0207676_11006898
1000 Ga0207674_10004293
1001 Ga0207675_100219937
1002 Ga0207698_10064301
1003 Ga0210000_1053731
1004 Ga0207428_10271194
1005 Ga0268264_10182306
1006 Ga0268264_10829898
1007 Ga0265319_1077434
1008 Ga0265319_1138665
1009 Ga0265319_1152469
1010 Ga0265334_10120299
1011 Ga0265318_10000273
1012 Ga0265318_10001387
1013 Ga0265318_10028950
1014 Ga0265322_10230541
1015 Ga0265336_10000028
1016 Ga0307515_10450121
1017 Ga0265338_10145149
1018 Ga0307511_10051346
1019 Ga0265769_101828
1020 Ga0265760_10080711
1021 Ga0265330_10000998
1022 Ga0265330_10059999
1023 Ga0265330_10279046
1024 Ga0265330_10286466
1025 Ga0265332_10000280
1026 Ga0265332_10002691
1027 Ga0265332_10214300
1028 Ga0265328_10010978
1029 Ga0265328_10016001
1030 Ga0265328_10032488
1031 Ga0265328_10032994
1032 Ga0265328_10127622
1033 Ga0265320_10000485
1034 Ga0265320_10054588
1035 Ga0265320_10141966
1036 Ga0265320_10406698
1037 Ga0265325_10001575
1038 Ga0265325_10061357
1039 Ga0265325_10410898
1040 Ga0265329_10000013
1041 Ga0265329_10028096
1042 Ga0265329_10054803
1043 Ga0265340_10000189
1044 Ga0265340_10002589
1045 Ga0265340_10004541
1046 Ga0265340_10016859
1047 Ga0265340_10019984
1048 Ga0265340_10219713
1049 Ga0265340_10310168
1050 Ga0265339_10008773
1051 Ga0265339_10017456
1052 Ga0265339_10092846
1053 Ga0265339_10229158
1054 Ga0265339_10242742
1055 Ga0265331_10002207
1056 Ga0265331_10012161
1057 Ga0265331_10059653
1058 Ga0265327_10001331
1059 Ga0265316_10001048
1060 Ga0265316_10002957
1061 Ga0265316_10063600
1062 Ga0265316_10082839
1063 Ga0307509_10186769
1064 Ga0265313_10000463
1065 Ga0265313_10001355
1066 Ga0265313_10163343
1067 Ga0265313_10349525
1068 Ga0316575_10318071
1069 Ga0265314_10002804
1070 Ga0265314_10026291
1071 Ga0265314_10046503
1072 Ga0265342_10000448
1073 Ga0265342_10000471
1074 Ga0265342_10414017
1075 Ga0316576_10013287
1076 Ga0316576_10015660
1077 Ga0316576_10239576
1078 Ga0316576_10544142
1079 Ga0307516_10005443
1080 Ga0307516_10647953
1081 Ga0307407_10499792
1082 Ga0316053_102602
1083 Ga0316593_10000059
1084 Ga0316593_10004223
1085 Ga0316593_10060312
1086 Ga0316593_10103206
1087 Ga0307507_10228329
1088 Ga0316592_1001046
1089 Ga0316592_1014236
1090 Ga0316586_1043276
1091 Ga0316588_1000022
1092 Ga0316587_1069510
1093 Ga0316596_1031277
1094 Ga0373930_0201709
1095 Ga0373948_0070889
1096 Ga0373959_0003714
1097 Ga0373926_0132953
1098 Ga0373926_0165608
1099 Ga0373926_0379546
1100 Ga0373934_0067801
1101 Ga0373934_0091807
1102 Ga0373944_0068621
1103 Ga0373951_0142609
1104 Ga0373923_0017522
1105 Ga0373953_0276069
1106 Ga0373954_0002392
1107 Ga0373954_0520581
1108 Ga0373956_0064316
1109 Ga0373956_0099252
1110 Ga0373943_0142436
1111 Ga0373943_0150267
1112 Ga0373955_0018642
1113 Ga0373955_0061959
1114 Ga0373942_0182146
1115 Ga0316574_0039406
1116 Ga0373924_0021925
1117 Ga0373931_0028385
1118 Ga0373935_0018778
1119 Ga0373935_0125338
1120 Ga0373935_0517305
1121 Ga0373935_0564651
1122 Ga0373935_0613347
1123 Ga0373927_0017276
1124 Ga0373927_0195899
1125 Ga0373927_0364974
1126 Ga0373927_0618975
1127 Ga0373927_0765615
1128 Ga0373927_0921002
1129 Ga0373933_0000858
1130 Ga0373947_0029627
1131 Ga0373947_0043754
1132 Ga0373937_0001081
1133 Ga0373937_0258653
1134 Ga0373937_0533962
1135 Ga0265778_045829
1136 Ga0310110_031531
1137 Ga0373925_0016615
1138 Ga0373925_0095779
1139 Ga0373925_0096148
1140 Ga0395899_0177124
1141 Ga0395900_0734024
1142 Ga0395898_0012209
1143 Ga0395905_0000084
1144 Ga0395905_0416315
1145 Ga0436364_0156715
1146 Ga0436364_1142589
1147 Ga0395901_0001925
1148 Ga0400483_040814
1149 Ga0436365_0348356
1150 Ga0436360_0492388
1151 Ga0436360_0819959
1152 Ga0436361_0086433
1153 Ga0436361_0472363
1154 Ga0436363_0172872
1155 Ga0436363_0554297
1156 Ga0436363_0960112
1157 Ga0436363_1459501
1158 Ga0436362_1093814
1159 Ga0436362_1216827
1160 Ga0451802_0089247
1161 Ga0451805_064365
1162 Ga0451841_0097283
1163 Ga0451851_0274901
1164 Ga0439448_0019235
1165 Ga0451577_0000033
1166 Ga0451577_0006345
1167 Ga0451577_0011735
1168 Ga0451577_0021568
1169 Ga0451577_0022979
1170 Ga0451577_0101691
1171 Ga0451577_1026423
1172 Ga0451577_1335591
1173 Ga0466972_0434709
1174 Ga0453683_0009861
1175 Ga0453683_0022862
1176 Ga0453683_0342980
1177 Ga0453683_0451383
1178 Ga0466963_0560019
1179 Ga0466963_1063492
1180 Ga0453684_0000109
1181 Ga0453684_0007468
1182 Ga0453684_0021766
1183 Ga0453684_0030174
1184 Ga0453684_0045078
1185 Ga0453684_0057007
1186 Ga0453684_0086711
1187 Ga0453684_0114376
1188 Ga0453684_0175765
1189 Ga0453684_0178772
1190 Ga0453684_0321389
1191 Ga0453684_0600656
1192 Ga0453684_0991941
1193 Ga0453684_1228363
1194 Ga0453684_2036605
1195 Ga0453684_2053855
1196 Ga0451576_0005411
1197 Ga0451576_0042025
1198 Ga0451576_0116782
1199 Ga0451576_0507389
1200 Ga0466967_0859254
1201 Ga0495592_0004065
1202 Ga0495592_0191353
1203 Ga0495603_0130614
1204 Ga0495603_0402195
1205 Ga0495629_0027091
1206 Ga0495629_0105735
1207 Ga0495651_0001400
1208 Ga0495651_0095409
1209 Ga0495653_0000370
1210 Ga0495650_0030570
1211 Ga0495582_0084464
1212 Ga0495639_0013602
1213 Ga0495662_0130214
1214 Ga0495662_0285430
1215 Ga0495664_0154882
1216 Ga0495664_0177335
1217 Ga0495583_0000510
1218 Ga0495606_0057236
1219 Ga0495608_0077646
1220 Ga0495608_0476609
1221 Ga0495618_0015533
1222 Ga0495628_0014171
1223 Ga0495628_0028002
1224 Ga0495628_0547848
1225 Ga0495666_0087692
1226 Ga0495666_0288961
1227 Ga0495652_0004294
1228 Ga0495652_0058795
1229 Ga0495652_0121026
1230 Ga0495665_0098170
1231 Ga0495640_0000769
1232 Ga0495640_0286422
1233 Ga0495586_0432835
1234 Ga0495586_0566406
1235 Ga0495587_0001283
1236 Ga0495587_0076302
1237 Ga0495587_0667780
1238 Ga0495645_0121611
1239 Ga0495645_0462489
1240 Ga0495622_0142980
1241 Ga0495667_0001440
1242 Ga0495667_0077165
1243 Ga0495668_0076671
1244 Ga0495625_0071349
1245 Ga0495635_0030116
1246 Ga0495635_0206185
1247 Ga0495635_0680112
1248 Ga0495657_0069542
1249 Ga0495657_0073076
1250 Ga0495599_0071441
1251 Ga0495599_0118080
1252 Ga0495623_0013044
1253 Ga0495623_0056886
1254 Ga0495623_0165314
1255 Ga0495646_0010752
1256 Ga0495646_0076284
1257 Ga0495646_0199053
1258 Ga0495647_0182064
1259 Ga0495658_0164017
1260 Ga0495669_0068959
1261 Ga0495613_0053483
1262 Ga0495613_0242482
1263 Ga0495624_0056635
1264 Ga0495671_0070435
1265 Ga0495649_0000961
1266 Ga0495589_0004694
1267 Ga0495600_0000422
1268 Ga0495600_0073413
1269 Ga0495604_0000406
1270 Ga0495604_0200999
1271 Ga0495674_0023413
1272 Ga0495674_0382073
1273 Ga0495676_0071144
1274 Ga0495680_0001477
1275 Ga0495680_0751124
1276 Ga0495683_0084411
1277 Ga0495675_0036422
1278 Ga0495675_0038770
1279 Ga0495684_0002545
1280 Ga0495684_0332917
1281 Ga0495686_0024589
1282 Ga0495593_0035738
1283 Ga0495602_0010292
1284 Ga0495602_0193078
1285 Ga0495602_0947697
1286 Ga0496100_1463114
1287 Ga0496101_0013828
1288 Ga0496101_0620526
1289 Ga0496102_0099626
1290 Ga0496104_0056453
1291 Ga0496104_0207951
1292 Ga0496105_0091241
1293 Ga0496105_0454067
1294 Ga0496105_1138649
1295 Ga0496106_0013846
1296 Ga0496106_0380462
1297 Ga0496106_0407526
1298 Ga0496107_0355208
1299 Ga0496107_0935655
1300 Ga0496108_0310980
1301 Ga0496108_0495908
1302 Ga0496108_0537383
1303 Ga0496108_1570015
1304 Ga0496109_0334595
1305 Ga0496109_0709928
1306 Ga0496109_0789501
1307 Ga0496109_0946357
1308 Ga0496109_1767454
1309 Ga0496110_0275586
1310 Ga0496110_1484199
1311 Ga0496112_0880532
1312 Ga0496113_1515888
1313 Ga0496114_0043566
1314 Ga0496114_0831067
1315 Ga0496115_0073725
1316 Ga0496115_0214760
1317 Ga0496119_0007636
1318 Ga0496126_0153375
1319 Ga0496126_0402361
1320 Ga0501306_074159
1321 Ga0501312_124053
1322 Ga0501034_0011194
1323 Ga0501034_0062111
1324 Ga0501034_0213455
1325 Ga0501034_0929856
1326 Ga0501067_0012140
1327 Ga0501067_0040594
1328 Ga0501068_0011298
1329 Ga0501068_0124575
1330 Ga0501069_0120381
1331 Ga0501071_0750483
1332 Ga0501072_1008839
1333 Ga0501073_0094048
1334 Ga0501073_0109680
1335 Ga0501073_0690583
1336 Ga0501074_0092370
1337 Ga0501079_0982197
1338 Ga0501080_0068177
1339 Ga0501080_0970474
1340 Ga0501081_0048650
1341 Ga0501083_0086310
1342 Ga0501035_0318618
1343 Ga0501044_0242091
1344 Ga0501044_0275193
1345 Ga0501044_0653553
1346 nmdc:mga03683_154212_c1
1347 nmdc:mga00v17_550791_c1
1348 nmdc:mga0k408_17468_c1
1349 nmdc:mga0k408_18793_c1
1350 nmdc:mga0k408_3994_c1
1351 nmdc:mga07m45_2618_c1
1352 nmdc:mga05p37_1557282_c1
1353 nmdc:mga09592_418985_c1
1354 nmdc:mga0qj67_773324_c1
1355 nmdc:mga08y16_112266_c1
1356 nmdc:mga08y16_918900_c1
1357 nmdc:mga0n895_324307_c1
1358 nmdc:mga0rr50_119161_c1
1359 nmdc:mga08x19_81325_c1
1360 nmdc:mga0a205_1230022_c1
1361 nmdc:mga0sz30_58732_c1
1362 Ga0495601_0013011
1363 Ga0495601_0288764
1364 Ga0495601_0779406
1365 Ga0495612_0001890
1366 Ga0495612_0182693
1367 Ga0500635_0000036
1368 Ga0495595_0000821
1369 Ga0495595_0019353
1370 Ga0495619_0000352
1371 Ga0495619_0444844
1372 Ga0495619_1028864
1373 Ga0500651_0272510
1374 Ga0500641_0033682
1375 Ga0500594_0012196
1376 Ga0500607_134777
1377 Ga0500608_273900
1378 Ga0500559_0110294
1379 Ga0500589_148106
1380 Ga0500604_0327222
1381 Ga0500630_193628
1382 Ga0500638_161624
1383 Ga0500639_339252
1384 Ga0500636_0105188
1385 Ga0500636_0230069
1386 Ga0587084_005438
1387 Ga0587084_139095
1388 Ga0587093_010602
1389 Ga0587066_006963
1390 Ga0587066_060549
1391 Ga0587070_003113
1392 Ga0587070_198311
1393 Ga0587073_0001947
1394 Ga0587073_0101802
1395 Ga0587073_0250411
1396 Ga0587077_124834
1397 Ga0587080_004286
1398 Ga0587080_159338
1399 Ga0587082_032816
1400 Ga0587082_129963
1401 Ga0587083_0000179
1402 Ga0587083_0073253
1403 Ga0587083_0240818
1404 Ga0587085_034481
1405 Ga0587086_055568
1406 Ga0587088_043631
1407 Ga0587088_079546
1408 Ga0587088_096516
1409 Ga0587089_012402
1410 Ga0587089_070146
1411 Ga0587090_020013
1412 Ga0587090_115900
1413 Ga0587090_168558
1414 Ga0587092_009469
1415 Ga0587094_012127
1416 Ga0587098_024966
1417 Ga0587106_055892
1418 Ga0587125_020912
1419 Ga0587099_014844
1420 Ga0587109_009123
1421 Ga0587109_015181
1422 Ga0587113_018370
1423 Ga0587128_000534
1424 Ga0587062_025654
1425 Ga0587067_000404
1426 Ga0587068_023032
1427 Ga0587068_129323
1428 Ga0587072_001614
1429 Ga0587076_009651
1430 Ga0587078_003507
1431 Ga0587100_005857
1432 Ga0587102_010689
1433 Ga0587104_004395
1434 Ga0587105_001974
1435 Ga0587107_000941
1436 Ga0587107_007297
1437 Ga0587116_12521
1438 Ga0587118_01471
1439 Ga0587124_019230
1440 Ga0587071_004987
1441 Ga0587071_070077
1442 2523107254
1443 2643746677
1444 2644131946
1445 2644256830
1446 2723879664
1447 2739309064
1448 2837679884
1449 2889793650
1450 2889919552
1451 2891050840
1452 2891092405
1453 2909400002
1454 8002061420

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00416

Ribosomal_S13

Ribosomal protein S13/S18

23

129

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mqa-assembly1.cif.gz_L3 cryo-em structure of the human ssu processome, state post-a1 0.9713 3 61
6zqf-assembly1.cif.gz_DS cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-b (poly-ala) 0.9668 3 61
6zqg-assembly1.cif.gz_DS cryo-em structure of the 90s pre-ribosome from saccharomyces cerevisiae, state dis-c 0.9413 3 61
6rbd-assembly1.cif.gz_S state 1 of yeast tsr1-tap rps20-deltaloop pre-40s particles 0.934 3 61
1l1z-assembly1.cif.gz_A mutm (fpg) covalent-dna intermediate 0.9202 30 58
ID Description Score Start End Superfamily
af_P54019_1_77_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9786 3 61 1.10.8.50
af_A0A1D8PQQ5_1_82_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9747 3 61 1.10.8.50
af_Q8HCP0_1_71_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9693 4 70 1.10.8.50
1i94M01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.9669 14 63 1.10.8.50
af_Q2FW30_1_70_1.10.8.50 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3; 0.966 1 70 1.10.8.50
ID Description Score Start End GO Terms
AF-A0A436DSH1-F1-model_v4 30S ribosomal protein S13 1.003 1 66 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935
AF-A0A533J219-F1-model_v4 deleted 0.9937 1 58
AF-A0A7C1JM66-F1-model_v4 30S ribosomal protein S13 0.9927 1 60 GO:0003723
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A6B0CFM2-F1-model_v4 30S ribosomal protein S13 0.9919 1 60 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7C4MPL7-F1-model_v4 30S ribosomal protein S13 0.9879 1 66 GO:0003723
GO:0003735
GO:0005829
GO:0006412
GO:0015935

Map