F477806
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 728 | 375 | 1456 | 419 |
Family's Representative Sequence
| Representative Sequence | 3300025923|Ga0207681_10016898|Ga0207681_100168983 |
| Length | 455 |
| Sequence | MARPPGSGSSGQAIHGPGVRGRSGRLVGVRSARGPSAMPAGTLLYAQSGGVTAVINATASAVIAEARARKVKVFAARNGILGALREELIDTSKESAAAIRALAHTPGGAFGSCRVKLKSLDADRGRYERLLAVLRAHDVRWFLYNGGNDSADTANKVSKLAAEFGYPLTCIGVPKTVDNDLAVTDCCPGFGSAAKYTAVSVREAALDVAAMAETSTKVFVYEAMGRHAGWLAAAAGLAGRTADDAPHLILFPERPYDEADFLARVGKIVARVGYCVVVASEGIQTADGKFVADAGAGSDSFGHTQLGGVASFLAGRVKDALGMKVHWTLPDYLQRSARHLASKTDVEQALAVGKAAVRLALAGRNATMPVIVRTADKPYRWKIAEAKLDDVANREKKMPPGFIRKDGYGITAAARSYLEPLIRGEAPPPYGRDGLPAYVALKNVAVKKKLPAWAG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 9 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 11 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 12 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 13 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 31 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 32 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 33 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 65 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 90 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 92 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 108 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 109 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 112 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 115 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 171 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 172 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 173 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 174 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 175 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 176 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 177 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 178 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 179 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 182 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 183 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 184 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 185 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 188 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 189 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 190 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 191 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 192 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 193 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 194 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 195 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 202 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 203 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 204 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 205 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 206 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 207 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 208 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 209 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 210 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 211 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 212 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 213 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 255 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 256 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 257 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 258 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 261 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 287 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 294 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 295 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 296 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 297 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 298 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 299 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 302 | 2524614729 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 303 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 304 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 305 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 306 | 2593339238 | Luteibacter sp. UNCMF366Tsu5.1 | Isolate | Unclassified |
| 307 | 2593339239 | Luteibacter sp. UNCMF331Sha3.1 | Isolate | Unclassified |
| 308 | 2627854209 | Arenimonas oryziterrae YC6267, DSM 21050 | Isolate | Rhizosphere |
| 309 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 310 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 311 | 2643221579 | Pseudoxanthomonas sp. Root630 | Isolate | Unclassified |
| 312 | 2643221581 | Pseudoxanthomonas sp. Root65 | Isolate | Unclassified |
| 313 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 314 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 315 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 316 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 317 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 318 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 319 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 320 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 321 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 322 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 323 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 324 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 325 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 326 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 327 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 328 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 329 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 330 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 331 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 332 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 333 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 334 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 335 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 336 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 337 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 338 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 339 | 2894414249 | Luteimonas sp. LNNU 24178 | Isolate | Rhizosphere |
| 340 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 341 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 342 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 343 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 344 | 2919085039 | Luteibacter sp. 1214 | Isolate | Unclassified |
| 345 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 346 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 347 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 348 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 349 | 2919513703 | Luteimonas sp. 3794 | Isolate | Unclassified |
| 350 | 2919675420 | Luteimonas terrae 4099 | Isolate | Unclassified |
| 351 | 2923516293 | Pseudoxanthomonas mexicana SLBN-89 | Isolate | Rhizosphere |
| 352 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 353 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 354 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 355 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 356 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 357 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 358 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 359 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 360 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 361 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 362 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 363 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 364 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 365 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 366 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 367 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 368 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 369 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 370 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 371 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 372 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
| 373 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 374 | 8021626552 | Xanthomonas sp. LMG12460 | Isolate | Rhizosphere |
| 375 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.74 |
| Metatranscriptomes | 1.1 |
| Isolates | 10.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.14 |
| Bulb | 0 |
| Endosphere | 17.31 |
| Nodule | 0.14 |
| Rhizoplane | 2.34 |
| Rhizosphere | 64.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207681_10016898 | 3300025923 | Bacteria | 4575 |
| 2 | SwRhRL2b_contig_1053233 | 2162886007 | Bacteria | 3250 |
| 3 | SwRhRL2b_contig_1073745 | 2162886007 | Bacteria | 6170 |
| 4 | JGI24741J21665_1007320 | 3300001915 | Bacteria | 2148 |
| 5 | JGI24735J21928_10000400 | 3300002067 | Bacteria | 15108 |
| 6 | JGI24738J21930_10001530 | 3300002075 | Bacteria | 6384 |
| 7 | JGI25156J39149_1004995 | 3300002705 | Bacteria | 3917 |
| 8 | JGI25162J39368_1000239 | 3300002737 | Bacteria | 54751 |
| 9 | JGI25157J39369_1000720 | 3300002741 | Bacteria | 17683 |
| 10 | JGI25164J39214_1000200 | 3300002772 | Bacteria | 50877 |
| 11 | JGI25164J39214_1000605 | 3300002772 | Bacteria | 15553 |
| 12 | JGI25152J39213_1000057 | 3300002773 | Bacteria | 75426 |
| 13 | JGI25150J39212_1000150 | 3300002774 | Bacteria | 39306 |
| 14 | JGI25151J46595_10000109 | 3300003187 | Bacteria | 112044 |
| 15 | JGI25151J46595_10000118 | 3300003187 | Bacteria | 106502 |
| 16 | JGI25165J46597_1000319 | 3300003214 | Bacteria | 57885 |
| 17 | JGI25153J46596_10000084 | 3300003215 | Bacteria | 112044 |
| 18 | Ga0006554J51385_1037292 | 3300003567 | Bacteria | 1295 |
| 19 | Ga0006562J51391_1035852 | 3300003578 | Bacteria | 12060 |
| 20 | Ga0006562J51391_1035855 | 3300003578 | Bacteria | 1380 |
| 21 | Ga0055539_1001249 | 3300003752 | Bacteria | 5101 |
| 22 | Ga0055533_1002005 | 3300003756 | Bacteria | 4957 |
| 23 | Ga0055533_1004847 | 3300003756 | Bacteria | 2314 |
| 24 | Ga0055527_1000331 | 3300003760 | Bacteria | 25227 |
| 25 | Ga0055535_1000242 | 3300003761 | Bacteria | 57885 |
| 26 | Ga0055535_1000715 | 3300003761 | Bacteria | 25227 |
| 27 | Ga0055542_1000298 | 3300003762 | Bacteria | 55290 |
| 28 | Ga0055542_1000741 | 3300003762 | Bacteria | 25227 |
| 29 | Ga0055529_1000437 | 3300003763 | Bacteria | 41881 |
| 30 | Ga0055529_1000648 | 3300003763 | Bacteria | 25227 |
| 31 | Ga0055526_1000082 | 3300003771 | Bacteria | 87106 |
| 32 | Ga0055526_1009936 | 3300003771 | Bacteria | 4502 |
| 33 | Ga0055537_1000228 | 3300003773 | Bacteria | 41108 |
| 34 | Ga0055537_1000526 | 3300003773 | Bacteria | 22324 |
| 35 | Ga0055537_1002379 | 3300003773 | Bacteria | 6363 |
| 36 | Ga0055537_1003609 | 3300003773 | Bacteria | 4706 |
| 37 | Ga0055524_1000138 | 3300003775 | Bacteria | 87106 |
| 38 | Ga0055524_1010765 | 3300003775 | Bacteria | 3619 |
| 39 | Ga0055536_1001681 | 3300003781 | Bacteria | 13113 |
| 40 | Ga0055536_1002692 | 3300003781 | Bacteria | 9861 |
| 41 | Ga0055536_1002705 | 3300003781 | Bacteria | 9838 |
| 42 | Ga0055536_1018107 | 3300003781 | Bacteria | 2271 |
| 43 | Ga0055534_1000056 | 3300003784 | Bacteria | 87106 |
| 44 | Ga0055534_1000121 | 3300003784 | Bacteria | 57849 |
| 45 | Ga0055528_1000061 | 3300003790 | Bacteria | 87106 |
| 46 | Ga0055528_1000148 | 3300003790 | Bacteria | 57842 |
| 47 | Ga0055530_10000618 | 3300003791 | Bacteria | 30889 |
| 48 | Ga0055530_10001089 | 3300003791 | Bacteria | 21346 |
| 49 | Ga0055530_10007041 | 3300003791 | Bacteria | 4836 |
| 50 | Ga0055531_10002801 | 3300003794 | Bacteria | 11433 |
| 51 | Ga0055531_10012704 | 3300003794 | Bacteria | 3936 |
| 52 | Ga0055531_10021543 | 3300003794 | Bacteria | 2495 |
| 53 | Ga0055531_10024411 | 3300003794 | Bacteria | 2232 |
| 54 | Ga0055531_10027325 | 3300003794 | Bacteria | 2006 |
| 55 | Ga0058692_1000013 | 3300003856 | Bacteria | 316299 |
| 56 | Ga0058692_1000045 | 3300003856 | Bacteria | 115083 |
| 57 | Ga0065165_1000887 | 3300005262 | Bacteria | 38644 |
| 58 | Ga0065704_10074566 | 3300005289 | Bacteria | 6181 |
| 59 | Ga0065704_10077370 | 3300005289 | Bacteria | 4752 |
| 60 | Ga0070658_10007494 | 3300005327 | Bacteria | 8806 |
| 61 | Ga0070658_10225831 | 3300005327 | Bacteria | 1584 |
| 62 | Ga0070676_10028577 | 3300005328 | Bacteria | 3168 |
| 63 | Ga0070670_100008187 | 3300005331 | Bacteria | 8902 |
| 64 | Ga0070670_100236672 | 3300005331 | Bacteria | 1589 |
| 65 | Ga0070666_10000082 | 3300005335 | Bacteria | 68562 |
| 66 | Ga0070666_10105244 | 3300005335 | Bacteria | 1948 |
| 67 | Ga0070680_100002369 | 3300005336 | Bacteria | 13928 |
| 68 | Ga0070680_100007340 | 3300005336 | Bacteria | 8407 |
| 69 | Ga0070680_100054184 | 3300005336 | Bacteria | 3274 |
| 70 | Ga0070660_100225558 | 3300005339 | Bacteria | 1524 |
| 71 | Ga0070689_100016007 | 3300005340 | Bacteria | 5483 |
| 72 | Ga0070691_10019838 | 3300005341 | Bacteria | 3103 |
| 73 | Ga0070661_100132961 | 3300005344 | Bacteria | 1870 |
| 74 | Ga0070661_100139754 | 3300005344 | Bacteria | 1824 |
| 75 | Ga0070668_100003260 | 3300005347 | Bacteria | 11969 |
| 76 | Ga0070668_100022562 | 3300005347 | Bacteria | 4759 |
| 77 | Ga0070668_100121805 | 3300005347 | Bacteria | 2086 |
| 78 | Ga0070671_100106817 | 3300005355 | Bacteria | 2350 |
| 79 | Ga0070671_100108444 | 3300005355 | Bacteria | 2332 |
| 80 | Ga0070667_100000049 | 3300005367 | Bacteria | 158483 |
| 81 | Ga0070667_100005927 | 3300005367 | Bacteria | 10173 |
| 82 | Ga0070667_100043089 | 3300005367 | Bacteria | 3787 |
| 83 | Ga0070714_100001179 | 3300005435 | Bacteria | 18812 |
| 84 | Ga0070711_100141624 | 3300005439 | Bacteria | 1804 |
| 85 | Ga0070663_100029791 | 3300005455 | Bacteria | 3734 |
| 86 | Ga0070663_100039763 | 3300005455 | Bacteria | 3289 |
| 87 | Ga0070678_100012380 | 3300005456 | Bacteria | 5299 |
| 88 | Ga0070681_10000484 | 3300005458 | Bacteria | 32437 |
| 89 | Ga0070681_10000534 | 3300005458 | Bacteria | 31253 |
| 90 | Ga0070681_10016654 | 3300005458 | Bacteria | 7338 |
| 91 | Ga0070679_100000571 | 3300005530 | Bacteria | 31258 |
| 92 | Ga0070679_100001635 | 3300005530 | Bacteria | 20192 |
| 93 | Ga0070679_100011025 | 3300005530 | Bacteria | 8594 |
| 94 | Ga0070679_100015323 | 3300005530 | Bacteria | 7366 |
| 95 | Ga0068853_100002452 | 3300005539 | Bacteria | 13881 |
| 96 | Ga0068853_100039875 | 3300005539 | Bacteria | 4006 |
| 97 | Ga0068853_100170234 | 3300005539 | Bacteria | 1970 |
| 98 | Ga0070672_100030579 | 3300005543 | Bacteria | 4047 |
| 99 | Ga0070672_100055265 | 3300005543 | Bacteria | 3110 |
| 100 | Ga0070696_100048086 | 3300005546 | Bacteria | 2960 |
| 101 | Ga0070696_100048090 | 3300005546 | Bacteria | 2960 |
| 102 | Ga0070693_100021970 | 3300005547 | Bacteria | 3386 |
| 103 | Ga0070693_100024780 | 3300005547 | Bacteria | 3222 |
| 104 | Ga0070665_100000028 | 3300005548 | Bacteria | 351357 |
| 105 | Ga0070665_100030082 | 3300005548 | Bacteria | 5464 |
| 106 | Ga0070665_100053199 | 3300005548 | Bacteria | 4060 |
| 107 | Ga0068855_100008568 | 3300005563 | Bacteria | 12365 |
| 108 | Ga0070664_100068581 | 3300005564 | Bacteria | 3032 |
| 109 | Ga0070664_100105137 | 3300005564 | Bacteria | 2458 |
| 110 | Ga0068857_100046813 | 3300005577 | Bacteria | 3838 |
| 111 | Ga0068857_100127717 | 3300005577 | Bacteria | 2291 |
| 112 | Ga0068856_100013243 | 3300005614 | Bacteria | 7987 |
| 113 | Ga0068852_100006366 | 3300005616 | Bacteria | 8528 |
| 114 | Ga0068860_100076943 | 3300005843 | Bacteria | 3173 |
| 115 | Ga0068860_100087722 | 3300005843 | Bacteria | 2962 |
| 116 | Ga0068862_100000215 | 3300005844 | Bacteria | 64251 |
| 117 | Ga0081540_1004974 | 3300005983 | Bacteria | 9993 |
| 118 | Ga0081539_10012422 | 3300005985 | Bacteria | 6565 |
| 119 | Ga0075364_10001706 | 3300006051 | Bacteria | 12075 |
| 120 | Ga0075364_10047836 | 3300006051 | Bacteria | 2787 |
| 121 | Ga0075369_10008855 | 3300006186 | Bacteria | 3889 |
| 122 | Ga0097621_100037463 | 3300006237 | Bacteria | 3885 |
| 123 | Ga0068871_100060646 | 3300006358 | Bacteria | 3086 |
| 124 | Ga0105251_10006095 | 3300009011 | Bacteria | 7764 |
| 125 | Ga0105251_10008644 | 3300009011 | Bacteria | 6106 |
| 126 | Ga0105244_10019129 | 3300009036 | Bacteria | 3830 |
| 127 | Ga0105244_10024400 | 3300009036 | Bacteria | 3301 |
| 128 | Ga0105244_10041213 | 3300009036 | Bacteria | 2393 |
| 129 | Ga0105240_10002481 | 3300009093 | Bacteria | 29651 |
| 130 | Ga0105240_10034520 | 3300009093 | Bacteria | 6523 |
| 131 | Ga0105240_10117805 | 3300009093 | Bacteria | 3201 |
| 132 | Ga0105240_10143850 | 3300009093 | Bacteria | 2848 |
| 133 | Ga0105245_10160528 | 3300009098 | Bacteria | 2133 |
| 134 | Ga0105245_10168283 | 3300009098 | Bacteria | 2085 |
| 135 | Ga0105247_10004712 | 3300009101 | Bacteria | 8693 |
| 136 | Ga0105241_10089015 | 3300009174 | Bacteria | 2432 |
| 137 | Ga0105242_10116648 | 3300009176 | Bacteria | 2284 |
| 138 | Ga0105238_10009665 | 3300009551 | Bacteria | 9652 |
| 139 | Ga0105238_10123451 | 3300009551 | Bacteria | 2569 |
| 140 | Ga0105238_10274005 | 3300009551 | Bacteria | 1668 |
| 141 | Ga0105239_10001637 | 3300010375 | Bacteria | 29547 |
| 142 | Ga0105239_10040173 | 3300010375 | Bacteria | 5125 |
| 143 | Ga0105239_10105472 | 3300010375 | Bacteria | 3121 |
| 144 | Ga0105239_10205338 | 3300010375 | Bacteria | 2208 |
| 145 | Ga0157371_10000184 | 3300013102 | Bacteria | 92100 |
| 146 | Ga0157371_10037971 | 3300013102 | Bacteria | 3446 |
| 147 | Ga0157370_10006151 | 3300013104 | Bacteria | 13317 |
| 148 | Ga0157370_10007352 | 3300013104 | Bacteria | 12015 |
| 149 | Ga0157370_10021551 | 3300013104 | Bacteria | 6420 |
| 150 | Ga0157370_10032654 | 3300013104 | Bacteria | 5082 |
| 151 | Ga0157370_10036214 | 3300013104 | Bacteria | 4790 |
| 152 | Ga0157370_10081183 | 3300013104 | Bacteria | 3052 |
| 153 | Ga0157369_10021566 | 3300013105 | Bacteria | 7205 |
| 154 | Ga0157369_10097397 | 3300013105 | Bacteria | 3138 |
| 155 | Ga0157378_10066474 | 3300013297 | Bacteria | 3229 |
| 156 | Ga0163162_10020366 | 3300013306 | Bacteria | 6517 |
| 157 | Ga0163162_10053837 | 3300013306 | Bacteria | 4045 |
| 158 | Ga0157372_10005781 | 3300013307 | Bacteria | 13174 |
| 159 | Ga0157372_10029020 | 3300013307 | Bacteria | 6036 |
| 160 | Ga0157372_10041430 | 3300013307 | Bacteria | 5092 |
| 161 | Ga0157372_10278022 | 3300013307 | Bacteria | 1946 |
| 162 | Ga0182008_10000473 | 3300014497 | Bacteria | 30750 |
| 163 | Ga0182008_10008140 | 3300014497 | Bacteria | 5738 |
| 164 | Ga0182008_10013637 | 3300014497 | Bacteria | 4270 |
| 165 | Ga0182008_10055826 | 3300014497 | Bacteria | 1952 |
| 166 | Ga0157379_10115658 | 3300014968 | Bacteria | 2411 |
| 167 | Ga0157379_10356893 | 3300014968 | Bacteria | 1339 |
| 168 | Ga0157376_10048547 | 3300014969 | Bacteria | 3511 |
| 169 | Ga0157376_10365257 | 3300014969 | Bacteria | 1385 |
| 170 | Ga0182006_1000461 | 3300015261 | Bacteria | 31892 |
| 171 | Ga0182006_1001147 | 3300015261 | Bacteria | 16817 |
| 172 | Ga0182006_1011101 | 3300015261 | Bacteria | 3978 |
| 173 | Ga0182006_1013092 | 3300015261 | Bacteria | 3610 |
| 174 | Ga0182006_1020517 | 3300015261 | Bacteria | 2768 |
| 175 | Ga0182006_1023914 | 3300015261 | Bacteria | 2527 |
| 176 | Ga0182006_1038452 | 3300015261 | Bacteria | 1892 |
| 177 | Ga0182007_10000118 | 3300015262 | Bacteria | 54536 |
| 178 | Ga0182007_10013264 | 3300015262 | Bacteria | 3148 |
| 179 | Ga0182005_1000999 | 3300015265 | Bacteria | 12169 |
| 180 | Ga0182005_1001072 | 3300015265 | Bacteria | 11527 |
| 181 | Ga0182005_1001074 | 3300015265 | Bacteria | 11526 |
| 182 | Ga0182005_1001234 | 3300015265 | Bacteria | 10590 |
| 183 | Ga0182005_1001964 | 3300015265 | Bacteria | 7725 |
| 184 | Ga0183368_1007 | 3300015687 | Bacteria | 405609 |
| 185 | Ga0183360_10003 | 3300015689 | Bacteria | 713221 |
| 186 | Ga0163161_10000766 | 3300017792 | Bacteria | 25292 |
| 187 | Ga0163161_10000891 | 3300017792 | Bacteria | 23193 |
| 188 | Ga0163161_10018430 | 3300017792 | Bacteria | 4892 |
| 189 | Ga0163161_10021086 | 3300017792 | Bacteria | 4579 |
| 190 | Ga0206356_10628665 | 3300020070 | Bacteria | 2829 |
| 191 | Ga0206356_11804033 | 3300020070 | Bacteria | 2601 |
| 192 | Ga0206354_10819979 | 3300020081 | Bacteria | 2619 |
| 193 | Ga0206354_11580386 | 3300020081 | Bacteria | 2784 |
| 194 | Ga0224712_10027171 | 3300022467 | Bacteria | 2033 |
| 195 | Ga0209435_101970 | 3300025206 | Bacteria | 2473 |
| 196 | Ga0209760_100623 | 3300025207 | Bacteria | 6034 |
| 197 | Ga0209784_100163 | 3300025224 | Bacteria | 57927 |
| 198 | Ga0209674_100037 | 3300025226 | Bacteria | 404339 |
| 199 | Ga0209674_100058 | 3300025226 | Bacteria | 286902 |
| 200 | Ga0209674_101812 | 3300025226 | Bacteria | 5118 |
| 201 | Ga0209672_100061 | 3300025228 | Bacteria | 206098 |
| 202 | Ga0209672_102507 | 3300025228 | Bacteria | 4432 |
| 203 | Ga0209147_106306 | 3300025229 | Bacteria | 1657 |
| 204 | Ga0207427_100196 | 3300025231 | Bacteria | 57937 |
| 205 | Ga0209437_100345 | 3300025233 | Bacteria | 54531 |
| 206 | Ga0209437_100894 | 3300025233 | Bacteria | 12005 |
| 207 | Ga0209258_100054 | 3300025242 | Bacteria | 339063 |
| 208 | Ga0209258_100384 | 3300025242 | Bacteria | 56539 |
| 209 | Ga0209258_100514 | 3300025242 | Bacteria | 37294 |
| 210 | Ga0207425_1000045 | 3300025245 | Bacteria | 194257 |
| 211 | Ga0209646_1004443 | 3300025246 | Bacteria | 2554 |
| 212 | Ga0209026_1000286 | 3300025250 | Bacteria | 57937 |
| 213 | Ga0209026_1009861 | 3300025250 | Bacteria | 1833 |
| 214 | Ga0209677_101425 | 3300025253 | Bacteria | 10326 |
| 215 | Ga0209148_1000047 | 3300025254 | Bacteria | 434369 |
| 216 | Ga0209148_1000066 | 3300025254 | Bacteria | 339063 |
| 217 | Ga0209148_1000912 | 3300025254 | Bacteria | 19949 |
| 218 | Ga0209759_1001948 | 3300025256 | Bacteria | 9984 |
| 219 | Ga0209129_1000057 | 3300025258 | Bacteria | 253632 |
| 220 | Ga0209129_1000331 | 3300025258 | Bacteria | 41001 |
| 221 | Ga0209233_1000100 | 3300025261 | Bacteria | 293905 |
| 222 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 223 | Ga0209565_1000023 | 3300025263 | Bacteria | 388244 |
| 224 | Ga0209565_1004811 | 3300025263 | Bacteria | 4039 |
| 225 | Ga0209455_1000101 | 3300025272 | Bacteria | 206098 |
| 226 | Ga0209455_1000270 | 3300025272 | Bacteria | 57937 |
| 227 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 228 | Ga0209673_1000047 | 3300025273 | Bacteria | 289276 |
| 229 | Ga0209673_1005603 | 3300025273 | Bacteria | 6275 |
| 230 | Ga0209130_1008264 | 3300025284 | Bacteria | 3090 |
| 231 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 232 | Ga0209675_1000016 | 3300025291 | Bacteria | 391965 |
| 233 | Ga0209675_1008593 | 3300025291 | Bacteria | 3728 |
| 234 | Ga0209676_1000027 | 3300025292 | Bacteria | 560222 |
| 235 | Ga0209676_1000037 | 3300025292 | Bacteria | 457562 |
| 236 | Ga0209676_1000160 | 3300025292 | Bacteria | 161069 |
| 237 | Ga0209676_1000796 | 3300025292 | Bacteria | 41705 |
| 238 | Ga0209676_1000830 | 3300025292 | Bacteria | 40120 |
| 239 | Ga0209676_1003891 | 3300025292 | Bacteria | 8704 |
| 240 | Ga0209025_1000013 | 3300025294 | Bacteria | 871757 |
| 241 | Ga0209025_1000200 | 3300025294 | Bacteria | 146048 |
| 242 | Ga0209025_1007913 | 3300025294 | Bacteria | 7783 |
| 243 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 244 | Ga0209564_1000194 | 3300025295 | Bacteria | 141518 |
| 245 | Ga0209564_1003164 | 3300025295 | Bacteria | 11586 |
| 246 | Ga0209758_1000014 | 3300025297 | Bacteria | 871757 |
| 247 | Ga0209758_1014135 | 3300025297 | Bacteria | 4275 |
| 248 | Ga0209758_1018063 | 3300025297 | Bacteria | 3477 |
| 249 | Ga0209758_1023548 | 3300025297 | Bacteria | 2781 |
| 250 | Ga0209050_1000462 | 3300025298 | Bacteria | 72638 |
| 251 | Ga0209050_1000971 | 3300025298 | Bacteria | 36685 |
| 252 | Ga0209050_1002489 | 3300025298 | Bacteria | 15573 |
| 253 | Ga0209050_1011478 | 3300025298 | Bacteria | 4192 |
| 254 | Ga0209050_1034076 | 3300025298 | Bacteria | 1531 |
| 255 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 256 | Ga0209256_1001572 | 3300025299 | Bacteria | 22464 |
| 257 | Ga0209256_1002300 | 3300025299 | Bacteria | 16021 |
| 258 | Ga0209256_1010730 | 3300025299 | Bacteria | 3784 |
| 259 | Ga0207426_1003250 | 3300025302 | Bacteria | 9107 |
| 260 | Ga0209051_1004177 | 3300025303 | Bacteria | 9022 |
| 261 | Ga0209051_1005461 | 3300025303 | Bacteria | 7418 |
| 262 | Ga0209051_1008798 | 3300025303 | Bacteria | 5293 |
| 263 | Ga0209257_1000046 | 3300025304 | Bacteria | 477765 |
| 264 | Ga0209257_1000091 | 3300025304 | Bacteria | 270637 |
| 265 | Ga0209257_1000177 | 3300025304 | Bacteria | 161069 |
| 266 | Ga0209257_1000499 | 3300025304 | Bacteria | 70103 |
| 267 | Ga0209257_1002803 | 3300025304 | Bacteria | 16393 |
| 268 | Ga0209257_1003235 | 3300025304 | Bacteria | 14334 |
| 269 | Ga0209257_1021122 | 3300025304 | Bacteria | 2377 |
| 270 | Ga0207713_1006743 | 3300025735 | Bacteria | 6933 |
| 271 | Ga0207713_1017270 | 3300025735 | Bacteria | 3627 |
| 272 | Ga0207710_10002997 | 3300025900 | Bacteria | 7626 |
| 273 | Ga0207680_10000003 | 3300025903 | Bacteria | 925264 |
| 274 | Ga0207647_10000130 | 3300025904 | Bacteria | 58985 |
| 275 | Ga0207647_10002143 | 3300025904 | Bacteria | 15080 |
| 276 | Ga0207647_10011433 | 3300025904 | Bacteria | 6225 |
| 277 | Ga0207647_10034228 | 3300025904 | Bacteria | 3245 |
| 278 | Ga0207645_10085680 | 3300025907 | Bacteria | 2023 |
| 279 | Ga0207705_10000400 | 3300025909 | Bacteria | 38159 |
| 280 | Ga0207705_10001982 | 3300025909 | Bacteria | 15917 |
| 281 | Ga0207705_10004563 | 3300025909 | Bacteria | 10460 |
| 282 | Ga0207705_10049895 | 3300025909 | Bacteria | 3012 |
| 283 | Ga0207705_10186261 | 3300025909 | Bacteria | 1568 |
| 284 | Ga0207707_10000020 | 3300025912 | Bacteria | 205480 |
| 285 | Ga0207707_10003170 | 3300025912 | Bacteria | 14597 |
| 286 | Ga0207707_10012604 | 3300025912 | Bacteria | 7346 |
| 287 | Ga0207707_10035320 | 3300025912 | Bacteria | 4371 |
| 288 | Ga0207695_10001663 | 3300025913 | Bacteria | 35807 |
| 289 | Ga0207695_10002173 | 3300025913 | Bacteria | 29659 |
| 290 | Ga0207695_10028244 | 3300025913 | Bacteria | 6226 |
| 291 | Ga0207695_10041475 | 3300025913 | Bacteria | 4927 |
| 292 | Ga0207695_10242399 | 3300025913 | Bacteria | 1704 |
| 293 | Ga0207660_10000726 | 3300025917 | Bacteria | 21921 |
| 294 | Ga0207660_10000950 | 3300025917 | Bacteria | 19197 |
| 295 | Ga0207660_10005901 | 3300025917 | Bacteria | 7956 |
| 296 | Ga0207660_10039120 | 3300025917 | Bacteria | 3314 |
| 297 | Ga0207660_10065311 | 3300025917 | Bacteria | 2629 |
| 298 | Ga0207657_10014239 | 3300025919 | Bacteria | 7774 |
| 299 | Ga0207657_10026757 | 3300025919 | Bacteria | 5293 |
| 300 | Ga0207657_10141840 | 3300025919 | Bacteria | 1963 |
| 301 | Ga0207649_10005191 | 3300025920 | Bacteria | 7035 |
| 302 | Ga0207649_10008579 | 3300025920 | Bacteria | 5576 |
| 303 | Ga0207649_10079274 | 3300025920 | Bacteria | 2121 |
| 304 | Ga0207649_10100528 | 3300025920 | Bacteria | 1913 |
| 305 | Ga0207652_10000037 | 3300025921 | Bacteria | 134369 |
| 306 | Ga0207652_10000753 | 3300025921 | Bacteria | 31143 |
| 307 | Ga0207652_10002384 | 3300025921 | Bacteria | 15874 |
| 308 | Ga0207652_10012358 | 3300025921 | Bacteria | 6899 |
| 309 | Ga0207652_10012736 | 3300025921 | Bacteria | 6799 |
| 310 | Ga0207652_10115855 | 3300025921 | Bacteria | 2380 |
| 311 | Ga0207694_10001777 | 3300025924 | Bacteria | 18014 |
| 312 | Ga0207694_10040592 | 3300025924 | Bacteria | 3583 |
| 313 | Ga0207694_10093456 | 3300025924 | Bacteria | 2375 |
| 314 | Ga0207694_10103780 | 3300025924 | Bacteria | 2255 |
| 315 | Ga0207650_10129227 | 3300025925 | Bacteria | 1975 |
| 316 | Ga0207664_10000856 | 3300025929 | Bacteria | 20600 |
| 317 | Ga0207690_10000657 | 3300025932 | Bacteria | 22118 |
| 318 | Ga0207690_10033037 | 3300025932 | Bacteria | 3324 |
| 319 | Ga0207690_10048257 | 3300025932 | Bacteria | 2830 |
| 320 | Ga0207709_10007956 | 3300025935 | Bacteria | 5875 |
| 321 | Ga0207691_10018245 | 3300025940 | Bacteria | 6647 |
| 322 | Ga0207691_10071615 | 3300025940 | Bacteria | 3128 |
| 323 | Ga0207661_10004484 | 3300025944 | Bacteria | 9791 |
| 324 | Ga0207667_10000633 | 3300025949 | Bacteria | 45505 |
| 325 | Ga0207667_10019918 | 3300025949 | Bacteria | 7475 |
| 326 | Ga0207667_10081769 | 3300025949 | Bacteria | 3346 |
| 327 | Ga0207667_10129844 | 3300025949 | Bacteria | 2595 |
| 328 | Ga0207667_10216350 | 3300025949 | Bacteria | 1963 |
| 329 | Ga0207640_10001068 | 3300025981 | Bacteria | 15187 |
| 330 | Ga0207658_10004314 | 3300025986 | Bacteria | 9902 |
| 331 | Ga0207639_10003456 | 3300026041 | Bacteria | 10631 |
| 332 | Ga0207639_10004090 | 3300026041 | Bacteria | 9839 |
| 333 | Ga0207639_10095816 | 3300026041 | Bacteria | 2386 |
| 334 | Ga0207678_10007384 | 3300026067 | Bacteria | 9730 |
| 335 | Ga0207678_10199694 | 3300026067 | Bacteria | 1710 |
| 336 | Ga0207678_10211547 | 3300026067 | Bacteria | 1659 |
| 337 | Ga0207702_10001784 | 3300026078 | Bacteria | 21201 |
| 338 | Ga0207702_10003564 | 3300026078 | Bacteria | 14163 |
| 339 | Ga0207702_10004508 | 3300026078 | Bacteria | 12357 |
| 340 | Ga0207641_10055975 | 3300026088 | Bacteria | 3350 |
| 341 | Ga0207648_10045518 | 3300026089 | Bacteria | 3849 |
| 342 | Ga0207674_10042443 | 3300026116 | Bacteria | 4697 |
| 343 | Ga0207674_10104040 | 3300026116 | Bacteria | 2818 |
| 344 | Ga0207683_10022177 | 3300026121 | Bacteria | 5450 |
| 345 | Ga0207683_10098701 | 3300026121 | Bacteria | 2606 |
| 346 | Ga0207698_10000844 | 3300026142 | Bacteria | 17776 |
| 347 | Ga0207698_10010069 | 3300026142 | Bacteria | 6055 |
| 348 | Ga0207698_10096317 | 3300026142 | Bacteria | 2438 |
| 349 | Ga0209371_1000007 | 3300027312 | Bacteria | 1050654 |
| 350 | Ga0209371_1000043 | 3300027312 | Bacteria | 331009 |
| 351 | Ga0209969_1003965 | 3300027360 | Bacteria | 2062 |
| 352 | Ga0209995_1005763 | 3300027471 | Bacteria | 1991 |
| 353 | Ga0209999_1000892 | 3300027543 | Bacteria | 4997 |
| 354 | Ga0209982_1002226 | 3300027552 | Bacteria | 2713 |
| 355 | Ga0209983_1001615 | 3300027665 | Bacteria | 4992 |
| 356 | Ga0209971_1003771 | 3300027682 | Bacteria | 3584 |
| 357 | Ga0209974_10008710 | 3300027876 | Bacteria | 3458 |
| 358 | Ga0268266_10000017 | 3300028379 | Bacteria | 607272 |
| 359 | Ga0268266_10001303 | 3300028379 | Bacteria | 30308 |
| 360 | Ga0268265_10002016 | 3300028380 | Bacteria | 15950 |
| 361 | Ga0268265_10040381 | 3300028380 | Bacteria | 3446 |
| 362 | Ga0268265_10064291 | 3300028380 | Bacteria | 2826 |
| 363 | Ga0268264_10071166 | 3300028381 | Bacteria | 2946 |
| 364 | Ga0268256_1000008 | 3300030500 | Bacteria | 1050654 |
| 365 | Ga0268256_1000044 | 3300030500 | Bacteria | 330997 |
| 366 | Ga0316176_1021304 | 3300030732 | Bacteria | 6206 |
| 367 | Ga0314311_1061056 | 3300030733 | Bacteria | 4109 |
| 368 | Ga0316182_1116479 | 3300030745 | Bacteria | 2007 |
| 369 | Ga0307513_10023179 | 3300031456 | Bacteria | 7261 |
| 370 | Ga0316575_10006346 | 3300031665 | Bacteria | 4244 |
| 371 | Ga0316579_10001744 | 3300031691 | Bacteria | 7995 |
| 372 | Ga0307413_10015817 | 3300031824 | Bacteria | 3877 |
| 373 | Ga0307413_10166906 | 3300031824 | Bacteria | 1553 |
| 374 | Ga0307406_10002976 | 3300031901 | Bacteria | 9237 |
| 375 | Ga0307406_10032774 | 3300031901 | Bacteria | 3174 |
| 376 | Ga0307412_10001279 | 3300031911 | Bacteria | 14087 |
| 377 | Ga0307412_10016904 | 3300031911 | Bacteria | 4358 |
| 378 | Ga0307416_100171282 | 3300032002 | Bacteria | 2021 |
| 379 | Ga0307414_10011174 | 3300032004 | Bacteria | 5253 |
| 380 | Ga0307414_10015898 | 3300032004 | Bacteria | 4558 |
| 381 | Ga0307414_10020978 | 3300032004 | Bacteria | 4085 |
| 382 | Ga0316583_10000604 | 3300032133 | Bacteria | 10925 |
| 383 | Ga0307507_10101030 | 3300033179 | Bacteria | 2414 |
| 384 | Ga0307510_10006141 | 3300033180 | Bacteria | 14318 |
| 385 | Ga0316582_0005132 | 3300036647 | Bacteria | 6700 |
| 386 | Ga0395899_0000410 | 3300037312 | Bacteria | 50063 |
| 387 | Ga0395899_0041522 | 3300037312 | Bacteria | 3437 |
| 388 | Ga0395900_0000206 | 3300037418 | Bacteria | 92782 |
| 389 | Ga0395900_0000656 | 3300037418 | Bacteria | 46333 |
| 390 | Ga0395900_0006056 | 3300037418 | Bacteria | 12613 |
| 391 | Ga0395900_0118044 | 3300037418 | Bacteria | 2722 |
| 392 | Ga0395898_0000120 | 3300037466 | Bacteria | 209091 |
| 393 | Ga0395905_0007372 | 3300037471 | Bacteria | 10948 |
| 394 | Ga0316581_0002944 | 3300037588 | Bacteria | 4175 |
| 395 | Ga0395901_0048413 | 3300038443 | Bacteria | 4414 |
| 396 | Ga0395901_0087189 | 3300038443 | Bacteria | 3263 |
| 397 | Ga0237819_01949 | 3300038705 | Bacteria | 4673 |
| 398 | Ga0237819_04535 | 3300038705 | Bacteria | 2276 |
| 399 | Ga0237816_00200 | 3300039145 | Bacteria | 4858 |
| 400 | Ga0439436_0000019 | 3300041404 | Bacteria | 70584 |
| 401 | Ga0439436_0007235 | 3300041404 | Bacteria | 3414 |
| 402 | Ga0439465_0000101 | 3300041413 | Bacteria | 19683 |
| 403 | Ga0439465_0000251 | 3300041413 | Bacteria | 14747 |
| 404 | Ga0439465_0002026 | 3300041413 | Bacteria | 6654 |
| 405 | Ga0439465_0004478 | 3300041413 | Bacteria | 4516 |
| 406 | Ga0451791_0109322 | 3300041451 | Bacteria | 1888 |
| 407 | Ga0451793_0932637 | 3300041452 | Bacteria | 2115 |
| 408 | Ga0451793_1725027 | 3300041452 | Bacteria | 1756 |
| 409 | Ga0451795_0364400 | 3300041456 | Bacteria | 1477 |
| 410 | Ga0451800_0257622 | 3300041459 | Bacteria | 2952 |
| 411 | Ga0451806_400478 | 3300041462 | Bacteria | 3594 |
| 412 | Ga0451807_0625853 | 3300041486 | Bacteria | 2180 |
| 413 | Ga0451807_1319978 | 3300041486 | Bacteria | 3003 |
| 414 | Ga0451837_1141630 | 3300041494 | Bacteria | 3802 |
| 415 | Ga0439432_011465 | 3300042006 | Bacteria | 3055 |
| 416 | Ga0439449_0000013 | 3300042007 | Bacteria | 51317 |
| 417 | Ga0439449_0018849 | 3300042007 | Bacteria | 2587 |
| 418 | Ga0439449_0031544 | 3300042007 | Bacteria | 1975 |
| 419 | Ga0439449_0034696 | 3300042007 | Bacteria | 1878 |
| 420 | Ga0439449_0066769 | 3300042007 | Bacteria | 1326 |
| 421 | Ga0450908_000141 | 3300042184 | Bacteria | 14773 |
| 422 | Ga0451577_0005118 | 3300042876 | Bacteria | 13510 |
| 423 | Ga0439440_0008626 | 3300042993 | Bacteria | 2097 |
| 424 | Ga0466982_0000363 | 3300044672 | Bacteria | 12817 |
| 425 | Ga0466966_0017909 | 3300044684 | Bacteria | 4677 |
| 426 | Ga0466961_0001089 | 3300044693 | Bacteria | 16718 |
| 427 | Ga0466961_0004931 | 3300044693 | Bacteria | 8390 |
| 428 | Ga0466961_0028811 | 3300044693 | Bacteria | 3571 |
| 429 | Ga0466963_0101388 | 3300044694 | Bacteria | 1971 |
| 430 | Ga0466968_0001582 | 3300044735 | Bacteria | 8202 |
| 431 | Ga0466970_0000349 | 3300044765 | Bacteria | 22379 |
| 432 | Ga0466957_0108549 | 3300044842 | Bacteria | 1758 |
| 433 | Ga0466959_0000848 | 3300045049 | Bacteria | 18039 |
| 434 | Ga0466959_0022566 | 3300045049 | Bacteria | 4654 |
| 435 | Ga0466967_0270997 | 3300045976 | Bacteria | 1627 |
| 436 | Ga0495617_000409 | 3300046452 | Bacteria | 23631 |
| 437 | Ga0495627_013403 | 3300046453 | Bacteria | 2884 |
| 438 | Ga0495638_0000904 | 3300046460 | Bacteria | 30331 |
| 439 | Ga0495638_0000949 | 3300046460 | Bacteria | 29412 |
| 440 | Ga0495638_0007280 | 3300046460 | Bacteria | 7954 |
| 441 | Ga0495638_0062570 | 3300046460 | Bacteria | 2297 |
| 442 | Ga0495650_0001191 | 3300046471 | Bacteria | 27568 |
| 443 | Ga0495650_0001431 | 3300046471 | Bacteria | 23089 |
| 444 | Ga0495650_0002629 | 3300046471 | Bacteria | 14054 |
| 445 | Ga0495584_0003052 | 3300046491 | Bacteria | 9299 |
| 446 | Ga0495585_0001595 | 3300046492 | Bacteria | 17521 |
| 447 | Ga0495607_0001268 | 3300046501 | Bacteria | 22571 |
| 448 | Ga0495607_0028874 | 3300046501 | Bacteria | 3416 |
| 449 | Ga0495607_0063475 | 3300046501 | Bacteria | 2089 |
| 450 | Ga0495606_0002137 | 3300046507 | Bacteria | 23864 |
| 451 | Ga0495606_0003479 | 3300046507 | Bacteria | 16682 |
| 452 | Ga0495610_0005438 | 3300046512 | Bacteria | 9050 |
| 453 | Ga0495610_0006040 | 3300046512 | Bacteria | 8455 |
| 454 | Ga0495610_0009237 | 3300046512 | Bacteria | 6253 |
| 455 | Ga0495616_0000831 | 3300046513 | Bacteria | 22547 |
| 456 | Ga0495616_0013202 | 3300046513 | Bacteria | 4667 |
| 457 | Ga0495620_0000889 | 3300046515 | Bacteria | 18374 |
| 458 | Ga0495620_0004160 | 3300046515 | Bacteria | 8203 |
| 459 | Ga0495631_0000970 | 3300046518 | Bacteria | 17785 |
| 460 | Ga0495631_0002549 | 3300046518 | Bacteria | 10212 |
| 461 | Ga0495632_0000005 | 3300046519 | Bacteria | 362872 |
| 462 | Ga0495632_0003976 | 3300046519 | Bacteria | 10244 |
| 463 | Ga0495643_0002409 | 3300046522 | Bacteria | 14870 |
| 464 | Ga0495643_0036896 | 3300046522 | Bacteria | 2683 |
| 465 | Ga0495648_0003467 | 3300046524 | Bacteria | 13867 |
| 466 | Ga0495663_0002548 | 3300046525 | Bacteria | 5451 |
| 467 | Ga0495663_0003056 | 3300046525 | Bacteria | 4902 |
| 468 | Ga0495598_0002608 | 3300046537 | Bacteria | 3732 |
| 469 | Ga0495621_0000071 | 3300046539 | Bacteria | 20126 |
| 470 | Ga0495622_0064377 | 3300046557 | Bacteria | 1696 |
| 471 | Ga0495656_0011880 | 3300046615 | Bacteria | 3202 |
| 472 | Ga0495656_0045777 | 3300046615 | Bacteria | 1848 |
| 473 | Ga0495611_0000450 | 3300046648 | Bacteria | 24925 |
| 474 | Ga0495625_0027977 | 3300046660 | Bacteria | 4233 |
| 475 | Ga0495625_0050251 | 3300046660 | Bacteria | 2992 |
| 476 | Ga0495625_0131158 | 3300046660 | Bacteria | 1697 |
| 477 | Ga0495659_0015760 | 3300046664 | Bacteria | 2487 |
| 478 | Ga0495670_0003672 | 3300046691 | Bacteria | 7544 |
| 479 | Ga0495670_0019986 | 3300046691 | Bacteria | 3300 |
| 480 | Ga0495649_0013875 | 3300046694 | Bacteria | 4633 |
| 481 | Ga0495660_0001723 | 3300046810 | Bacteria | 14619 |
| 482 | Ga0495636_0004585 | 3300047318 | Bacteria | 5414 |
| 483 | Ga0495636_0021834 | 3300047318 | Bacteria | 2585 |
| 484 | Ga0495672_0000720 | 3300047320 | Bacteria | 36381 |
| 485 | Ga0495673_0000038 | 3300047469 | Bacteria | 303785 |
| 486 | Ga0495673_0000685 | 3300047469 | Bacteria | 33195 |
| 487 | Ga0495686_0000050 | 3300047472 | Bacteria | 269010 |
| 488 | Ga0495686_0003791 | 3300047472 | Bacteria | 12840 |
| 489 | Ga0495686_0012899 | 3300047472 | Bacteria | 5825 |
| 490 | Ga0495686_0019561 | 3300047472 | Bacteria | 4524 |
| 491 | Ga0495686_0066576 | 3300047472 | Bacteria | 2225 |
| 492 | Ga0496101_0002985 | 3300048904 | Bacteria | 10421 |
| 493 | Ga0496101_0242056 | 3300048904 | Bacteria | 1404 |
| 494 | Ga0496105_0003721 | 3300048908 | Bacteria | 11354 |
| 495 | Ga0496106_0004672 | 3300048909 | Bacteria | 10156 |
| 496 | Ga0496108_0010770 | 3300048911 | Bacteria | 7423 |
| 497 | Ga0496110_0202523 | 3300048913 | Bacteria | 1803 |
| 498 | Ga0496111_0059907 | 3300048914 | Bacteria | 2758 |
| 499 | Ga0496112_0028515 | 3300048915 | Bacteria | 5389 |
| 500 | Ga0496115_0001176 | 3300048918 | Bacteria | 18772 |
| 501 | Ga0496116_0042323 | 3300048919 | Bacteria | 3115 |
| 502 | Ga0496116_0053819 | 3300048919 | Bacteria | 2656 |
| 503 | Ga0496117_0000854 | 3300048920 | Bacteria | 47114 |
| 504 | Ga0496117_0011491 | 3300048920 | Bacteria | 7926 |
| 505 | Ga0496117_0019373 | 3300048920 | Bacteria | 5592 |
| 506 | Ga0496117_0025775 | 3300048920 | Bacteria | 4613 |
| 507 | Ga0496117_0029320 | 3300048920 | Bacteria | 4244 |
| 508 | Ga0496117_0037246 | 3300048920 | Bacteria | 3626 |
| 509 | Ga0496118_0000383 | 3300048921 | Bacteria | 74507 |
| 510 | Ga0496118_0003037 | 3300048921 | Bacteria | 21644 |
| 511 | Ga0496118_0003339 | 3300048921 | Bacteria | 20305 |
| 512 | Ga0496118_0011558 | 3300048921 | Bacteria | 8601 |
| 513 | Ga0496118_0014596 | 3300048921 | Bacteria | 7343 |
| 514 | Ga0496118_0060609 | 3300048921 | Bacteria | 2808 |
| 515 | Ga0496118_0107100 | 3300048921 | Bacteria | 1867 |
| 516 | Ga0496119_0000069 | 3300048922 | Bacteria | 155265 |
| 517 | Ga0496119_0000725 | 3300048922 | Bacteria | 44399 |
| 518 | Ga0496119_0037936 | 3300048922 | Bacteria | 3121 |
| 519 | Ga0496120_0000517 | 3300048923 | Bacteria | 59950 |
| 520 | Ga0496120_0000821 | 3300048923 | Bacteria | 44390 |
| 521 | Ga0496120_0000884 | 3300048923 | Bacteria | 42219 |
| 522 | Ga0496121_0001206 | 3300048924 | Bacteria | 45212 |
| 523 | Ga0496121_0004869 | 3300048924 | Bacteria | 17644 |
| 524 | Ga0496121_0005164 | 3300048924 | Bacteria | 16951 |
| 525 | Ga0496121_0008379 | 3300048924 | Bacteria | 12189 |
| 526 | Ga0496121_0029483 | 3300048924 | Bacteria | 5072 |
| 527 | Ga0496121_0065141 | 3300048924 | Bacteria | 2966 |
| 528 | Ga0496121_0085247 | 3300048924 | Bacteria | 2487 |
| 529 | Ga0496122_0000315 | 3300048925 | Bacteria | 106323 |
| 530 | Ga0496122_0000710 | 3300048925 | Bacteria | 65728 |
| 531 | Ga0496122_0001858 | 3300048925 | Bacteria | 32188 |
| 532 | Ga0496122_0009208 | 3300048925 | Bacteria | 10456 |
| 533 | Ga0496122_0016132 | 3300048925 | Bacteria | 7097 |
| 534 | Ga0496122_0021458 | 3300048925 | Bacteria | 5782 |
| 535 | Ga0496122_0106628 | 3300048925 | Bacteria | 1854 |
| 536 | Ga0496123_0000104 | 3300048926 | Bacteria | 168230 |
| 537 | Ga0496123_0000149 | 3300048926 | Bacteria | 142962 |
| 538 | Ga0496123_0000323 | 3300048926 | Bacteria | 91212 |
| 539 | Ga0496123_0013735 | 3300048926 | Bacteria | 6770 |
| 540 | Ga0496123_0020809 | 3300048926 | Bacteria | 5119 |
| 541 | Ga0496124_0000006 | 3300048927 | Bacteria | 904259 |
| 542 | Ga0496124_0000403 | 3300048927 | Bacteria | 78615 |
| 543 | Ga0496124_0000516 | 3300048927 | Bacteria | 66627 |
| 544 | Ga0496124_0013382 | 3300048927 | Bacteria | 8011 |
| 545 | Ga0496124_0013693 | 3300048927 | Bacteria | 7900 |
| 546 | Ga0496124_0022642 | 3300048927 | Bacteria | 5753 |
| 547 | Ga0496124_0025084 | 3300048927 | Bacteria | 5405 |
| 548 | Ga0496124_0037721 | 3300048927 | Bacteria | 4200 |
| 549 | Ga0496125_0001475 | 3300048928 | Bacteria | 34001 |
| 550 | Ga0496125_0009290 | 3300048928 | Bacteria | 10140 |
| 551 | Ga0496125_0012399 | 3300048928 | Bacteria | 8465 |
| 552 | Ga0496125_0012472 | 3300048928 | Bacteria | 8433 |
| 553 | Ga0496125_0045364 | 3300048928 | Bacteria | 3700 |
| 554 | Ga0496126_0000913 | 3300048929 | Bacteria | 51086 |
| 555 | Ga0496126_0032202 | 3300048929 | Bacteria | 4942 |
| 556 | Ga0501031_0037701 | 3300049568 | Bacteria | 3155 |
| 557 | Ga0501032_0005214 | 3300049569 | Bacteria | 9671 |
| 558 | Ga0501032_0016205 | 3300049569 | Bacteria | 5243 |
| 559 | Ga0501032_0017375 | 3300049569 | Bacteria | 5051 |
| 560 | Ga0501032_0048436 | 3300049569 | Bacteria | 2869 |
| 561 | Ga0501033_0001723 | 3300049570 | Bacteria | 19140 |
| 562 | Ga0501033_0005108 | 3300049570 | Bacteria | 10439 |
| 563 | Ga0501034_0000521 | 3300049571 | Bacteria | 61943 |
| 564 | Ga0501034_0007682 | 3300049571 | Bacteria | 11473 |
| 565 | Ga0501034_0009730 | 3300049571 | Bacteria | 10049 |
| 566 | Ga0501034_0014956 | 3300049571 | Bacteria | 7982 |
| 567 | Ga0501034_0022350 | 3300049571 | Bacteria | 6445 |
| 568 | Ga0501034_0041727 | 3300049571 | Bacteria | 4642 |
| 569 | Ga0501034_0135595 | 3300049571 | Bacteria | 2442 |
| 570 | Ga0501036_0027814 | 3300049572 | Bacteria | 4780 |
| 571 | Ga0501036_0041912 | 3300049572 | Bacteria | 3874 |
| 572 | Ga0501036_0059017 | 3300049572 | Bacteria | 3250 |
| 573 | Ga0501036_0077230 | 3300049572 | Bacteria | 2817 |
| 574 | Ga0501037_0035956 | 3300049573 | Bacteria | 3650 |
| 575 | Ga0501037_0059619 | 3300049573 | Bacteria | 2783 |
| 576 | Ga0501038_0001563 | 3300049574 | Bacteria | 21191 |
| 577 | Ga0501038_0006223 | 3300049574 | Bacteria | 11035 |
| 578 | Ga0501038_0015956 | 3300049574 | Bacteria | 6825 |
| 579 | Ga0501038_0190851 | 3300049574 | Bacteria | 1649 |
| 580 | Ga0501039_0017388 | 3300049575 | Bacteria | 5515 |
| 581 | Ga0501039_0024068 | 3300049575 | Bacteria | 4676 |
| 582 | Ga0501039_0066515 | 3300049575 | Bacteria | 2798 |
| 583 | Ga0501042_0036100 | 3300049578 | Bacteria | 3506 |
| 584 | Ga0501043_0009768 | 3300049579 | Bacteria | 7521 |
| 585 | Ga0501043_0016408 | 3300049579 | Bacteria | 5806 |
| 586 | Ga0501043_0023271 | 3300049579 | Bacteria | 4858 |
| 587 | Ga0501043_0026485 | 3300049579 | Bacteria | 4548 |
| 588 | Ga0501043_0031800 | 3300049579 | Bacteria | 4148 |
| 589 | Ga0501043_0084877 | 3300049579 | Bacteria | 2489 |
| 590 | Ga0501046_0003875 | 3300049580 | Bacteria | 13681 |
| 591 | Ga0501046_0004129 | 3300049580 | Bacteria | 13232 |
| 592 | Ga0501047_0005660 | 3300049581 | Bacteria | 11765 |
| 593 | Ga0501047_0007103 | 3300049581 | Bacteria | 10516 |
| 594 | Ga0501047_0040857 | 3300049581 | Bacteria | 4484 |
| 595 | Ga0501047_0044769 | 3300049581 | Bacteria | 4277 |
| 596 | Ga0501047_0061680 | 3300049581 | Bacteria | 3617 |
| 597 | Ga0501047_0091774 | 3300049581 | Bacteria | 2915 |
| 598 | Ga0501047_0099175 | 3300049581 | Bacteria | 2792 |
| 599 | Ga0501048_0033636 | 3300049582 | Bacteria | 3702 |
| 600 | Ga0501048_0145225 | 3300049582 | Bacteria | 1678 |
| 601 | Ga0501067_0021653 | 3300049583 | Bacteria | 3557 |
| 602 | Ga0501069_0000559 | 3300049585 | Bacteria | 17150 |
| 603 | Ga0501070_0011009 | 3300049586 | Bacteria | 7635 |
| 604 | Ga0501070_0033622 | 3300049586 | Bacteria | 4292 |
| 605 | Ga0501070_0040497 | 3300049586 | Bacteria | 3884 |
| 606 | Ga0501070_0056101 | 3300049586 | Bacteria | 3265 |
| 607 | Ga0501070_0056592 | 3300049586 | Bacteria | 3250 |
| 608 | Ga0501070_0089487 | 3300049586 | Bacteria | 2547 |
| 609 | Ga0501070_0090312 | 3300049586 | Bacteria | 2535 |
| 610 | Ga0501070_0134897 | 3300049586 | Bacteria | 2038 |
| 611 | Ga0501071_0010240 | 3300049587 | Bacteria | 6276 |
| 612 | Ga0501071_0055605 | 3300049587 | Bacteria | 2857 |
| 613 | Ga0501072_0014884 | 3300049588 | Bacteria | 5962 |
| 614 | Ga0501073_0033345 | 3300049589 | Bacteria | 3667 |
| 615 | Ga0501073_0055366 | 3300049589 | Bacteria | 2775 |
| 616 | Ga0501073_0095842 | 3300049589 | Bacteria | 2060 |
| 617 | Ga0501073_0105334 | 3300049589 | Bacteria | 1957 |
| 618 | Ga0501074_0011471 | 3300049590 | Bacteria | 6445 |
| 619 | Ga0501074_0045027 | 3300049590 | Bacteria | 3192 |
| 620 | Ga0501074_0074660 | 3300049590 | Bacteria | 2434 |
| 621 | Ga0501076_0192187 | 3300049592 | Bacteria | 1666 |
| 622 | Ga0501225_0019101 | 3300049705 | Bacteria | 1897 |
| 623 | Ga0501079_0088971 | 3300049741 | Bacteria | 2391 |
| 624 | Ga0501080_0007181 | 3300049742 | Bacteria | 10054 |
| 625 | Ga0501080_0025316 | 3300049742 | Bacteria | 5506 |
| 626 | Ga0501080_0083733 | 3300049742 | Bacteria | 2963 |
| 627 | Ga0501080_0095923 | 3300049742 | Bacteria | 2753 |
| 628 | Ga0501080_0106868 | 3300049742 | Bacteria | 2593 |
| 629 | Ga0501080_0134390 | 3300049742 | Bacteria | 2289 |
| 630 | Ga0501083_0010617 | 3300049744 | Bacteria | 6483 |
| 631 | Ga0501035_0004891 | 3300049822 | Bacteria | 12712 |
| 632 | Ga0501035_0024640 | 3300049822 | Bacteria | 5516 |
| 633 | Ga0501035_0025400 | 3300049822 | Bacteria | 5431 |
| 634 | Ga0501035_0031392 | 3300049822 | Bacteria | 4838 |
| 635 | Ga0501035_0050164 | 3300049822 | Bacteria | 3740 |
| 636 | Ga0501035_0066898 | 3300049822 | Bacteria | 3188 |
| 637 | Ga0501035_0122499 | 3300049822 | Bacteria | 2272 |
| 638 | Ga0501044_0004108 | 3300049823 | Bacteria | 16325 |
| 639 | Ga0501044_0006723 | 3300049823 | Bacteria | 12679 |
| 640 | Ga0501044_0009324 | 3300049823 | Bacteria | 10708 |
| 641 | Ga0501044_0169216 | 3300049823 | Bacteria | 2157 |
| 642 | Ga0501045_0011376 | 3300049824 | Bacteria | 6248 |
| 643 | nmdc:mga00v17_105035_c1 | 3300050491 | Bacteria | 1787 |
| 644 | nmdc:mga00v17_32326_c1 | 3300050491 | Bacteria | 3092 |
| 645 | nmdc:mga00v17_32479_c1 | 3300050491 | Bacteria | 3086 |
| 646 | nmdc:mga00v17_476_c1 | 3300050491 | Bacteria | 22518 |
| 647 | nmdc:mga0sz30_84315_c1 | 3300050516 | Bacteria | 1378 |
| 648 | Ga0500651_0001642 | 3300053093 | Bacteria | 11382 |
| 649 | Ga0500568_0006147 | 3300053139 | Bacteria | 6074 |
| 650 | Ga0500620_008421 | 3300053155 | Bacteria | 2604 |
| 651 | Ga0500634_0000363 | 3300053161 | Bacteria | 14395 |
| 652 | Ga0501084_0235396 | 3300054114 | Bacteria | 1546 |
| 653 | Ga0501082_0000107 | 3300060353 | Bacteria | 65178 |
| 654 | Ga0466962_0064733 | 3300061719 | Bacteria | 1745 |
| 655 | 2525558490 | 2524614729 | Bacteria | 3091755 |
| 656 | 2547503502 | 2547132130 | Bacteria | 4660562 |
| 657 | 2572255794 | 2571042365 | Bacteria | 3289345 |
| 658 | 2578457118 | 2576861471 | Bacteria | 4648976 |
| 659 | 2595448977 | 2593339238 | Bacteria | 4182970 |
| 660 | 2595452866 | 2593339239 | Bacteria | 4124669 |
| 661 | 2630650472 | 2627854209 | Bacteria | 3093011 |
| 662 | 2643816049 | 2643221559 | Bacteria | 4424915 |
| 663 | 2643881015 | 2643221573 | Bacteria | 4784121 |
| 664 | 2643909293 | 2643221579 | Bacteria | 4443405 |
| 665 | 2643914855 | 2643221581 | Bacteria | 3893603 |
| 666 | 2643939125 | 2643221586 | Bacteria | 4446529 |
| 667 | 2643977603 | 2643221593 | Bacteria | 6296053 |
| 668 | 2644077816 | 2643221612 | Bacteria | 4361984 |
| 669 | 2644530081 | 2643221695 | Bacteria | 3441323 |
| 670 | 2644661785 | 2643221720 | Bacteria | 4694283 |
| 671 | 2644697087 | 2643221727 | Bacteria | 4415595 |
| 672 | 2644699927 | 2643221728 | Bacteria | 4797149 |
| 673 | 2721029040 | 2718218334 | Bacteria | 4765486 |
| 674 | 2735835380 | 2734482264 | Unclassified | 5014763 |
| 675 | 2739229508 | 2738543009 | Bacteria | 4944499 |
| 676 | 2747950747 | 2747842428 | Bacteria | 4689383 |
| 677 | 2748018587 | 2747842501 | Bacteria | 5293829 |
| 678 | 2765580376 | 2765235840 | Bacteria | 4663337 |
| 679 | 2816518588 | 2816332141 | Bacteria | 4436036 |
| 680 | 2819661173 | 2818991457 | Bacteria | 5323295 |
| 681 | 2842395319 | 2842391507 | Bacteria | 4486072 |
| 682 | 2842759099 | 2842757796 | Bacteria | 3981385 |
| 683 | 2842782250 | 2842780639 | Bacteria | 4337790 |
| 684 | 2842917031 | 2842914999 | Bacteria | 4419378 |
| 685 | 2842922537 | 2842918807 | Bacteria | 4289178 |
| 686 | 2852652261 | 2852649853 | Bacteria | 4036942 |
| 687 | 2852687033 | 2852684882 | Bacteria | 5463342 |
| 688 | 2857445698 | 2857442823 | Bacteria | 4562550 |
| 689 | 2874223051 | 2874220319 | Bacteria | 4594709 |
| 690 | 2884342222 | 2884338543 | Bacteria | 4610696 |
| 691 | 2884411826 | 2884411467 | Bacteria | 5246714 |
| 692 | 2894416001 | 2894414249 | Bacteria | 4405451 |
| 693 | 2895501795 | 2895498888 | Bacteria | 5283788 |
| 694 | 2895517655 | 2895511927 | Bacteria | 6802080 |
| 695 | 2895525219 | 2895522137 | Bacteria | 3284416 |
| 696 | 2895526163 | 2895525241 | Bacteria | 3388457 |
| 697 | 2919087893 | 2919085039 | Bacteria | 4532964 |
| 698 | 2919092959 | 2919089067 | Bacteria | 4560942 |
| 699 | 2919131186 | 2919130084 | Bacteria | 5301837 |
| 700 | 2919137354 | 2919134579 | Bacteria | 4480386 |
| 701 | 2919407899 | 2919404418 | Bacteria | 4232372 |
| 702 | 2919517002 | 2919513703 | Bacteria | 3844312 |
| 703 | 2919678864 | 2919675420 | Bacteria | 3969095 |
| 704 | 2923517292 | 2923516293 | Bacteria | 3716336 |
| 705 | 2928498947 | 2928496128 | Bacteria | 4631123 |
| 706 | 2929196426 | 2929195423 | Bacteria | 5325372 |
| 707 | 2931383488 | 2931380184 | Bacteria | 4455911 |
| 708 | 2937615029 | 2937610967 | Bacteria | 4618818 |
| 709 | 2939589690 | 2939589442 | Bacteria | 4214238 |
| 710 | 2939614042 | 2939611941 | Bacteria | 3892017 |
| 711 | 2939624234 | 2939622612 | Bacteria | 4698046 |
| 712 | 2939630670 | 2939626828 | Bacteria | 4695272 |
| 713 | 2941474678 | 2941471342 | Bacteria | 5018624 |
| 714 | 2941478877 | 2941475908 | Bacteria | 4145589 |
| 715 | 2941492494 | 2941489479 | Bacteria | 6313767 |
| 716 | 2953996995 | 2953994433 | Bacteria | 4303959 |
| 717 | 2961049816 | 2961047084 | Bacteria | 4594415 |
| 718 | 2961066503 | 2961064222 | Bacteria | 4749990 |
| 719 | 2974307755 | 2974307012 | Bacteria | 4172388 |
| 720 | 2977248475 | 2977247770 | Bacteria | 4160543 |
| 721 | 2984517039 | 2984514374 | Bacteria | 4172479 |
| 722 | 2987608653 | 2987605356 | Bacteria | 4187822 |
| 723 | 2995953247 | 2995948881 | Bacteria | 6358104 |
| 724 | 8002869917 | 8002869464 | Bacteria | 3588529 |
| 725 | 8003017402 | 8003014200 | Bacteria | 4059994 |
| 726 | 8021624978 | 8021622325 | Bacteria | 4844743 |
| 727 | 8021626759 | 8021626552 | Bacteria | 4665214 |
| 728 | 8021650087 | 8021648035 | Bacteria | 4772378 |
| 729 | Ga0207681_10016898 | |||
| 730 | SwRhRL2b_contig_1053233 | |||
| 731 | SwRhRL2b_contig_1073745 | |||
| 732 | JGI24741J21665_1007320 | |||
| 733 | JGI24735J21928_10000400 | |||
| 734 | JGI24738J21930_10001530 | |||
| 735 | JGI25156J39149_1004995 | |||
| 736 | JGI25162J39368_1000239 | |||
| 737 | JGI25157J39369_1000720 | |||
| 738 | JGI25164J39214_1000200 | |||
| 739 | JGI25164J39214_1000605 | |||
| 740 | JGI25152J39213_1000057 | |||
| 741 | JGI25150J39212_1000150 | |||
| 742 | JGI25151J46595_10000109 | |||
| 743 | JGI25151J46595_10000118 | |||
| 744 | JGI25165J46597_1000319 | |||
| 745 | JGI25153J46596_10000084 | |||
| 746 | Ga0006554J51385_1037292 | |||
| 747 | Ga0006562J51391_1035852 | |||
| 748 | Ga0006562J51391_1035855 | |||
| 749 | Ga0055539_1001249 | |||
| 750 | Ga0055533_1002005 | |||
| 751 | Ga0055533_1004847 | |||
| 752 | Ga0055527_1000331 | |||
| 753 | Ga0055535_1000242 | |||
| 754 | Ga0055535_1000715 | |||
| 755 | Ga0055542_1000298 | |||
| 756 | Ga0055542_1000741 | |||
| 757 | Ga0055529_1000437 | |||
| 758 | Ga0055529_1000648 | |||
| 759 | Ga0055526_1000082 | |||
| 760 | Ga0055526_1009936 | |||
| 761 | Ga0055537_1000228 | |||
| 762 | Ga0055537_1000526 | |||
| 763 | Ga0055537_1002379 | |||
| 764 | Ga0055537_1003609 | |||
| 765 | Ga0055524_1000138 | |||
| 766 | Ga0055524_1010765 | |||
| 767 | Ga0055536_1001681 | |||
| 768 | Ga0055536_1002692 | |||
| 769 | Ga0055536_1002705 | |||
| 770 | Ga0055536_1018107 | |||
| 771 | Ga0055534_1000056 | |||
| 772 | Ga0055534_1000121 | |||
| 773 | Ga0055528_1000061 | |||
| 774 | Ga0055528_1000148 | |||
| 775 | Ga0055530_10000618 | |||
| 776 | Ga0055530_10001089 | |||
| 777 | Ga0055530_10007041 | |||
| 778 | Ga0055531_10002801 | |||
| 779 | Ga0055531_10012704 | |||
| 780 | Ga0055531_10021543 | |||
| 781 | Ga0055531_10024411 | |||
| 782 | Ga0055531_10027325 | |||
| 783 | Ga0058692_1000013 | |||
| 784 | Ga0058692_1000045 | |||
| 785 | Ga0065165_1000887 | |||
| 786 | Ga0065704_10074566 | |||
| 787 | Ga0065704_10077370 | |||
| 788 | Ga0070658_10007494 | |||
| 789 | Ga0070658_10225831 | |||
| 790 | Ga0070676_10028577 | |||
| 791 | Ga0070670_100008187 | |||
| 792 | Ga0070670_100236672 | |||
| 793 | Ga0070666_10000082 | |||
| 794 | Ga0070666_10105244 | |||
| 795 | Ga0070680_100002369 | |||
| 796 | Ga0070680_100007340 | |||
| 797 | Ga0070680_100054184 | |||
| 798 | Ga0070660_100225558 | |||
| 799 | Ga0070689_100016007 | |||
| 800 | Ga0070691_10019838 | |||
| 801 | Ga0070661_100132961 | |||
| 802 | Ga0070661_100139754 | |||
| 803 | Ga0070668_100003260 | |||
| 804 | Ga0070668_100022562 | |||
| 805 | Ga0070668_100121805 | |||
| 806 | Ga0070671_100106817 | |||
| 807 | Ga0070671_100108444 | |||
| 808 | Ga0070667_100000049 | |||
| 809 | Ga0070667_100005927 | |||
| 810 | Ga0070667_100043089 | |||
| 811 | Ga0070714_100001179 | |||
| 812 | Ga0070711_100141624 | |||
| 813 | Ga0070663_100029791 | |||
| 814 | Ga0070663_100039763 | |||
| 815 | Ga0070678_100012380 | |||
| 816 | Ga0070681_10000484 | |||
| 817 | Ga0070681_10000534 | |||
| 818 | Ga0070681_10016654 | |||
| 819 | Ga0070679_100000571 | |||
| 820 | Ga0070679_100001635 | |||
| 821 | Ga0070679_100011025 | |||
| 822 | Ga0070679_100015323 | |||
| 823 | Ga0068853_100002452 | |||
| 824 | Ga0068853_100039875 | |||
| 825 | Ga0068853_100170234 | |||
| 826 | Ga0070672_100030579 | |||
| 827 | Ga0070672_100055265 | |||
| 828 | Ga0070696_100048086 | |||
| 829 | Ga0070696_100048090 | |||
| 830 | Ga0070693_100021970 | |||
| 831 | Ga0070693_100024780 | |||
| 832 | Ga0070665_100000028 | |||
| 833 | Ga0070665_100030082 | |||
| 834 | Ga0070665_100053199 | |||
| 835 | Ga0068855_100008568 | |||
| 836 | Ga0070664_100068581 | |||
| 837 | Ga0070664_100105137 | |||
| 838 | Ga0068857_100046813 | |||
| 839 | Ga0068857_100127717 | |||
| 840 | Ga0068856_100013243 | |||
| 841 | Ga0068852_100006366 | |||
| 842 | Ga0068860_100076943 | |||
| 843 | Ga0068860_100087722 | |||
| 844 | Ga0068862_100000215 | |||
| 845 | Ga0081540_1004974 | |||
| 846 | Ga0081539_10012422 | |||
| 847 | Ga0075364_10001706 | |||
| 848 | Ga0075364_10047836 | |||
| 849 | Ga0075369_10008855 | |||
| 850 | Ga0097621_100037463 | |||
| 851 | Ga0068871_100060646 | |||
| 852 | Ga0105251_10006095 | |||
| 853 | Ga0105251_10008644 | |||
| 854 | Ga0105244_10019129 | |||
| 855 | Ga0105244_10024400 | |||
| 856 | Ga0105244_10041213 | |||
| 857 | Ga0105240_10002481 | |||
| 858 | Ga0105240_10034520 | |||
| 859 | Ga0105240_10117805 | |||
| 860 | Ga0105240_10143850 | |||
| 861 | Ga0105245_10160528 | |||
| 862 | Ga0105245_10168283 | |||
| 863 | Ga0105247_10004712 | |||
| 864 | Ga0105241_10089015 | |||
| 865 | Ga0105242_10116648 | |||
| 866 | Ga0105238_10009665 | |||
| 867 | Ga0105238_10123451 | |||
| 868 | Ga0105238_10274005 | |||
| 869 | Ga0105239_10001637 | |||
| 870 | Ga0105239_10040173 | |||
| 871 | Ga0105239_10105472 | |||
| 872 | Ga0105239_10205338 | |||
| 873 | Ga0157371_10000184 | |||
| 874 | Ga0157371_10037971 | |||
| 875 | Ga0157370_10006151 | |||
| 876 | Ga0157370_10007352 | |||
| 877 | Ga0157370_10021551 | |||
| 878 | Ga0157370_10032654 | |||
| 879 | Ga0157370_10036214 | |||
| 880 | Ga0157370_10081183 | |||
| 881 | Ga0157369_10021566 | |||
| 882 | Ga0157369_10097397 | |||
| 883 | Ga0157378_10066474 | |||
| 884 | Ga0163162_10020366 | |||
| 885 | Ga0163162_10053837 | |||
| 886 | Ga0157372_10005781 | |||
| 887 | Ga0157372_10029020 | |||
| 888 | Ga0157372_10041430 | |||
| 889 | Ga0157372_10278022 | |||
| 890 | Ga0182008_10000473 | |||
| 891 | Ga0182008_10008140 | |||
| 892 | Ga0182008_10013637 | |||
| 893 | Ga0182008_10055826 | |||
| 894 | Ga0157379_10115658 | |||
| 895 | Ga0157379_10356893 | |||
| 896 | Ga0157376_10048547 | |||
| 897 | Ga0157376_10365257 | |||
| 898 | Ga0182006_1000461 | |||
| 899 | Ga0182006_1001147 | |||
| 900 | Ga0182006_1011101 | |||
| 901 | Ga0182006_1013092 | |||
| 902 | Ga0182006_1020517 | |||
| 903 | Ga0182006_1023914 | |||
| 904 | Ga0182006_1038452 | |||
| 905 | Ga0182007_10000118 | |||
| 906 | Ga0182007_10013264 | |||
| 907 | Ga0182005_1000999 | |||
| 908 | Ga0182005_1001072 | |||
| 909 | Ga0182005_1001074 | |||
| 910 | Ga0182005_1001234 | |||
| 911 | Ga0182005_1001964 | |||
| 912 | Ga0183368_1007 | |||
| 913 | Ga0183360_10003 | |||
| 914 | Ga0163161_10000766 | |||
| 915 | Ga0163161_10000891 | |||
| 916 | Ga0163161_10018430 | |||
| 917 | Ga0163161_10021086 | |||
| 918 | Ga0206356_10628665 | |||
| 919 | Ga0206356_11804033 | |||
| 920 | Ga0206354_10819979 | |||
| 921 | Ga0206354_11580386 | |||
| 922 | Ga0224712_10027171 | |||
| 923 | Ga0209435_101970 | |||
| 924 | Ga0209760_100623 | |||
| 925 | Ga0209784_100163 | |||
| 926 | Ga0209674_100037 | |||
| 927 | Ga0209674_100058 | |||
| 928 | Ga0209674_101812 | |||
| 929 | Ga0209672_100061 | |||
| 930 | Ga0209672_102507 | |||
| 931 | Ga0209147_106306 | |||
| 932 | Ga0207427_100196 | |||
| 933 | Ga0209437_100345 | |||
| 934 | Ga0209437_100894 | |||
| 935 | Ga0209258_100054 | |||
| 936 | Ga0209258_100384 | |||
| 937 | Ga0209258_100514 | |||
| 938 | Ga0207425_1000045 | |||
| 939 | Ga0209646_1004443 | |||
| 940 | Ga0209026_1000286 | |||
| 941 | Ga0209026_1009861 | |||
| 942 | Ga0209677_101425 | |||
| 943 | Ga0209148_1000047 | |||
| 944 | Ga0209148_1000066 | |||
| 945 | Ga0209148_1000912 | |||
| 946 | Ga0209759_1001948 | |||
| 947 | Ga0209129_1000057 | |||
| 948 | Ga0209129_1000331 | |||
| 949 | Ga0209233_1000100 | |||
| 950 | Ga0209565_1000002 | |||
| 951 | Ga0209565_1000023 | |||
| 952 | Ga0209565_1004811 | |||
| 953 | Ga0209455_1000101 | |||
| 954 | Ga0209455_1000270 | |||
| 955 | Ga0209673_1000002 | |||
| 956 | Ga0209673_1000047 | |||
| 957 | Ga0209673_1005603 | |||
| 958 | Ga0209130_1008264 | |||
| 959 | Ga0209675_1000002 | |||
| 960 | Ga0209675_1000016 | |||
| 961 | Ga0209675_1008593 | |||
| 962 | Ga0209676_1000027 | |||
| 963 | Ga0209676_1000037 | |||
| 964 | Ga0209676_1000160 | |||
| 965 | Ga0209676_1000796 | |||
| 966 | Ga0209676_1000830 | |||
| 967 | Ga0209676_1003891 | |||
| 968 | Ga0209025_1000013 | |||
| 969 | Ga0209025_1000200 | |||
| 970 | Ga0209025_1007913 | |||
| 971 | Ga0209564_1000004 | |||
| 972 | Ga0209564_1000194 | |||
| 973 | Ga0209564_1003164 | |||
| 974 | Ga0209758_1000014 | |||
| 975 | Ga0209758_1014135 | |||
| 976 | Ga0209758_1018063 | |||
| 977 | Ga0209758_1023548 | |||
| 978 | Ga0209050_1000462 | |||
| 979 | Ga0209050_1000971 | |||
| 980 | Ga0209050_1002489 | |||
| 981 | Ga0209050_1011478 | |||
| 982 | Ga0209050_1034076 | |||
| 983 | Ga0209256_1000004 | |||
| 984 | Ga0209256_1001572 | |||
| 985 | Ga0209256_1002300 | |||
| 986 | Ga0209256_1010730 | |||
| 987 | Ga0207426_1003250 | |||
| 988 | Ga0209051_1004177 | |||
| 989 | Ga0209051_1005461 | |||
| 990 | Ga0209051_1008798 | |||
| 991 | Ga0209257_1000046 | |||
| 992 | Ga0209257_1000091 | |||
| 993 | Ga0209257_1000177 | |||
| 994 | Ga0209257_1000499 | |||
| 995 | Ga0209257_1002803 | |||
| 996 | Ga0209257_1003235 | |||
| 997 | Ga0209257_1021122 | |||
| 998 | Ga0207713_1006743 | |||
| 999 | Ga0207713_1017270 | |||
| 1000 | Ga0207710_10002997 | |||
| 1001 | Ga0207680_10000003 | |||
| 1002 | Ga0207647_10000130 | |||
| 1003 | Ga0207647_10002143 | |||
| 1004 | Ga0207647_10011433 | |||
| 1005 | Ga0207647_10034228 | |||
| 1006 | Ga0207645_10085680 | |||
| 1007 | Ga0207705_10000400 | |||
| 1008 | Ga0207705_10001982 | |||
| 1009 | Ga0207705_10004563 | |||
| 1010 | Ga0207705_10049895 | |||
| 1011 | Ga0207705_10186261 | |||
| 1012 | Ga0207707_10000020 | |||
| 1013 | Ga0207707_10003170 | |||
| 1014 | Ga0207707_10012604 | |||
| 1015 | Ga0207707_10035320 | |||
| 1016 | Ga0207695_10001663 | |||
| 1017 | Ga0207695_10002173 | |||
| 1018 | Ga0207695_10028244 | |||
| 1019 | Ga0207695_10041475 | |||
| 1020 | Ga0207695_10242399 | |||
| 1021 | Ga0207660_10000726 | |||
| 1022 | Ga0207660_10000950 | |||
| 1023 | Ga0207660_10005901 | |||
| 1024 | Ga0207660_10039120 | |||
| 1025 | Ga0207660_10065311 | |||
| 1026 | Ga0207657_10014239 | |||
| 1027 | Ga0207657_10026757 | |||
| 1028 | Ga0207657_10141840 | |||
| 1029 | Ga0207649_10005191 | |||
| 1030 | Ga0207649_10008579 | |||
| 1031 | Ga0207649_10079274 | |||
| 1032 | Ga0207649_10100528 | |||
| 1033 | Ga0207652_10000037 | |||
| 1034 | Ga0207652_10000753 | |||
| 1035 | Ga0207652_10002384 | |||
| 1036 | Ga0207652_10012358 | |||
| 1037 | Ga0207652_10012736 | |||
| 1038 | Ga0207652_10115855 | |||
| 1039 | Ga0207694_10001777 | |||
| 1040 | Ga0207694_10040592 | |||
| 1041 | Ga0207694_10093456 | |||
| 1042 | Ga0207694_10103780 | |||
| 1043 | Ga0207650_10129227 | |||
| 1044 | Ga0207664_10000856 | |||
| 1045 | Ga0207690_10000657 | |||
| 1046 | Ga0207690_10033037 | |||
| 1047 | Ga0207690_10048257 | |||
| 1048 | Ga0207709_10007956 | |||
| 1049 | Ga0207691_10018245 | |||
| 1050 | Ga0207691_10071615 | |||
| 1051 | Ga0207661_10004484 | |||
| 1052 | Ga0207667_10000633 | |||
| 1053 | Ga0207667_10019918 | |||
| 1054 | Ga0207667_10081769 | |||
| 1055 | Ga0207667_10129844 | |||
| 1056 | Ga0207667_10216350 | |||
| 1057 | Ga0207640_10001068 | |||
| 1058 | Ga0207658_10004314 | |||
| 1059 | Ga0207639_10003456 | |||
| 1060 | Ga0207639_10004090 | |||
| 1061 | Ga0207639_10095816 | |||
| 1062 | Ga0207678_10007384 | |||
| 1063 | Ga0207678_10199694 | |||
| 1064 | Ga0207678_10211547 | |||
| 1065 | Ga0207702_10001784 | |||
| 1066 | Ga0207702_10003564 | |||
| 1067 | Ga0207702_10004508 | |||
| 1068 | Ga0207641_10055975 | |||
| 1069 | Ga0207648_10045518 | |||
| 1070 | Ga0207674_10042443 | |||
| 1071 | Ga0207674_10104040 | |||
| 1072 | Ga0207683_10022177 | |||
| 1073 | Ga0207683_10098701 | |||
| 1074 | Ga0207698_10000844 | |||
| 1075 | Ga0207698_10010069 | |||
| 1076 | Ga0207698_10096317 | |||
| 1077 | Ga0209371_1000007 | |||
| 1078 | Ga0209371_1000043 | |||
| 1079 | Ga0209969_1003965 | |||
| 1080 | Ga0209995_1005763 | |||
| 1081 | Ga0209999_1000892 | |||
| 1082 | Ga0209982_1002226 | |||
| 1083 | Ga0209983_1001615 | |||
| 1084 | Ga0209971_1003771 | |||
| 1085 | Ga0209974_10008710 | |||
| 1086 | Ga0268266_10000017 | |||
| 1087 | Ga0268266_10001303 | |||
| 1088 | Ga0268265_10002016 | |||
| 1089 | Ga0268265_10040381 | |||
| 1090 | Ga0268265_10064291 | |||
| 1091 | Ga0268264_10071166 | |||
| 1092 | Ga0268256_1000008 | |||
| 1093 | Ga0268256_1000044 | |||
| 1094 | Ga0316176_1021304 | |||
| 1095 | Ga0314311_1061056 | |||
| 1096 | Ga0316182_1116479 | |||
| 1097 | Ga0307513_10023179 | |||
| 1098 | Ga0316575_10006346 | |||
| 1099 | Ga0316579_10001744 | |||
| 1100 | Ga0307413_10015817 | |||
| 1101 | Ga0307413_10166906 | |||
| 1102 | Ga0307406_10002976 | |||
| 1103 | Ga0307406_10032774 | |||
| 1104 | Ga0307412_10001279 | |||
| 1105 | Ga0307412_10016904 | |||
| 1106 | Ga0307416_100171282 | |||
| 1107 | Ga0307414_10011174 | |||
| 1108 | Ga0307414_10015898 | |||
| 1109 | Ga0307414_10020978 | |||
| 1110 | Ga0316583_10000604 | |||
| 1111 | Ga0307507_10101030 | |||
| 1112 | Ga0307510_10006141 | |||
| 1113 | Ga0316582_0005132 | |||
| 1114 | Ga0395899_0000410 | |||
| 1115 | Ga0395899_0041522 | |||
| 1116 | Ga0395900_0000206 | |||
| 1117 | Ga0395900_0000656 | |||
| 1118 | Ga0395900_0006056 | |||
| 1119 | Ga0395900_0118044 | |||
| 1120 | Ga0395898_0000120 | |||
| 1121 | Ga0395905_0007372 | |||
| 1122 | Ga0316581_0002944 | |||
| 1123 | Ga0395901_0048413 | |||
| 1124 | Ga0395901_0087189 | |||
| 1125 | Ga0237819_01949 | |||
| 1126 | Ga0237819_04535 | |||
| 1127 | Ga0237816_00200 | |||
| 1128 | Ga0439436_0000019 | |||
| 1129 | Ga0439436_0007235 | |||
| 1130 | Ga0439465_0000101 | |||
| 1131 | Ga0439465_0000251 | |||
| 1132 | Ga0439465_0002026 | |||
| 1133 | Ga0439465_0004478 | |||
| 1134 | Ga0451791_0109322 | |||
| 1135 | Ga0451793_0932637 | |||
| 1136 | Ga0451793_1725027 | |||
| 1137 | Ga0451795_0364400 | |||
| 1138 | Ga0451800_0257622 | |||
| 1139 | Ga0451806_400478 | |||
| 1140 | Ga0451807_0625853 | |||
| 1141 | Ga0451807_1319978 | |||
| 1142 | Ga0451837_1141630 | |||
| 1143 | Ga0439432_011465 | |||
| 1144 | Ga0439449_0000013 | |||
| 1145 | Ga0439449_0018849 | |||
| 1146 | Ga0439449_0031544 | |||
| 1147 | Ga0439449_0034696 | |||
| 1148 | Ga0439449_0066769 | |||
| 1149 | Ga0450908_000141 | |||
| 1150 | Ga0451577_0005118 | |||
| 1151 | Ga0439440_0008626 | |||
| 1152 | Ga0466982_0000363 | |||
| 1153 | Ga0466966_0017909 | |||
| 1154 | Ga0466961_0001089 | |||
| 1155 | Ga0466961_0004931 | |||
| 1156 | Ga0466961_0028811 | |||
| 1157 | Ga0466963_0101388 | |||
| 1158 | Ga0466968_0001582 | |||
| 1159 | Ga0466970_0000349 | |||
| 1160 | Ga0466957_0108549 | |||
| 1161 | Ga0466959_0000848 | |||
| 1162 | Ga0466959_0022566 | |||
| 1163 | Ga0466967_0270997 | |||
| 1164 | Ga0495617_000409 | |||
| 1165 | Ga0495627_013403 | |||
| 1166 | Ga0495638_0000904 | |||
| 1167 | Ga0495638_0000949 | |||
| 1168 | Ga0495638_0007280 | |||
| 1169 | Ga0495638_0062570 | |||
| 1170 | Ga0495650_0001191 | |||
| 1171 | Ga0495650_0001431 | |||
| 1172 | Ga0495650_0002629 | |||
| 1173 | Ga0495584_0003052 | |||
| 1174 | Ga0495585_0001595 | |||
| 1175 | Ga0495607_0001268 | |||
| 1176 | Ga0495607_0028874 | |||
| 1177 | Ga0495607_0063475 | |||
| 1178 | Ga0495606_0002137 | |||
| 1179 | Ga0495606_0003479 | |||
| 1180 | Ga0495610_0005438 | |||
| 1181 | Ga0495610_0006040 | |||
| 1182 | Ga0495610_0009237 | |||
| 1183 | Ga0495616_0000831 | |||
| 1184 | Ga0495616_0013202 | |||
| 1185 | Ga0495620_0000889 | |||
| 1186 | Ga0495620_0004160 | |||
| 1187 | Ga0495631_0000970 | |||
| 1188 | Ga0495631_0002549 | |||
| 1189 | Ga0495632_0000005 | |||
| 1190 | Ga0495632_0003976 | |||
| 1191 | Ga0495643_0002409 | |||
| 1192 | Ga0495643_0036896 | |||
| 1193 | Ga0495648_0003467 | |||
| 1194 | Ga0495663_0002548 | |||
| 1195 | Ga0495663_0003056 | |||
| 1196 | Ga0495598_0002608 | |||
| 1197 | Ga0495621_0000071 | |||
| 1198 | Ga0495622_0064377 | |||
| 1199 | Ga0495656_0011880 | |||
| 1200 | Ga0495656_0045777 | |||
| 1201 | Ga0495611_0000450 | |||
| 1202 | Ga0495625_0027977 | |||
| 1203 | Ga0495625_0050251 | |||
| 1204 | Ga0495625_0131158 | |||
| 1205 | Ga0495659_0015760 | |||
| 1206 | Ga0495670_0003672 | |||
| 1207 | Ga0495670_0019986 | |||
| 1208 | Ga0495649_0013875 | |||
| 1209 | Ga0495660_0001723 | |||
| 1210 | Ga0495636_0004585 | |||
| 1211 | Ga0495636_0021834 | |||
| 1212 | Ga0495672_0000720 | |||
| 1213 | Ga0495673_0000038 | |||
| 1214 | Ga0495673_0000685 | |||
| 1215 | Ga0495686_0000050 | |||
| 1216 | Ga0495686_0003791 | |||
| 1217 | Ga0495686_0012899 | |||
| 1218 | Ga0495686_0019561 | |||
| 1219 | Ga0495686_0066576 | |||
| 1220 | Ga0496101_0002985 | |||
| 1221 | Ga0496101_0242056 | |||
| 1222 | Ga0496105_0003721 | |||
| 1223 | Ga0496106_0004672 | |||
| 1224 | Ga0496108_0010770 | |||
| 1225 | Ga0496110_0202523 | |||
| 1226 | Ga0496111_0059907 | |||
| 1227 | Ga0496112_0028515 | |||
| 1228 | Ga0496115_0001176 | |||
| 1229 | Ga0496116_0042323 | |||
| 1230 | Ga0496116_0053819 | |||
| 1231 | Ga0496117_0000854 | |||
| 1232 | Ga0496117_0011491 | |||
| 1233 | Ga0496117_0019373 | |||
| 1234 | Ga0496117_0025775 | |||
| 1235 | Ga0496117_0029320 | |||
| 1236 | Ga0496117_0037246 | |||
| 1237 | Ga0496118_0000383 | |||
| 1238 | Ga0496118_0003037 | |||
| 1239 | Ga0496118_0003339 | |||
| 1240 | Ga0496118_0011558 | |||
| 1241 | Ga0496118_0014596 | |||
| 1242 | Ga0496118_0060609 | |||
| 1243 | Ga0496118_0107100 | |||
| 1244 | Ga0496119_0000069 | |||
| 1245 | Ga0496119_0000725 | |||
| 1246 | Ga0496119_0037936 | |||
| 1247 | Ga0496120_0000517 | |||
| 1248 | Ga0496120_0000821 | |||
| 1249 | Ga0496120_0000884 | |||
| 1250 | Ga0496121_0001206 | |||
| 1251 | Ga0496121_0004869 | |||
| 1252 | Ga0496121_0005164 | |||
| 1253 | Ga0496121_0008379 | |||
| 1254 | Ga0496121_0029483 | |||
| 1255 | Ga0496121_0065141 | |||
| 1256 | Ga0496121_0085247 | |||
| 1257 | Ga0496122_0000315 | |||
| 1258 | Ga0496122_0000710 | |||
| 1259 | Ga0496122_0001858 | |||
| 1260 | Ga0496122_0009208 | |||
| 1261 | Ga0496122_0016132 | |||
| 1262 | Ga0496122_0021458 | |||
| 1263 | Ga0496122_0106628 | |||
| 1264 | Ga0496123_0000104 | |||
| 1265 | Ga0496123_0000149 | |||
| 1266 | Ga0496123_0000323 | |||
| 1267 | Ga0496123_0013735 | |||
| 1268 | Ga0496123_0020809 | |||
| 1269 | Ga0496124_0000006 | |||
| 1270 | Ga0496124_0000403 | |||
| 1271 | Ga0496124_0000516 | |||
| 1272 | Ga0496124_0013382 | |||
| 1273 | Ga0496124_0013693 | |||
| 1274 | Ga0496124_0022642 | |||
| 1275 | Ga0496124_0025084 | |||
| 1276 | Ga0496124_0037721 | |||
| 1277 | Ga0496125_0001475 | |||
| 1278 | Ga0496125_0009290 | |||
| 1279 | Ga0496125_0012399 | |||
| 1280 | Ga0496125_0012472 | |||
| 1281 | Ga0496125_0045364 | |||
| 1282 | Ga0496126_0000913 | |||
| 1283 | Ga0496126_0032202 | |||
| 1284 | Ga0501031_0037701 | |||
| 1285 | Ga0501032_0005214 | |||
| 1286 | Ga0501032_0016205 | |||
| 1287 | Ga0501032_0017375 | |||
| 1288 | Ga0501032_0048436 | |||
| 1289 | Ga0501033_0001723 | |||
| 1290 | Ga0501033_0005108 | |||
| 1291 | Ga0501034_0000521 | |||
| 1292 | Ga0501034_0007682 | |||
| 1293 | Ga0501034_0009730 | |||
| 1294 | Ga0501034_0014956 | |||
| 1295 | Ga0501034_0022350 | |||
| 1296 | Ga0501034_0041727 | |||
| 1297 | Ga0501034_0135595 | |||
| 1298 | Ga0501036_0027814 | |||
| 1299 | Ga0501036_0041912 | |||
| 1300 | Ga0501036_0059017 | |||
| 1301 | Ga0501036_0077230 | |||
| 1302 | Ga0501037_0035956 | |||
| 1303 | Ga0501037_0059619 | |||
| 1304 | Ga0501038_0001563 | |||
| 1305 | Ga0501038_0006223 | |||
| 1306 | Ga0501038_0015956 | |||
| 1307 | Ga0501038_0190851 | |||
| 1308 | Ga0501039_0017388 | |||
| 1309 | Ga0501039_0024068 | |||
| 1310 | Ga0501039_0066515 | |||
| 1311 | Ga0501042_0036100 | |||
| 1312 | Ga0501043_0009768 | |||
| 1313 | Ga0501043_0016408 | |||
| 1314 | Ga0501043_0023271 | |||
| 1315 | Ga0501043_0026485 | |||
| 1316 | Ga0501043_0031800 | |||
| 1317 | Ga0501043_0084877 | |||
| 1318 | Ga0501046_0003875 | |||
| 1319 | Ga0501046_0004129 | |||
| 1320 | Ga0501047_0005660 | |||
| 1321 | Ga0501047_0007103 | |||
| 1322 | Ga0501047_0040857 | |||
| 1323 | Ga0501047_0044769 | |||
| 1324 | Ga0501047_0061680 | |||
| 1325 | Ga0501047_0091774 | |||
| 1326 | Ga0501047_0099175 | |||
| 1327 | Ga0501048_0033636 | |||
| 1328 | Ga0501048_0145225 | |||
| 1329 | Ga0501067_0021653 | |||
| 1330 | Ga0501069_0000559 | |||
| 1331 | Ga0501070_0011009 | |||
| 1332 | Ga0501070_0033622 | |||
| 1333 | Ga0501070_0040497 | |||
| 1334 | Ga0501070_0056101 | |||
| 1335 | Ga0501070_0056592 | |||
| 1336 | Ga0501070_0089487 | |||
| 1337 | Ga0501070_0090312 | |||
| 1338 | Ga0501070_0134897 | |||
| 1339 | Ga0501071_0010240 | |||
| 1340 | Ga0501071_0055605 | |||
| 1341 | Ga0501072_0014884 | |||
| 1342 | Ga0501073_0033345 | |||
| 1343 | Ga0501073_0055366 | |||
| 1344 | Ga0501073_0095842 | |||
| 1345 | Ga0501073_0105334 | |||
| 1346 | Ga0501074_0011471 | |||
| 1347 | Ga0501074_0045027 | |||
| 1348 | Ga0501074_0074660 | |||
| 1349 | Ga0501076_0192187 | |||
| 1350 | Ga0501225_0019101 | |||
| 1351 | Ga0501079_0088971 | |||
| 1352 | Ga0501080_0007181 | |||
| 1353 | Ga0501080_0025316 | |||
| 1354 | Ga0501080_0083733 | |||
| 1355 | Ga0501080_0095923 | |||
| 1356 | Ga0501080_0106868 | |||
| 1357 | Ga0501080_0134390 | |||
| 1358 | Ga0501083_0010617 | |||
| 1359 | Ga0501035_0004891 | |||
| 1360 | Ga0501035_0024640 | |||
| 1361 | Ga0501035_0025400 | |||
| 1362 | Ga0501035_0031392 | |||
| 1363 | Ga0501035_0050164 | |||
| 1364 | Ga0501035_0066898 | |||
| 1365 | Ga0501035_0122499 | |||
| 1366 | Ga0501044_0004108 | |||
| 1367 | Ga0501044_0006723 | |||
| 1368 | Ga0501044_0009324 | |||
| 1369 | Ga0501044_0169216 | |||
| 1370 | Ga0501045_0011376 | |||
| 1371 | nmdc:mga00v17_105035_c1 | |||
| 1372 | nmdc:mga00v17_32326_c1 | |||
| 1373 | nmdc:mga00v17_32479_c1 | |||
| 1374 | nmdc:mga00v17_476_c1 | |||
| 1375 | nmdc:mga0sz30_84315_c1 | |||
| 1376 | Ga0500651_0001642 | |||
| 1377 | Ga0500568_0006147 | |||
| 1378 | Ga0500620_008421 | |||
| 1379 | Ga0500634_0000363 | |||
| 1380 | Ga0501084_0235396 | |||
| 1381 | Ga0501082_0000107 | |||
| 1382 | Ga0466962_0064733 | |||
| 1383 | 2525558490 | |||
| 1384 | 2547503502 | |||
| 1385 | 2572255794 | |||
| 1386 | 2578457118 | |||
| 1387 | 2595448977 | |||
| 1388 | 2595452866 | |||
| 1389 | 2630650472 | |||
| 1390 | 2643816049 | |||
| 1391 | 2643881015 | |||
| 1392 | 2643909293 | |||
| 1393 | 2643914855 | |||
| 1394 | 2643939125 | |||
| 1395 | 2643977603 | |||
| 1396 | 2644077816 | |||
| 1397 | 2644530081 | |||
| 1398 | 2644661785 | |||
| 1399 | 2644697087 | |||
| 1400 | 2644699927 | |||
| 1401 | 2721029040 | |||
| 1402 | 2735835380 | |||
| 1403 | 2739229508 | |||
| 1404 | 2747950747 | |||
| 1405 | 2748018587 | |||
| 1406 | 2765580376 | |||
| 1407 | 2816518588 | |||
| 1408 | 2819661173 | |||
| 1409 | 2842395319 | |||
| 1410 | 2842759099 | |||
| 1411 | 2842782250 | |||
| 1412 | 2842917031 | |||
| 1413 | 2842922537 | |||
| 1414 | 2852652261 | |||
| 1415 | 2852687033 | |||
| 1416 | 2857445698 | |||
| 1417 | 2874223051 | |||
| 1418 | 2884342222 | |||
| 1419 | 2884411826 | |||
| 1420 | 2894416001 | |||
| 1421 | 2895501795 | |||
| 1422 | 2895517655 | |||
| 1423 | 2895525219 | |||
| 1424 | 2895526163 | |||
| 1425 | 2919087893 | |||
| 1426 | 2919092959 | |||
| 1427 | 2919131186 | |||
| 1428 | 2919137354 | |||
| 1429 | 2919407899 | |||
| 1430 | 2919517002 | |||
| 1431 | 2919678864 | |||
| 1432 | 2923517292 | |||
| 1433 | 2928498947 | |||
| 1434 | 2929196426 | |||
| 1435 | 2931383488 | |||
| 1436 | 2937615029 | |||
| 1437 | 2939589690 | |||
| 1438 | 2939614042 | |||
| 1439 | 2939624234 | |||
| 1440 | 2939630670 | |||
| 1441 | 2941474678 | |||
| 1442 | 2941478877 | |||
| 1443 | 2941492494 | |||
| 1444 | 2953996995 | |||
| 1445 | 2961049816 | |||
| 1446 | 2961066503 | |||
| 1447 | 2974307755 | |||
| 1448 | 2977248475 | |||
| 1449 | 2984517039 | |||
| 1450 | 2987608653 | |||
| 1451 | 2995953247 | |||
| 1452 | 8002869917 | |||
| 1453 | 8003017402 | |||
| 1454 | 8021624978 | |||
| 1455 | 8021626759 | |||
| 1456 | 8021650087 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3k2q-assembly1.cif.gz_A | crystal structure of pyrophosphate-dependent phosphofructokinase from marinobacter aquaeolei, northeast structural genomics consortium target mqr88 | 0.9776 | 3 | 415 |
| 3hno-assembly4.cif.gz_D-5 | crystal structure of pyrophosphate-dependent phosphofructokinase from nitrosospira multiformis. northeast structural genomics consortium target id nmr42 | 0.9693 | 2 | 416 |
| 3hno-assembly1.cif.gz_C | crystal structure of pyrophosphate-dependent phosphofructokinase from nitrosospira multiformis. northeast structural genomics consortium target id nmr42 | 0.9674 | 5 | 416 |
| 3k2q-assembly1.cif.gz_A | crystal structure of pyrophosphate-dependent phosphofructokinase from marinobacter aquaeolei, northeast structural genomics consortium target mqr88 | 0.9653 | 3 | 415 |
| 3hno-assembly4.cif.gz_D-5 | crystal structure of pyrophosphate-dependent phosphofructokinase from nitrosospira multiformis. northeast structural genomics consortium target id nmr42 | 0.9645 | 2 | 416 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3k2qC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphofructokinase domain | 0.9733 | 139 | 385 | 3.40.50.460 |
| 3k2qC02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphofructokinase domain | 0.9678 | 139 | 385 | 3.40.50.460 |
| 3k2qC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9677 | 3 | 415 | 3.40.50.450 |
| 3k2qC01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9461 | 3 | 415 | 3.40.50.450 |
| af_A0A0R4ITA8_404_544_3.40.50.450 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9026 | 5 | 148 | 3.40.50.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2R7NRU1-F1-model_v4 | deleted | 0.9958 | 1 | 241 |
|
| AF-A0A2R7NRU1-F1-model_v4 | deleted | 0.9917 | 1 | 241 |
|
| AF-T1AJY1-F1-model_v4 | 6-phosphofructokinase | 0.9887 | 3 | 202 |
GO:0003872
GO:0006002 GO:0046872 |
| AF-A0A3C0T6E7-F1-model_v4 | 6-phosphofructokinase (EC 2.7.1.11) | 0.9861 | 4 | 154 |
GO:0003872
GO:0046872 GO:0047334 |
| AF-A0A7C5WE77-F1-model_v4 | Diphosphate--fructose-6-phosphate 1-phosphotransferase (EC 2.7.1.90) | 0.9832 | 4 | 178 |
GO:0003872
GO:0046872 GO:0047334 |