F477806

General Info

Members Datasets Scaffolds Average Seq Length
728 375 1456 419

Family's Representative Sequence

Representative Sequence 3300025923|Ga0207681_10016898|Ga0207681_100168983
Length 455
Sequence MARPPGSGSSGQAIHGPGVRGRSGRLVGVRSARGPSAMPAGTLLYAQSGGVTAVINATASAVIAEARARKVKVFAARNGILGALREELIDTSKESAAAIRALAHTPGGAFGSCRVKLKSLDADRGRYERLLAVLRAHDVRWFLYNGGNDSADTANKVSKLAAEFGYPLTCIGVPKTVDNDLAVTDCCPGFGSAAKYTAVSVREAALDVAAMAETSTKVFVYEAMGRHAGWLAAAAGLAGRTADDAPHLILFPERPYDEADFLARVGKIVARVGYCVVVASEGIQTADGKFVADAGAGSDSFGHTQLGGVASFLAGRVKDALGMKVHWTLPDYLQRSARHLASKTDVEQALAVGKAAVRLALAGRNATMPVIVRTADKPYRWKIAEAKLDDVANREKKMPPGFIRKDGYGITAAARSYLEPLIRGEAPPPYGRDGLPAYVALKNVAVKKKLPAWAG

Samples

Sample ID Description Type Environment
1 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
11 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
31 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
32 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
33 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
92 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
98 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
108 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
109 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
112 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
113 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
114 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
118 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
126 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
170 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
171 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
172 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
175 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
178 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
182 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
192 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
193 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
196 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
197 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
198 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
199 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
200 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
201 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
202 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
203 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
204 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
205 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
206 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
207 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
208 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
209 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
210 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
211 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
212 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
213 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
217 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
220 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
236 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
237 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
238 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
239 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
240 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
241 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
242 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
279 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
295 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
296 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
297 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
298 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
299 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
302 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
303 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
304 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
305 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
306 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
307 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
308 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
309 2643221559 Lysobacter sp. Root559 Isolate Unclassified
310 2643221573 Lysobacter sp. Root604 Isolate Unclassified
311 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
312 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
313 2643221586 Lysobacter sp. Root667 Isolate Unclassified
314 2643221593 Lysobacter sp. Root690 Isolate Unclassified
315 2643221612 Lysobacter sp. Root76 Isolate Unclassified
316 2643221695 Lysobacter sp. Root494 Isolate Unclassified
317 2643221720 Lysobacter sp. Root916 Isolate Unclassified
318 2643221727 Lysobacter sp. Root96 Isolate Unclassified
319 2643221728 Lysobacter sp. Root983 Isolate Unclassified
320 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
321 2734482264 Dyella sp. AD052 Isolate Unclassified
322 2738543009 Luteibacter sp. OK325 Isolate Unclassified
323 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
324 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
325 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
326 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
327 2818991457 Xanthomonas translucens 569 Isolate Unclassified
328 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
329 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
330 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
331 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
332 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
333 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
334 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
335 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
336 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
337 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
338 2884411467 Dyella sp. AD56 Isolate Rhizosphere
339 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
340 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
341 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
342 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
343 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
344 2919085039 Luteibacter sp. 1214 Isolate Unclassified
345 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
346 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
347 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
348 2919404418 Luteibacter sp. 3190 Isolate Unclassified
349 2919513703 Luteimonas sp. 3794 Isolate Unclassified
350 2919675420 Luteimonas terrae 4099 Isolate Unclassified
351 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
352 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
353 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
354 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
355 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
356 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
357 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
358 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
359 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
360 2941471342 Luteibacter sp. 621 Isolate Unclassified
361 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
362 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
363 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
364 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
365 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
366 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
367 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
368 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
369 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
370 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
371 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
372 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
373 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
374 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
375 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.74
Metatranscriptomes 1.1
Isolates 10.16

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 17.31
Nodule 0.14
Rhizoplane 2.34
Rhizosphere 64.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207681_10016898 3300025923 Bacteria 4575
2 SwRhRL2b_contig_1053233 2162886007 Bacteria 3250
3 SwRhRL2b_contig_1073745 2162886007 Bacteria 6170
4 JGI24741J21665_1007320 3300001915 Bacteria 2148
5 JGI24735J21928_10000400 3300002067 Bacteria 15108
6 JGI24738J21930_10001530 3300002075 Bacteria 6384
7 JGI25156J39149_1004995 3300002705 Bacteria 3917
8 JGI25162J39368_1000239 3300002737 Bacteria 54751
9 JGI25157J39369_1000720 3300002741 Bacteria 17683
10 JGI25164J39214_1000200 3300002772 Bacteria 50877
11 JGI25164J39214_1000605 3300002772 Bacteria 15553
12 JGI25152J39213_1000057 3300002773 Bacteria 75426
13 JGI25150J39212_1000150 3300002774 Bacteria 39306
14 JGI25151J46595_10000109 3300003187 Bacteria 112044
15 JGI25151J46595_10000118 3300003187 Bacteria 106502
16 JGI25165J46597_1000319 3300003214 Bacteria 57885
17 JGI25153J46596_10000084 3300003215 Bacteria 112044
18 Ga0006554J51385_1037292 3300003567 Bacteria 1295
19 Ga0006562J51391_1035852 3300003578 Bacteria 12060
20 Ga0006562J51391_1035855 3300003578 Bacteria 1380
21 Ga0055539_1001249 3300003752 Bacteria 5101
22 Ga0055533_1002005 3300003756 Bacteria 4957
23 Ga0055533_1004847 3300003756 Bacteria 2314
24 Ga0055527_1000331 3300003760 Bacteria 25227
25 Ga0055535_1000242 3300003761 Bacteria 57885
26 Ga0055535_1000715 3300003761 Bacteria 25227
27 Ga0055542_1000298 3300003762 Bacteria 55290
28 Ga0055542_1000741 3300003762 Bacteria 25227
29 Ga0055529_1000437 3300003763 Bacteria 41881
30 Ga0055529_1000648 3300003763 Bacteria 25227
31 Ga0055526_1000082 3300003771 Bacteria 87106
32 Ga0055526_1009936 3300003771 Bacteria 4502
33 Ga0055537_1000228 3300003773 Bacteria 41108
34 Ga0055537_1000526 3300003773 Bacteria 22324
35 Ga0055537_1002379 3300003773 Bacteria 6363
36 Ga0055537_1003609 3300003773 Bacteria 4706
37 Ga0055524_1000138 3300003775 Bacteria 87106
38 Ga0055524_1010765 3300003775 Bacteria 3619
39 Ga0055536_1001681 3300003781 Bacteria 13113
40 Ga0055536_1002692 3300003781 Bacteria 9861
41 Ga0055536_1002705 3300003781 Bacteria 9838
42 Ga0055536_1018107 3300003781 Bacteria 2271
43 Ga0055534_1000056 3300003784 Bacteria 87106
44 Ga0055534_1000121 3300003784 Bacteria 57849
45 Ga0055528_1000061 3300003790 Bacteria 87106
46 Ga0055528_1000148 3300003790 Bacteria 57842
47 Ga0055530_10000618 3300003791 Bacteria 30889
48 Ga0055530_10001089 3300003791 Bacteria 21346
49 Ga0055530_10007041 3300003791 Bacteria 4836
50 Ga0055531_10002801 3300003794 Bacteria 11433
51 Ga0055531_10012704 3300003794 Bacteria 3936
52 Ga0055531_10021543 3300003794 Bacteria 2495
53 Ga0055531_10024411 3300003794 Bacteria 2232
54 Ga0055531_10027325 3300003794 Bacteria 2006
55 Ga0058692_1000013 3300003856 Bacteria 316299
56 Ga0058692_1000045 3300003856 Bacteria 115083
57 Ga0065165_1000887 3300005262 Bacteria 38644
58 Ga0065704_10074566 3300005289 Bacteria 6181
59 Ga0065704_10077370 3300005289 Bacteria 4752
60 Ga0070658_10007494 3300005327 Bacteria 8806
61 Ga0070658_10225831 3300005327 Bacteria 1584
62 Ga0070676_10028577 3300005328 Bacteria 3168
63 Ga0070670_100008187 3300005331 Bacteria 8902
64 Ga0070670_100236672 3300005331 Bacteria 1589
65 Ga0070666_10000082 3300005335 Bacteria 68562
66 Ga0070666_10105244 3300005335 Bacteria 1948
67 Ga0070680_100002369 3300005336 Bacteria 13928
68 Ga0070680_100007340 3300005336 Bacteria 8407
69 Ga0070680_100054184 3300005336 Bacteria 3274
70 Ga0070660_100225558 3300005339 Bacteria 1524
71 Ga0070689_100016007 3300005340 Bacteria 5483
72 Ga0070691_10019838 3300005341 Bacteria 3103
73 Ga0070661_100132961 3300005344 Bacteria 1870
74 Ga0070661_100139754 3300005344 Bacteria 1824
75 Ga0070668_100003260 3300005347 Bacteria 11969
76 Ga0070668_100022562 3300005347 Bacteria 4759
77 Ga0070668_100121805 3300005347 Bacteria 2086
78 Ga0070671_100106817 3300005355 Bacteria 2350
79 Ga0070671_100108444 3300005355 Bacteria 2332
80 Ga0070667_100000049 3300005367 Bacteria 158483
81 Ga0070667_100005927 3300005367 Bacteria 10173
82 Ga0070667_100043089 3300005367 Bacteria 3787
83 Ga0070714_100001179 3300005435 Bacteria 18812
84 Ga0070711_100141624 3300005439 Bacteria 1804
85 Ga0070663_100029791 3300005455 Bacteria 3734
86 Ga0070663_100039763 3300005455 Bacteria 3289
87 Ga0070678_100012380 3300005456 Bacteria 5299
88 Ga0070681_10000484 3300005458 Bacteria 32437
89 Ga0070681_10000534 3300005458 Bacteria 31253
90 Ga0070681_10016654 3300005458 Bacteria 7338
91 Ga0070679_100000571 3300005530 Bacteria 31258
92 Ga0070679_100001635 3300005530 Bacteria 20192
93 Ga0070679_100011025 3300005530 Bacteria 8594
94 Ga0070679_100015323 3300005530 Bacteria 7366
95 Ga0068853_100002452 3300005539 Bacteria 13881
96 Ga0068853_100039875 3300005539 Bacteria 4006
97 Ga0068853_100170234 3300005539 Bacteria 1970
98 Ga0070672_100030579 3300005543 Bacteria 4047
99 Ga0070672_100055265 3300005543 Bacteria 3110
100 Ga0070696_100048086 3300005546 Bacteria 2960
101 Ga0070696_100048090 3300005546 Bacteria 2960
102 Ga0070693_100021970 3300005547 Bacteria 3386
103 Ga0070693_100024780 3300005547 Bacteria 3222
104 Ga0070665_100000028 3300005548 Bacteria 351357
105 Ga0070665_100030082 3300005548 Bacteria 5464
106 Ga0070665_100053199 3300005548 Bacteria 4060
107 Ga0068855_100008568 3300005563 Bacteria 12365
108 Ga0070664_100068581 3300005564 Bacteria 3032
109 Ga0070664_100105137 3300005564 Bacteria 2458
110 Ga0068857_100046813 3300005577 Bacteria 3838
111 Ga0068857_100127717 3300005577 Bacteria 2291
112 Ga0068856_100013243 3300005614 Bacteria 7987
113 Ga0068852_100006366 3300005616 Bacteria 8528
114 Ga0068860_100076943 3300005843 Bacteria 3173
115 Ga0068860_100087722 3300005843 Bacteria 2962
116 Ga0068862_100000215 3300005844 Bacteria 64251
117 Ga0081540_1004974 3300005983 Bacteria 9993
118 Ga0081539_10012422 3300005985 Bacteria 6565
119 Ga0075364_10001706 3300006051 Bacteria 12075
120 Ga0075364_10047836 3300006051 Bacteria 2787
121 Ga0075369_10008855 3300006186 Bacteria 3889
122 Ga0097621_100037463 3300006237 Bacteria 3885
123 Ga0068871_100060646 3300006358 Bacteria 3086
124 Ga0105251_10006095 3300009011 Bacteria 7764
125 Ga0105251_10008644 3300009011 Bacteria 6106
126 Ga0105244_10019129 3300009036 Bacteria 3830
127 Ga0105244_10024400 3300009036 Bacteria 3301
128 Ga0105244_10041213 3300009036 Bacteria 2393
129 Ga0105240_10002481 3300009093 Bacteria 29651
130 Ga0105240_10034520 3300009093 Bacteria 6523
131 Ga0105240_10117805 3300009093 Bacteria 3201
132 Ga0105240_10143850 3300009093 Bacteria 2848
133 Ga0105245_10160528 3300009098 Bacteria 2133
134 Ga0105245_10168283 3300009098 Bacteria 2085
135 Ga0105247_10004712 3300009101 Bacteria 8693
136 Ga0105241_10089015 3300009174 Bacteria 2432
137 Ga0105242_10116648 3300009176 Bacteria 2284
138 Ga0105238_10009665 3300009551 Bacteria 9652
139 Ga0105238_10123451 3300009551 Bacteria 2569
140 Ga0105238_10274005 3300009551 Bacteria 1668
141 Ga0105239_10001637 3300010375 Bacteria 29547
142 Ga0105239_10040173 3300010375 Bacteria 5125
143 Ga0105239_10105472 3300010375 Bacteria 3121
144 Ga0105239_10205338 3300010375 Bacteria 2208
145 Ga0157371_10000184 3300013102 Bacteria 92100
146 Ga0157371_10037971 3300013102 Bacteria 3446
147 Ga0157370_10006151 3300013104 Bacteria 13317
148 Ga0157370_10007352 3300013104 Bacteria 12015
149 Ga0157370_10021551 3300013104 Bacteria 6420
150 Ga0157370_10032654 3300013104 Bacteria 5082
151 Ga0157370_10036214 3300013104 Bacteria 4790
152 Ga0157370_10081183 3300013104 Bacteria 3052
153 Ga0157369_10021566 3300013105 Bacteria 7205
154 Ga0157369_10097397 3300013105 Bacteria 3138
155 Ga0157378_10066474 3300013297 Bacteria 3229
156 Ga0163162_10020366 3300013306 Bacteria 6517
157 Ga0163162_10053837 3300013306 Bacteria 4045
158 Ga0157372_10005781 3300013307 Bacteria 13174
159 Ga0157372_10029020 3300013307 Bacteria 6036
160 Ga0157372_10041430 3300013307 Bacteria 5092
161 Ga0157372_10278022 3300013307 Bacteria 1946
162 Ga0182008_10000473 3300014497 Bacteria 30750
163 Ga0182008_10008140 3300014497 Bacteria 5738
164 Ga0182008_10013637 3300014497 Bacteria 4270
165 Ga0182008_10055826 3300014497 Bacteria 1952
166 Ga0157379_10115658 3300014968 Bacteria 2411
167 Ga0157379_10356893 3300014968 Bacteria 1339
168 Ga0157376_10048547 3300014969 Bacteria 3511
169 Ga0157376_10365257 3300014969 Bacteria 1385
170 Ga0182006_1000461 3300015261 Bacteria 31892
171 Ga0182006_1001147 3300015261 Bacteria 16817
172 Ga0182006_1011101 3300015261 Bacteria 3978
173 Ga0182006_1013092 3300015261 Bacteria 3610
174 Ga0182006_1020517 3300015261 Bacteria 2768
175 Ga0182006_1023914 3300015261 Bacteria 2527
176 Ga0182006_1038452 3300015261 Bacteria 1892
177 Ga0182007_10000118 3300015262 Bacteria 54536
178 Ga0182007_10013264 3300015262 Bacteria 3148
179 Ga0182005_1000999 3300015265 Bacteria 12169
180 Ga0182005_1001072 3300015265 Bacteria 11527
181 Ga0182005_1001074 3300015265 Bacteria 11526
182 Ga0182005_1001234 3300015265 Bacteria 10590
183 Ga0182005_1001964 3300015265 Bacteria 7725
184 Ga0183368_1007 3300015687 Bacteria 405609
185 Ga0183360_10003 3300015689 Bacteria 713221
186 Ga0163161_10000766 3300017792 Bacteria 25292
187 Ga0163161_10000891 3300017792 Bacteria 23193
188 Ga0163161_10018430 3300017792 Bacteria 4892
189 Ga0163161_10021086 3300017792 Bacteria 4579
190 Ga0206356_10628665 3300020070 Bacteria 2829
191 Ga0206356_11804033 3300020070 Bacteria 2601
192 Ga0206354_10819979 3300020081 Bacteria 2619
193 Ga0206354_11580386 3300020081 Bacteria 2784
194 Ga0224712_10027171 3300022467 Bacteria 2033
195 Ga0209435_101970 3300025206 Bacteria 2473
196 Ga0209760_100623 3300025207 Bacteria 6034
197 Ga0209784_100163 3300025224 Bacteria 57927
198 Ga0209674_100037 3300025226 Bacteria 404339
199 Ga0209674_100058 3300025226 Bacteria 286902
200 Ga0209674_101812 3300025226 Bacteria 5118
201 Ga0209672_100061 3300025228 Bacteria 206098
202 Ga0209672_102507 3300025228 Bacteria 4432
203 Ga0209147_106306 3300025229 Bacteria 1657
204 Ga0207427_100196 3300025231 Bacteria 57937
205 Ga0209437_100345 3300025233 Bacteria 54531
206 Ga0209437_100894 3300025233 Bacteria 12005
207 Ga0209258_100054 3300025242 Bacteria 339063
208 Ga0209258_100384 3300025242 Bacteria 56539
209 Ga0209258_100514 3300025242 Bacteria 37294
210 Ga0207425_1000045 3300025245 Bacteria 194257
211 Ga0209646_1004443 3300025246 Bacteria 2554
212 Ga0209026_1000286 3300025250 Bacteria 57937
213 Ga0209026_1009861 3300025250 Bacteria 1833
214 Ga0209677_101425 3300025253 Bacteria 10326
215 Ga0209148_1000047 3300025254 Bacteria 434369
216 Ga0209148_1000066 3300025254 Bacteria 339063
217 Ga0209148_1000912 3300025254 Bacteria 19949
218 Ga0209759_1001948 3300025256 Bacteria 9984
219 Ga0209129_1000057 3300025258 Bacteria 253632
220 Ga0209129_1000331 3300025258 Bacteria 41001
221 Ga0209233_1000100 3300025261 Bacteria 293905
222 Ga0209565_1000002 3300025263 Bacteria 1423083
223 Ga0209565_1000023 3300025263 Bacteria 388244
224 Ga0209565_1004811 3300025263 Bacteria 4039
225 Ga0209455_1000101 3300025272 Bacteria 206098
226 Ga0209455_1000270 3300025272 Bacteria 57937
227 Ga0209673_1000002 3300025273 Bacteria 1423083
228 Ga0209673_1000047 3300025273 Bacteria 289276
229 Ga0209673_1005603 3300025273 Bacteria 6275
230 Ga0209130_1008264 3300025284 Bacteria 3090
231 Ga0209675_1000002 3300025291 Bacteria 1423083
232 Ga0209675_1000016 3300025291 Bacteria 391965
233 Ga0209675_1008593 3300025291 Bacteria 3728
234 Ga0209676_1000027 3300025292 Bacteria 560222
235 Ga0209676_1000037 3300025292 Bacteria 457562
236 Ga0209676_1000160 3300025292 Bacteria 161069
237 Ga0209676_1000796 3300025292 Bacteria 41705
238 Ga0209676_1000830 3300025292 Bacteria 40120
239 Ga0209676_1003891 3300025292 Bacteria 8704
240 Ga0209025_1000013 3300025294 Bacteria 871757
241 Ga0209025_1000200 3300025294 Bacteria 146048
242 Ga0209025_1007913 3300025294 Bacteria 7783
243 Ga0209564_1000004 3300025295 Bacteria 1424639
244 Ga0209564_1000194 3300025295 Bacteria 141518
245 Ga0209564_1003164 3300025295 Bacteria 11586
246 Ga0209758_1000014 3300025297 Bacteria 871757
247 Ga0209758_1014135 3300025297 Bacteria 4275
248 Ga0209758_1018063 3300025297 Bacteria 3477
249 Ga0209758_1023548 3300025297 Bacteria 2781
250 Ga0209050_1000462 3300025298 Bacteria 72638
251 Ga0209050_1000971 3300025298 Bacteria 36685
252 Ga0209050_1002489 3300025298 Bacteria 15573
253 Ga0209050_1011478 3300025298 Bacteria 4192
254 Ga0209050_1034076 3300025298 Bacteria 1531
255 Ga0209256_1000004 3300025299 Bacteria 1424643
256 Ga0209256_1001572 3300025299 Bacteria 22464
257 Ga0209256_1002300 3300025299 Bacteria 16021
258 Ga0209256_1010730 3300025299 Bacteria 3784
259 Ga0207426_1003250 3300025302 Bacteria 9107
260 Ga0209051_1004177 3300025303 Bacteria 9022
261 Ga0209051_1005461 3300025303 Bacteria 7418
262 Ga0209051_1008798 3300025303 Bacteria 5293
263 Ga0209257_1000046 3300025304 Bacteria 477765
264 Ga0209257_1000091 3300025304 Bacteria 270637
265 Ga0209257_1000177 3300025304 Bacteria 161069
266 Ga0209257_1000499 3300025304 Bacteria 70103
267 Ga0209257_1002803 3300025304 Bacteria 16393
268 Ga0209257_1003235 3300025304 Bacteria 14334
269 Ga0209257_1021122 3300025304 Bacteria 2377
270 Ga0207713_1006743 3300025735 Bacteria 6933
271 Ga0207713_1017270 3300025735 Bacteria 3627
272 Ga0207710_10002997 3300025900 Bacteria 7626
273 Ga0207680_10000003 3300025903 Bacteria 925264
274 Ga0207647_10000130 3300025904 Bacteria 58985
275 Ga0207647_10002143 3300025904 Bacteria 15080
276 Ga0207647_10011433 3300025904 Bacteria 6225
277 Ga0207647_10034228 3300025904 Bacteria 3245
278 Ga0207645_10085680 3300025907 Bacteria 2023
279 Ga0207705_10000400 3300025909 Bacteria 38159
280 Ga0207705_10001982 3300025909 Bacteria 15917
281 Ga0207705_10004563 3300025909 Bacteria 10460
282 Ga0207705_10049895 3300025909 Bacteria 3012
283 Ga0207705_10186261 3300025909 Bacteria 1568
284 Ga0207707_10000020 3300025912 Bacteria 205480
285 Ga0207707_10003170 3300025912 Bacteria 14597
286 Ga0207707_10012604 3300025912 Bacteria 7346
287 Ga0207707_10035320 3300025912 Bacteria 4371
288 Ga0207695_10001663 3300025913 Bacteria 35807
289 Ga0207695_10002173 3300025913 Bacteria 29659
290 Ga0207695_10028244 3300025913 Bacteria 6226
291 Ga0207695_10041475 3300025913 Bacteria 4927
292 Ga0207695_10242399 3300025913 Bacteria 1704
293 Ga0207660_10000726 3300025917 Bacteria 21921
294 Ga0207660_10000950 3300025917 Bacteria 19197
295 Ga0207660_10005901 3300025917 Bacteria 7956
296 Ga0207660_10039120 3300025917 Bacteria 3314
297 Ga0207660_10065311 3300025917 Bacteria 2629
298 Ga0207657_10014239 3300025919 Bacteria 7774
299 Ga0207657_10026757 3300025919 Bacteria 5293
300 Ga0207657_10141840 3300025919 Bacteria 1963
301 Ga0207649_10005191 3300025920 Bacteria 7035
302 Ga0207649_10008579 3300025920 Bacteria 5576
303 Ga0207649_10079274 3300025920 Bacteria 2121
304 Ga0207649_10100528 3300025920 Bacteria 1913
305 Ga0207652_10000037 3300025921 Bacteria 134369
306 Ga0207652_10000753 3300025921 Bacteria 31143
307 Ga0207652_10002384 3300025921 Bacteria 15874
308 Ga0207652_10012358 3300025921 Bacteria 6899
309 Ga0207652_10012736 3300025921 Bacteria 6799
310 Ga0207652_10115855 3300025921 Bacteria 2380
311 Ga0207694_10001777 3300025924 Bacteria 18014
312 Ga0207694_10040592 3300025924 Bacteria 3583
313 Ga0207694_10093456 3300025924 Bacteria 2375
314 Ga0207694_10103780 3300025924 Bacteria 2255
315 Ga0207650_10129227 3300025925 Bacteria 1975
316 Ga0207664_10000856 3300025929 Bacteria 20600
317 Ga0207690_10000657 3300025932 Bacteria 22118
318 Ga0207690_10033037 3300025932 Bacteria 3324
319 Ga0207690_10048257 3300025932 Bacteria 2830
320 Ga0207709_10007956 3300025935 Bacteria 5875
321 Ga0207691_10018245 3300025940 Bacteria 6647
322 Ga0207691_10071615 3300025940 Bacteria 3128
323 Ga0207661_10004484 3300025944 Bacteria 9791
324 Ga0207667_10000633 3300025949 Bacteria 45505
325 Ga0207667_10019918 3300025949 Bacteria 7475
326 Ga0207667_10081769 3300025949 Bacteria 3346
327 Ga0207667_10129844 3300025949 Bacteria 2595
328 Ga0207667_10216350 3300025949 Bacteria 1963
329 Ga0207640_10001068 3300025981 Bacteria 15187
330 Ga0207658_10004314 3300025986 Bacteria 9902
331 Ga0207639_10003456 3300026041 Bacteria 10631
332 Ga0207639_10004090 3300026041 Bacteria 9839
333 Ga0207639_10095816 3300026041 Bacteria 2386
334 Ga0207678_10007384 3300026067 Bacteria 9730
335 Ga0207678_10199694 3300026067 Bacteria 1710
336 Ga0207678_10211547 3300026067 Bacteria 1659
337 Ga0207702_10001784 3300026078 Bacteria 21201
338 Ga0207702_10003564 3300026078 Bacteria 14163
339 Ga0207702_10004508 3300026078 Bacteria 12357
340 Ga0207641_10055975 3300026088 Bacteria 3350
341 Ga0207648_10045518 3300026089 Bacteria 3849
342 Ga0207674_10042443 3300026116 Bacteria 4697
343 Ga0207674_10104040 3300026116 Bacteria 2818
344 Ga0207683_10022177 3300026121 Bacteria 5450
345 Ga0207683_10098701 3300026121 Bacteria 2606
346 Ga0207698_10000844 3300026142 Bacteria 17776
347 Ga0207698_10010069 3300026142 Bacteria 6055
348 Ga0207698_10096317 3300026142 Bacteria 2438
349 Ga0209371_1000007 3300027312 Bacteria 1050654
350 Ga0209371_1000043 3300027312 Bacteria 331009
351 Ga0209969_1003965 3300027360 Bacteria 2062
352 Ga0209995_1005763 3300027471 Bacteria 1991
353 Ga0209999_1000892 3300027543 Bacteria 4997
354 Ga0209982_1002226 3300027552 Bacteria 2713
355 Ga0209983_1001615 3300027665 Bacteria 4992
356 Ga0209971_1003771 3300027682 Bacteria 3584
357 Ga0209974_10008710 3300027876 Bacteria 3458
358 Ga0268266_10000017 3300028379 Bacteria 607272
359 Ga0268266_10001303 3300028379 Bacteria 30308
360 Ga0268265_10002016 3300028380 Bacteria 15950
361 Ga0268265_10040381 3300028380 Bacteria 3446
362 Ga0268265_10064291 3300028380 Bacteria 2826
363 Ga0268264_10071166 3300028381 Bacteria 2946
364 Ga0268256_1000008 3300030500 Bacteria 1050654
365 Ga0268256_1000044 3300030500 Bacteria 330997
366 Ga0316176_1021304 3300030732 Bacteria 6206
367 Ga0314311_1061056 3300030733 Bacteria 4109
368 Ga0316182_1116479 3300030745 Bacteria 2007
369 Ga0307513_10023179 3300031456 Bacteria 7261
370 Ga0316575_10006346 3300031665 Bacteria 4244
371 Ga0316579_10001744 3300031691 Bacteria 7995
372 Ga0307413_10015817 3300031824 Bacteria 3877
373 Ga0307413_10166906 3300031824 Bacteria 1553
374 Ga0307406_10002976 3300031901 Bacteria 9237
375 Ga0307406_10032774 3300031901 Bacteria 3174
376 Ga0307412_10001279 3300031911 Bacteria 14087
377 Ga0307412_10016904 3300031911 Bacteria 4358
378 Ga0307416_100171282 3300032002 Bacteria 2021
379 Ga0307414_10011174 3300032004 Bacteria 5253
380 Ga0307414_10015898 3300032004 Bacteria 4558
381 Ga0307414_10020978 3300032004 Bacteria 4085
382 Ga0316583_10000604 3300032133 Bacteria 10925
383 Ga0307507_10101030 3300033179 Bacteria 2414
384 Ga0307510_10006141 3300033180 Bacteria 14318
385 Ga0316582_0005132 3300036647 Bacteria 6700
386 Ga0395899_0000410 3300037312 Bacteria 50063
387 Ga0395899_0041522 3300037312 Bacteria 3437
388 Ga0395900_0000206 3300037418 Bacteria 92782
389 Ga0395900_0000656 3300037418 Bacteria 46333
390 Ga0395900_0006056 3300037418 Bacteria 12613
391 Ga0395900_0118044 3300037418 Bacteria 2722
392 Ga0395898_0000120 3300037466 Bacteria 209091
393 Ga0395905_0007372 3300037471 Bacteria 10948
394 Ga0316581_0002944 3300037588 Bacteria 4175
395 Ga0395901_0048413 3300038443 Bacteria 4414
396 Ga0395901_0087189 3300038443 Bacteria 3263
397 Ga0237819_01949 3300038705 Bacteria 4673
398 Ga0237819_04535 3300038705 Bacteria 2276
399 Ga0237816_00200 3300039145 Bacteria 4858
400 Ga0439436_0000019 3300041404 Bacteria 70584
401 Ga0439436_0007235 3300041404 Bacteria 3414
402 Ga0439465_0000101 3300041413 Bacteria 19683
403 Ga0439465_0000251 3300041413 Bacteria 14747
404 Ga0439465_0002026 3300041413 Bacteria 6654
405 Ga0439465_0004478 3300041413 Bacteria 4516
406 Ga0451791_0109322 3300041451 Bacteria 1888
407 Ga0451793_0932637 3300041452 Bacteria 2115
408 Ga0451793_1725027 3300041452 Bacteria 1756
409 Ga0451795_0364400 3300041456 Bacteria 1477
410 Ga0451800_0257622 3300041459 Bacteria 2952
411 Ga0451806_400478 3300041462 Bacteria 3594
412 Ga0451807_0625853 3300041486 Bacteria 2180
413 Ga0451807_1319978 3300041486 Bacteria 3003
414 Ga0451837_1141630 3300041494 Bacteria 3802
415 Ga0439432_011465 3300042006 Bacteria 3055
416 Ga0439449_0000013 3300042007 Bacteria 51317
417 Ga0439449_0018849 3300042007 Bacteria 2587
418 Ga0439449_0031544 3300042007 Bacteria 1975
419 Ga0439449_0034696 3300042007 Bacteria 1878
420 Ga0439449_0066769 3300042007 Bacteria 1326
421 Ga0450908_000141 3300042184 Bacteria 14773
422 Ga0451577_0005118 3300042876 Bacteria 13510
423 Ga0439440_0008626 3300042993 Bacteria 2097
424 Ga0466982_0000363 3300044672 Bacteria 12817
425 Ga0466966_0017909 3300044684 Bacteria 4677
426 Ga0466961_0001089 3300044693 Bacteria 16718
427 Ga0466961_0004931 3300044693 Bacteria 8390
428 Ga0466961_0028811 3300044693 Bacteria 3571
429 Ga0466963_0101388 3300044694 Bacteria 1971
430 Ga0466968_0001582 3300044735 Bacteria 8202
431 Ga0466970_0000349 3300044765 Bacteria 22379
432 Ga0466957_0108549 3300044842 Bacteria 1758
433 Ga0466959_0000848 3300045049 Bacteria 18039
434 Ga0466959_0022566 3300045049 Bacteria 4654
435 Ga0466967_0270997 3300045976 Bacteria 1627
436 Ga0495617_000409 3300046452 Bacteria 23631
437 Ga0495627_013403 3300046453 Bacteria 2884
438 Ga0495638_0000904 3300046460 Bacteria 30331
439 Ga0495638_0000949 3300046460 Bacteria 29412
440 Ga0495638_0007280 3300046460 Bacteria 7954
441 Ga0495638_0062570 3300046460 Bacteria 2297
442 Ga0495650_0001191 3300046471 Bacteria 27568
443 Ga0495650_0001431 3300046471 Bacteria 23089
444 Ga0495650_0002629 3300046471 Bacteria 14054
445 Ga0495584_0003052 3300046491 Bacteria 9299
446 Ga0495585_0001595 3300046492 Bacteria 17521
447 Ga0495607_0001268 3300046501 Bacteria 22571
448 Ga0495607_0028874 3300046501 Bacteria 3416
449 Ga0495607_0063475 3300046501 Bacteria 2089
450 Ga0495606_0002137 3300046507 Bacteria 23864
451 Ga0495606_0003479 3300046507 Bacteria 16682
452 Ga0495610_0005438 3300046512 Bacteria 9050
453 Ga0495610_0006040 3300046512 Bacteria 8455
454 Ga0495610_0009237 3300046512 Bacteria 6253
455 Ga0495616_0000831 3300046513 Bacteria 22547
456 Ga0495616_0013202 3300046513 Bacteria 4667
457 Ga0495620_0000889 3300046515 Bacteria 18374
458 Ga0495620_0004160 3300046515 Bacteria 8203
459 Ga0495631_0000970 3300046518 Bacteria 17785
460 Ga0495631_0002549 3300046518 Bacteria 10212
461 Ga0495632_0000005 3300046519 Bacteria 362872
462 Ga0495632_0003976 3300046519 Bacteria 10244
463 Ga0495643_0002409 3300046522 Bacteria 14870
464 Ga0495643_0036896 3300046522 Bacteria 2683
465 Ga0495648_0003467 3300046524 Bacteria 13867
466 Ga0495663_0002548 3300046525 Bacteria 5451
467 Ga0495663_0003056 3300046525 Bacteria 4902
468 Ga0495598_0002608 3300046537 Bacteria 3732
469 Ga0495621_0000071 3300046539 Bacteria 20126
470 Ga0495622_0064377 3300046557 Bacteria 1696
471 Ga0495656_0011880 3300046615 Bacteria 3202
472 Ga0495656_0045777 3300046615 Bacteria 1848
473 Ga0495611_0000450 3300046648 Bacteria 24925
474 Ga0495625_0027977 3300046660 Bacteria 4233
475 Ga0495625_0050251 3300046660 Bacteria 2992
476 Ga0495625_0131158 3300046660 Bacteria 1697
477 Ga0495659_0015760 3300046664 Bacteria 2487
478 Ga0495670_0003672 3300046691 Bacteria 7544
479 Ga0495670_0019986 3300046691 Bacteria 3300
480 Ga0495649_0013875 3300046694 Bacteria 4633
481 Ga0495660_0001723 3300046810 Bacteria 14619
482 Ga0495636_0004585 3300047318 Bacteria 5414
483 Ga0495636_0021834 3300047318 Bacteria 2585
484 Ga0495672_0000720 3300047320 Bacteria 36381
485 Ga0495673_0000038 3300047469 Bacteria 303785
486 Ga0495673_0000685 3300047469 Bacteria 33195
487 Ga0495686_0000050 3300047472 Bacteria 269010
488 Ga0495686_0003791 3300047472 Bacteria 12840
489 Ga0495686_0012899 3300047472 Bacteria 5825
490 Ga0495686_0019561 3300047472 Bacteria 4524
491 Ga0495686_0066576 3300047472 Bacteria 2225
492 Ga0496101_0002985 3300048904 Bacteria 10421
493 Ga0496101_0242056 3300048904 Bacteria 1404
494 Ga0496105_0003721 3300048908 Bacteria 11354
495 Ga0496106_0004672 3300048909 Bacteria 10156
496 Ga0496108_0010770 3300048911 Bacteria 7423
497 Ga0496110_0202523 3300048913 Bacteria 1803
498 Ga0496111_0059907 3300048914 Bacteria 2758
499 Ga0496112_0028515 3300048915 Bacteria 5389
500 Ga0496115_0001176 3300048918 Bacteria 18772
501 Ga0496116_0042323 3300048919 Bacteria 3115
502 Ga0496116_0053819 3300048919 Bacteria 2656
503 Ga0496117_0000854 3300048920 Bacteria 47114
504 Ga0496117_0011491 3300048920 Bacteria 7926
505 Ga0496117_0019373 3300048920 Bacteria 5592
506 Ga0496117_0025775 3300048920 Bacteria 4613
507 Ga0496117_0029320 3300048920 Bacteria 4244
508 Ga0496117_0037246 3300048920 Bacteria 3626
509 Ga0496118_0000383 3300048921 Bacteria 74507
510 Ga0496118_0003037 3300048921 Bacteria 21644
511 Ga0496118_0003339 3300048921 Bacteria 20305
512 Ga0496118_0011558 3300048921 Bacteria 8601
513 Ga0496118_0014596 3300048921 Bacteria 7343
514 Ga0496118_0060609 3300048921 Bacteria 2808
515 Ga0496118_0107100 3300048921 Bacteria 1867
516 Ga0496119_0000069 3300048922 Bacteria 155265
517 Ga0496119_0000725 3300048922 Bacteria 44399
518 Ga0496119_0037936 3300048922 Bacteria 3121
519 Ga0496120_0000517 3300048923 Bacteria 59950
520 Ga0496120_0000821 3300048923 Bacteria 44390
521 Ga0496120_0000884 3300048923 Bacteria 42219
522 Ga0496121_0001206 3300048924 Bacteria 45212
523 Ga0496121_0004869 3300048924 Bacteria 17644
524 Ga0496121_0005164 3300048924 Bacteria 16951
525 Ga0496121_0008379 3300048924 Bacteria 12189
526 Ga0496121_0029483 3300048924 Bacteria 5072
527 Ga0496121_0065141 3300048924 Bacteria 2966
528 Ga0496121_0085247 3300048924 Bacteria 2487
529 Ga0496122_0000315 3300048925 Bacteria 106323
530 Ga0496122_0000710 3300048925 Bacteria 65728
531 Ga0496122_0001858 3300048925 Bacteria 32188
532 Ga0496122_0009208 3300048925 Bacteria 10456
533 Ga0496122_0016132 3300048925 Bacteria 7097
534 Ga0496122_0021458 3300048925 Bacteria 5782
535 Ga0496122_0106628 3300048925 Bacteria 1854
536 Ga0496123_0000104 3300048926 Bacteria 168230
537 Ga0496123_0000149 3300048926 Bacteria 142962
538 Ga0496123_0000323 3300048926 Bacteria 91212
539 Ga0496123_0013735 3300048926 Bacteria 6770
540 Ga0496123_0020809 3300048926 Bacteria 5119
541 Ga0496124_0000006 3300048927 Bacteria 904259
542 Ga0496124_0000403 3300048927 Bacteria 78615
543 Ga0496124_0000516 3300048927 Bacteria 66627
544 Ga0496124_0013382 3300048927 Bacteria 8011
545 Ga0496124_0013693 3300048927 Bacteria 7900
546 Ga0496124_0022642 3300048927 Bacteria 5753
547 Ga0496124_0025084 3300048927 Bacteria 5405
548 Ga0496124_0037721 3300048927 Bacteria 4200
549 Ga0496125_0001475 3300048928 Bacteria 34001
550 Ga0496125_0009290 3300048928 Bacteria 10140
551 Ga0496125_0012399 3300048928 Bacteria 8465
552 Ga0496125_0012472 3300048928 Bacteria 8433
553 Ga0496125_0045364 3300048928 Bacteria 3700
554 Ga0496126_0000913 3300048929 Bacteria 51086
555 Ga0496126_0032202 3300048929 Bacteria 4942
556 Ga0501031_0037701 3300049568 Bacteria 3155
557 Ga0501032_0005214 3300049569 Bacteria 9671
558 Ga0501032_0016205 3300049569 Bacteria 5243
559 Ga0501032_0017375 3300049569 Bacteria 5051
560 Ga0501032_0048436 3300049569 Bacteria 2869
561 Ga0501033_0001723 3300049570 Bacteria 19140
562 Ga0501033_0005108 3300049570 Bacteria 10439
563 Ga0501034_0000521 3300049571 Bacteria 61943
564 Ga0501034_0007682 3300049571 Bacteria 11473
565 Ga0501034_0009730 3300049571 Bacteria 10049
566 Ga0501034_0014956 3300049571 Bacteria 7982
567 Ga0501034_0022350 3300049571 Bacteria 6445
568 Ga0501034_0041727 3300049571 Bacteria 4642
569 Ga0501034_0135595 3300049571 Bacteria 2442
570 Ga0501036_0027814 3300049572 Bacteria 4780
571 Ga0501036_0041912 3300049572 Bacteria 3874
572 Ga0501036_0059017 3300049572 Bacteria 3250
573 Ga0501036_0077230 3300049572 Bacteria 2817
574 Ga0501037_0035956 3300049573 Bacteria 3650
575 Ga0501037_0059619 3300049573 Bacteria 2783
576 Ga0501038_0001563 3300049574 Bacteria 21191
577 Ga0501038_0006223 3300049574 Bacteria 11035
578 Ga0501038_0015956 3300049574 Bacteria 6825
579 Ga0501038_0190851 3300049574 Bacteria 1649
580 Ga0501039_0017388 3300049575 Bacteria 5515
581 Ga0501039_0024068 3300049575 Bacteria 4676
582 Ga0501039_0066515 3300049575 Bacteria 2798
583 Ga0501042_0036100 3300049578 Bacteria 3506
584 Ga0501043_0009768 3300049579 Bacteria 7521
585 Ga0501043_0016408 3300049579 Bacteria 5806
586 Ga0501043_0023271 3300049579 Bacteria 4858
587 Ga0501043_0026485 3300049579 Bacteria 4548
588 Ga0501043_0031800 3300049579 Bacteria 4148
589 Ga0501043_0084877 3300049579 Bacteria 2489
590 Ga0501046_0003875 3300049580 Bacteria 13681
591 Ga0501046_0004129 3300049580 Bacteria 13232
592 Ga0501047_0005660 3300049581 Bacteria 11765
593 Ga0501047_0007103 3300049581 Bacteria 10516
594 Ga0501047_0040857 3300049581 Bacteria 4484
595 Ga0501047_0044769 3300049581 Bacteria 4277
596 Ga0501047_0061680 3300049581 Bacteria 3617
597 Ga0501047_0091774 3300049581 Bacteria 2915
598 Ga0501047_0099175 3300049581 Bacteria 2792
599 Ga0501048_0033636 3300049582 Bacteria 3702
600 Ga0501048_0145225 3300049582 Bacteria 1678
601 Ga0501067_0021653 3300049583 Bacteria 3557
602 Ga0501069_0000559 3300049585 Bacteria 17150
603 Ga0501070_0011009 3300049586 Bacteria 7635
604 Ga0501070_0033622 3300049586 Bacteria 4292
605 Ga0501070_0040497 3300049586 Bacteria 3884
606 Ga0501070_0056101 3300049586 Bacteria 3265
607 Ga0501070_0056592 3300049586 Bacteria 3250
608 Ga0501070_0089487 3300049586 Bacteria 2547
609 Ga0501070_0090312 3300049586 Bacteria 2535
610 Ga0501070_0134897 3300049586 Bacteria 2038
611 Ga0501071_0010240 3300049587 Bacteria 6276
612 Ga0501071_0055605 3300049587 Bacteria 2857
613 Ga0501072_0014884 3300049588 Bacteria 5962
614 Ga0501073_0033345 3300049589 Bacteria 3667
615 Ga0501073_0055366 3300049589 Bacteria 2775
616 Ga0501073_0095842 3300049589 Bacteria 2060
617 Ga0501073_0105334 3300049589 Bacteria 1957
618 Ga0501074_0011471 3300049590 Bacteria 6445
619 Ga0501074_0045027 3300049590 Bacteria 3192
620 Ga0501074_0074660 3300049590 Bacteria 2434
621 Ga0501076_0192187 3300049592 Bacteria 1666
622 Ga0501225_0019101 3300049705 Bacteria 1897
623 Ga0501079_0088971 3300049741 Bacteria 2391
624 Ga0501080_0007181 3300049742 Bacteria 10054
625 Ga0501080_0025316 3300049742 Bacteria 5506
626 Ga0501080_0083733 3300049742 Bacteria 2963
627 Ga0501080_0095923 3300049742 Bacteria 2753
628 Ga0501080_0106868 3300049742 Bacteria 2593
629 Ga0501080_0134390 3300049742 Bacteria 2289
630 Ga0501083_0010617 3300049744 Bacteria 6483
631 Ga0501035_0004891 3300049822 Bacteria 12712
632 Ga0501035_0024640 3300049822 Bacteria 5516
633 Ga0501035_0025400 3300049822 Bacteria 5431
634 Ga0501035_0031392 3300049822 Bacteria 4838
635 Ga0501035_0050164 3300049822 Bacteria 3740
636 Ga0501035_0066898 3300049822 Bacteria 3188
637 Ga0501035_0122499 3300049822 Bacteria 2272
638 Ga0501044_0004108 3300049823 Bacteria 16325
639 Ga0501044_0006723 3300049823 Bacteria 12679
640 Ga0501044_0009324 3300049823 Bacteria 10708
641 Ga0501044_0169216 3300049823 Bacteria 2157
642 Ga0501045_0011376 3300049824 Bacteria 6248
643 nmdc:mga00v17_105035_c1 3300050491 Bacteria 1787
644 nmdc:mga00v17_32326_c1 3300050491 Bacteria 3092
645 nmdc:mga00v17_32479_c1 3300050491 Bacteria 3086
646 nmdc:mga00v17_476_c1 3300050491 Bacteria 22518
647 nmdc:mga0sz30_84315_c1 3300050516 Bacteria 1378
648 Ga0500651_0001642 3300053093 Bacteria 11382
649 Ga0500568_0006147 3300053139 Bacteria 6074
650 Ga0500620_008421 3300053155 Bacteria 2604
651 Ga0500634_0000363 3300053161 Bacteria 14395
652 Ga0501084_0235396 3300054114 Bacteria 1546
653 Ga0501082_0000107 3300060353 Bacteria 65178
654 Ga0466962_0064733 3300061719 Bacteria 1745
655 2525558490 2524614729 Bacteria 3091755
656 2547503502 2547132130 Bacteria 4660562
657 2572255794 2571042365 Bacteria 3289345
658 2578457118 2576861471 Bacteria 4648976
659 2595448977 2593339238 Bacteria 4182970
660 2595452866 2593339239 Bacteria 4124669
661 2630650472 2627854209 Bacteria 3093011
662 2643816049 2643221559 Bacteria 4424915
663 2643881015 2643221573 Bacteria 4784121
664 2643909293 2643221579 Bacteria 4443405
665 2643914855 2643221581 Bacteria 3893603
666 2643939125 2643221586 Bacteria 4446529
667 2643977603 2643221593 Bacteria 6296053
668 2644077816 2643221612 Bacteria 4361984
669 2644530081 2643221695 Bacteria 3441323
670 2644661785 2643221720 Bacteria 4694283
671 2644697087 2643221727 Bacteria 4415595
672 2644699927 2643221728 Bacteria 4797149
673 2721029040 2718218334 Bacteria 4765486
674 2735835380 2734482264 Unclassified 5014763
675 2739229508 2738543009 Bacteria 4944499
676 2747950747 2747842428 Bacteria 4689383
677 2748018587 2747842501 Bacteria 5293829
678 2765580376 2765235840 Bacteria 4663337
679 2816518588 2816332141 Bacteria 4436036
680 2819661173 2818991457 Bacteria 5323295
681 2842395319 2842391507 Bacteria 4486072
682 2842759099 2842757796 Bacteria 3981385
683 2842782250 2842780639 Bacteria 4337790
684 2842917031 2842914999 Bacteria 4419378
685 2842922537 2842918807 Bacteria 4289178
686 2852652261 2852649853 Bacteria 4036942
687 2852687033 2852684882 Bacteria 5463342
688 2857445698 2857442823 Bacteria 4562550
689 2874223051 2874220319 Bacteria 4594709
690 2884342222 2884338543 Bacteria 4610696
691 2884411826 2884411467 Bacteria 5246714
692 2894416001 2894414249 Bacteria 4405451
693 2895501795 2895498888 Bacteria 5283788
694 2895517655 2895511927 Bacteria 6802080
695 2895525219 2895522137 Bacteria 3284416
696 2895526163 2895525241 Bacteria 3388457
697 2919087893 2919085039 Bacteria 4532964
698 2919092959 2919089067 Bacteria 4560942
699 2919131186 2919130084 Bacteria 5301837
700 2919137354 2919134579 Bacteria 4480386
701 2919407899 2919404418 Bacteria 4232372
702 2919517002 2919513703 Bacteria 3844312
703 2919678864 2919675420 Bacteria 3969095
704 2923517292 2923516293 Bacteria 3716336
705 2928498947 2928496128 Bacteria 4631123
706 2929196426 2929195423 Bacteria 5325372
707 2931383488 2931380184 Bacteria 4455911
708 2937615029 2937610967 Bacteria 4618818
709 2939589690 2939589442 Bacteria 4214238
710 2939614042 2939611941 Bacteria 3892017
711 2939624234 2939622612 Bacteria 4698046
712 2939630670 2939626828 Bacteria 4695272
713 2941474678 2941471342 Bacteria 5018624
714 2941478877 2941475908 Bacteria 4145589
715 2941492494 2941489479 Bacteria 6313767
716 2953996995 2953994433 Bacteria 4303959
717 2961049816 2961047084 Bacteria 4594415
718 2961066503 2961064222 Bacteria 4749990
719 2974307755 2974307012 Bacteria 4172388
720 2977248475 2977247770 Bacteria 4160543
721 2984517039 2984514374 Bacteria 4172479
722 2987608653 2987605356 Bacteria 4187822
723 2995953247 2995948881 Bacteria 6358104
724 8002869917 8002869464 Bacteria 3588529
725 8003017402 8003014200 Bacteria 4059994
726 8021624978 8021622325 Bacteria 4844743
727 8021626759 8021626552 Bacteria 4665214
728 8021650087 8021648035 Bacteria 4772378
729 Ga0207681_10016898
730 SwRhRL2b_contig_1053233
731 SwRhRL2b_contig_1073745
732 JGI24741J21665_1007320
733 JGI24735J21928_10000400
734 JGI24738J21930_10001530
735 JGI25156J39149_1004995
736 JGI25162J39368_1000239
737 JGI25157J39369_1000720
738 JGI25164J39214_1000200
739 JGI25164J39214_1000605
740 JGI25152J39213_1000057
741 JGI25150J39212_1000150
742 JGI25151J46595_10000109
743 JGI25151J46595_10000118
744 JGI25165J46597_1000319
745 JGI25153J46596_10000084
746 Ga0006554J51385_1037292
747 Ga0006562J51391_1035852
748 Ga0006562J51391_1035855
749 Ga0055539_1001249
750 Ga0055533_1002005
751 Ga0055533_1004847
752 Ga0055527_1000331
753 Ga0055535_1000242
754 Ga0055535_1000715
755 Ga0055542_1000298
756 Ga0055542_1000741
757 Ga0055529_1000437
758 Ga0055529_1000648
759 Ga0055526_1000082
760 Ga0055526_1009936
761 Ga0055537_1000228
762 Ga0055537_1000526
763 Ga0055537_1002379
764 Ga0055537_1003609
765 Ga0055524_1000138
766 Ga0055524_1010765
767 Ga0055536_1001681
768 Ga0055536_1002692
769 Ga0055536_1002705
770 Ga0055536_1018107
771 Ga0055534_1000056
772 Ga0055534_1000121
773 Ga0055528_1000061
774 Ga0055528_1000148
775 Ga0055530_10000618
776 Ga0055530_10001089
777 Ga0055530_10007041
778 Ga0055531_10002801
779 Ga0055531_10012704
780 Ga0055531_10021543
781 Ga0055531_10024411
782 Ga0055531_10027325
783 Ga0058692_1000013
784 Ga0058692_1000045
785 Ga0065165_1000887
786 Ga0065704_10074566
787 Ga0065704_10077370
788 Ga0070658_10007494
789 Ga0070658_10225831
790 Ga0070676_10028577
791 Ga0070670_100008187
792 Ga0070670_100236672
793 Ga0070666_10000082
794 Ga0070666_10105244
795 Ga0070680_100002369
796 Ga0070680_100007340
797 Ga0070680_100054184
798 Ga0070660_100225558
799 Ga0070689_100016007
800 Ga0070691_10019838
801 Ga0070661_100132961
802 Ga0070661_100139754
803 Ga0070668_100003260
804 Ga0070668_100022562
805 Ga0070668_100121805
806 Ga0070671_100106817
807 Ga0070671_100108444
808 Ga0070667_100000049
809 Ga0070667_100005927
810 Ga0070667_100043089
811 Ga0070714_100001179
812 Ga0070711_100141624
813 Ga0070663_100029791
814 Ga0070663_100039763
815 Ga0070678_100012380
816 Ga0070681_10000484
817 Ga0070681_10000534
818 Ga0070681_10016654
819 Ga0070679_100000571
820 Ga0070679_100001635
821 Ga0070679_100011025
822 Ga0070679_100015323
823 Ga0068853_100002452
824 Ga0068853_100039875
825 Ga0068853_100170234
826 Ga0070672_100030579
827 Ga0070672_100055265
828 Ga0070696_100048086
829 Ga0070696_100048090
830 Ga0070693_100021970
831 Ga0070693_100024780
832 Ga0070665_100000028
833 Ga0070665_100030082
834 Ga0070665_100053199
835 Ga0068855_100008568
836 Ga0070664_100068581
837 Ga0070664_100105137
838 Ga0068857_100046813
839 Ga0068857_100127717
840 Ga0068856_100013243
841 Ga0068852_100006366
842 Ga0068860_100076943
843 Ga0068860_100087722
844 Ga0068862_100000215
845 Ga0081540_1004974
846 Ga0081539_10012422
847 Ga0075364_10001706
848 Ga0075364_10047836
849 Ga0075369_10008855
850 Ga0097621_100037463
851 Ga0068871_100060646
852 Ga0105251_10006095
853 Ga0105251_10008644
854 Ga0105244_10019129
855 Ga0105244_10024400
856 Ga0105244_10041213
857 Ga0105240_10002481
858 Ga0105240_10034520
859 Ga0105240_10117805
860 Ga0105240_10143850
861 Ga0105245_10160528
862 Ga0105245_10168283
863 Ga0105247_10004712
864 Ga0105241_10089015
865 Ga0105242_10116648
866 Ga0105238_10009665
867 Ga0105238_10123451
868 Ga0105238_10274005
869 Ga0105239_10001637
870 Ga0105239_10040173
871 Ga0105239_10105472
872 Ga0105239_10205338
873 Ga0157371_10000184
874 Ga0157371_10037971
875 Ga0157370_10006151
876 Ga0157370_10007352
877 Ga0157370_10021551
878 Ga0157370_10032654
879 Ga0157370_10036214
880 Ga0157370_10081183
881 Ga0157369_10021566
882 Ga0157369_10097397
883 Ga0157378_10066474
884 Ga0163162_10020366
885 Ga0163162_10053837
886 Ga0157372_10005781
887 Ga0157372_10029020
888 Ga0157372_10041430
889 Ga0157372_10278022
890 Ga0182008_10000473
891 Ga0182008_10008140
892 Ga0182008_10013637
893 Ga0182008_10055826
894 Ga0157379_10115658
895 Ga0157379_10356893
896 Ga0157376_10048547
897 Ga0157376_10365257
898 Ga0182006_1000461
899 Ga0182006_1001147
900 Ga0182006_1011101
901 Ga0182006_1013092
902 Ga0182006_1020517
903 Ga0182006_1023914
904 Ga0182006_1038452
905 Ga0182007_10000118
906 Ga0182007_10013264
907 Ga0182005_1000999
908 Ga0182005_1001072
909 Ga0182005_1001074
910 Ga0182005_1001234
911 Ga0182005_1001964
912 Ga0183368_1007
913 Ga0183360_10003
914 Ga0163161_10000766
915 Ga0163161_10000891
916 Ga0163161_10018430
917 Ga0163161_10021086
918 Ga0206356_10628665
919 Ga0206356_11804033
920 Ga0206354_10819979
921 Ga0206354_11580386
922 Ga0224712_10027171
923 Ga0209435_101970
924 Ga0209760_100623
925 Ga0209784_100163
926 Ga0209674_100037
927 Ga0209674_100058
928 Ga0209674_101812
929 Ga0209672_100061
930 Ga0209672_102507
931 Ga0209147_106306
932 Ga0207427_100196
933 Ga0209437_100345
934 Ga0209437_100894
935 Ga0209258_100054
936 Ga0209258_100384
937 Ga0209258_100514
938 Ga0207425_1000045
939 Ga0209646_1004443
940 Ga0209026_1000286
941 Ga0209026_1009861
942 Ga0209677_101425
943 Ga0209148_1000047
944 Ga0209148_1000066
945 Ga0209148_1000912
946 Ga0209759_1001948
947 Ga0209129_1000057
948 Ga0209129_1000331
949 Ga0209233_1000100
950 Ga0209565_1000002
951 Ga0209565_1000023
952 Ga0209565_1004811
953 Ga0209455_1000101
954 Ga0209455_1000270
955 Ga0209673_1000002
956 Ga0209673_1000047
957 Ga0209673_1005603
958 Ga0209130_1008264
959 Ga0209675_1000002
960 Ga0209675_1000016
961 Ga0209675_1008593
962 Ga0209676_1000027
963 Ga0209676_1000037
964 Ga0209676_1000160
965 Ga0209676_1000796
966 Ga0209676_1000830
967 Ga0209676_1003891
968 Ga0209025_1000013
969 Ga0209025_1000200
970 Ga0209025_1007913
971 Ga0209564_1000004
972 Ga0209564_1000194
973 Ga0209564_1003164
974 Ga0209758_1000014
975 Ga0209758_1014135
976 Ga0209758_1018063
977 Ga0209758_1023548
978 Ga0209050_1000462
979 Ga0209050_1000971
980 Ga0209050_1002489
981 Ga0209050_1011478
982 Ga0209050_1034076
983 Ga0209256_1000004
984 Ga0209256_1001572
985 Ga0209256_1002300
986 Ga0209256_1010730
987 Ga0207426_1003250
988 Ga0209051_1004177
989 Ga0209051_1005461
990 Ga0209051_1008798
991 Ga0209257_1000046
992 Ga0209257_1000091
993 Ga0209257_1000177
994 Ga0209257_1000499
995 Ga0209257_1002803
996 Ga0209257_1003235
997 Ga0209257_1021122
998 Ga0207713_1006743
999 Ga0207713_1017270
1000 Ga0207710_10002997
1001 Ga0207680_10000003
1002 Ga0207647_10000130
1003 Ga0207647_10002143
1004 Ga0207647_10011433
1005 Ga0207647_10034228
1006 Ga0207645_10085680
1007 Ga0207705_10000400
1008 Ga0207705_10001982
1009 Ga0207705_10004563
1010 Ga0207705_10049895
1011 Ga0207705_10186261
1012 Ga0207707_10000020
1013 Ga0207707_10003170
1014 Ga0207707_10012604
1015 Ga0207707_10035320
1016 Ga0207695_10001663
1017 Ga0207695_10002173
1018 Ga0207695_10028244
1019 Ga0207695_10041475
1020 Ga0207695_10242399
1021 Ga0207660_10000726
1022 Ga0207660_10000950
1023 Ga0207660_10005901
1024 Ga0207660_10039120
1025 Ga0207660_10065311
1026 Ga0207657_10014239
1027 Ga0207657_10026757
1028 Ga0207657_10141840
1029 Ga0207649_10005191
1030 Ga0207649_10008579
1031 Ga0207649_10079274
1032 Ga0207649_10100528
1033 Ga0207652_10000037
1034 Ga0207652_10000753
1035 Ga0207652_10002384
1036 Ga0207652_10012358
1037 Ga0207652_10012736
1038 Ga0207652_10115855
1039 Ga0207694_10001777
1040 Ga0207694_10040592
1041 Ga0207694_10093456
1042 Ga0207694_10103780
1043 Ga0207650_10129227
1044 Ga0207664_10000856
1045 Ga0207690_10000657
1046 Ga0207690_10033037
1047 Ga0207690_10048257
1048 Ga0207709_10007956
1049 Ga0207691_10018245
1050 Ga0207691_10071615
1051 Ga0207661_10004484
1052 Ga0207667_10000633
1053 Ga0207667_10019918
1054 Ga0207667_10081769
1055 Ga0207667_10129844
1056 Ga0207667_10216350
1057 Ga0207640_10001068
1058 Ga0207658_10004314
1059 Ga0207639_10003456
1060 Ga0207639_10004090
1061 Ga0207639_10095816
1062 Ga0207678_10007384
1063 Ga0207678_10199694
1064 Ga0207678_10211547
1065 Ga0207702_10001784
1066 Ga0207702_10003564
1067 Ga0207702_10004508
1068 Ga0207641_10055975
1069 Ga0207648_10045518
1070 Ga0207674_10042443
1071 Ga0207674_10104040
1072 Ga0207683_10022177
1073 Ga0207683_10098701
1074 Ga0207698_10000844
1075 Ga0207698_10010069
1076 Ga0207698_10096317
1077 Ga0209371_1000007
1078 Ga0209371_1000043
1079 Ga0209969_1003965
1080 Ga0209995_1005763
1081 Ga0209999_1000892
1082 Ga0209982_1002226
1083 Ga0209983_1001615
1084 Ga0209971_1003771
1085 Ga0209974_10008710
1086 Ga0268266_10000017
1087 Ga0268266_10001303
1088 Ga0268265_10002016
1089 Ga0268265_10040381
1090 Ga0268265_10064291
1091 Ga0268264_10071166
1092 Ga0268256_1000008
1093 Ga0268256_1000044
1094 Ga0316176_1021304
1095 Ga0314311_1061056
1096 Ga0316182_1116479
1097 Ga0307513_10023179
1098 Ga0316575_10006346
1099 Ga0316579_10001744
1100 Ga0307413_10015817
1101 Ga0307413_10166906
1102 Ga0307406_10002976
1103 Ga0307406_10032774
1104 Ga0307412_10001279
1105 Ga0307412_10016904
1106 Ga0307416_100171282
1107 Ga0307414_10011174
1108 Ga0307414_10015898
1109 Ga0307414_10020978
1110 Ga0316583_10000604
1111 Ga0307507_10101030
1112 Ga0307510_10006141
1113 Ga0316582_0005132
1114 Ga0395899_0000410
1115 Ga0395899_0041522
1116 Ga0395900_0000206
1117 Ga0395900_0000656
1118 Ga0395900_0006056
1119 Ga0395900_0118044
1120 Ga0395898_0000120
1121 Ga0395905_0007372
1122 Ga0316581_0002944
1123 Ga0395901_0048413
1124 Ga0395901_0087189
1125 Ga0237819_01949
1126 Ga0237819_04535
1127 Ga0237816_00200
1128 Ga0439436_0000019
1129 Ga0439436_0007235
1130 Ga0439465_0000101
1131 Ga0439465_0000251
1132 Ga0439465_0002026
1133 Ga0439465_0004478
1134 Ga0451791_0109322
1135 Ga0451793_0932637
1136 Ga0451793_1725027
1137 Ga0451795_0364400
1138 Ga0451800_0257622
1139 Ga0451806_400478
1140 Ga0451807_0625853
1141 Ga0451807_1319978
1142 Ga0451837_1141630
1143 Ga0439432_011465
1144 Ga0439449_0000013
1145 Ga0439449_0018849
1146 Ga0439449_0031544
1147 Ga0439449_0034696
1148 Ga0439449_0066769
1149 Ga0450908_000141
1150 Ga0451577_0005118
1151 Ga0439440_0008626
1152 Ga0466982_0000363
1153 Ga0466966_0017909
1154 Ga0466961_0001089
1155 Ga0466961_0004931
1156 Ga0466961_0028811
1157 Ga0466963_0101388
1158 Ga0466968_0001582
1159 Ga0466970_0000349
1160 Ga0466957_0108549
1161 Ga0466959_0000848
1162 Ga0466959_0022566
1163 Ga0466967_0270997
1164 Ga0495617_000409
1165 Ga0495627_013403
1166 Ga0495638_0000904
1167 Ga0495638_0000949
1168 Ga0495638_0007280
1169 Ga0495638_0062570
1170 Ga0495650_0001191
1171 Ga0495650_0001431
1172 Ga0495650_0002629
1173 Ga0495584_0003052
1174 Ga0495585_0001595
1175 Ga0495607_0001268
1176 Ga0495607_0028874
1177 Ga0495607_0063475
1178 Ga0495606_0002137
1179 Ga0495606_0003479
1180 Ga0495610_0005438
1181 Ga0495610_0006040
1182 Ga0495610_0009237
1183 Ga0495616_0000831
1184 Ga0495616_0013202
1185 Ga0495620_0000889
1186 Ga0495620_0004160
1187 Ga0495631_0000970
1188 Ga0495631_0002549
1189 Ga0495632_0000005
1190 Ga0495632_0003976
1191 Ga0495643_0002409
1192 Ga0495643_0036896
1193 Ga0495648_0003467
1194 Ga0495663_0002548
1195 Ga0495663_0003056
1196 Ga0495598_0002608
1197 Ga0495621_0000071
1198 Ga0495622_0064377
1199 Ga0495656_0011880
1200 Ga0495656_0045777
1201 Ga0495611_0000450
1202 Ga0495625_0027977
1203 Ga0495625_0050251
1204 Ga0495625_0131158
1205 Ga0495659_0015760
1206 Ga0495670_0003672
1207 Ga0495670_0019986
1208 Ga0495649_0013875
1209 Ga0495660_0001723
1210 Ga0495636_0004585
1211 Ga0495636_0021834
1212 Ga0495672_0000720
1213 Ga0495673_0000038
1214 Ga0495673_0000685
1215 Ga0495686_0000050
1216 Ga0495686_0003791
1217 Ga0495686_0012899
1218 Ga0495686_0019561
1219 Ga0495686_0066576
1220 Ga0496101_0002985
1221 Ga0496101_0242056
1222 Ga0496105_0003721
1223 Ga0496106_0004672
1224 Ga0496108_0010770
1225 Ga0496110_0202523
1226 Ga0496111_0059907
1227 Ga0496112_0028515
1228 Ga0496115_0001176
1229 Ga0496116_0042323
1230 Ga0496116_0053819
1231 Ga0496117_0000854
1232 Ga0496117_0011491
1233 Ga0496117_0019373
1234 Ga0496117_0025775
1235 Ga0496117_0029320
1236 Ga0496117_0037246
1237 Ga0496118_0000383
1238 Ga0496118_0003037
1239 Ga0496118_0003339
1240 Ga0496118_0011558
1241 Ga0496118_0014596
1242 Ga0496118_0060609
1243 Ga0496118_0107100
1244 Ga0496119_0000069
1245 Ga0496119_0000725
1246 Ga0496119_0037936
1247 Ga0496120_0000517
1248 Ga0496120_0000821
1249 Ga0496120_0000884
1250 Ga0496121_0001206
1251 Ga0496121_0004869
1252 Ga0496121_0005164
1253 Ga0496121_0008379
1254 Ga0496121_0029483
1255 Ga0496121_0065141
1256 Ga0496121_0085247
1257 Ga0496122_0000315
1258 Ga0496122_0000710
1259 Ga0496122_0001858
1260 Ga0496122_0009208
1261 Ga0496122_0016132
1262 Ga0496122_0021458
1263 Ga0496122_0106628
1264 Ga0496123_0000104
1265 Ga0496123_0000149
1266 Ga0496123_0000323
1267 Ga0496123_0013735
1268 Ga0496123_0020809
1269 Ga0496124_0000006
1270 Ga0496124_0000403
1271 Ga0496124_0000516
1272 Ga0496124_0013382
1273 Ga0496124_0013693
1274 Ga0496124_0022642
1275 Ga0496124_0025084
1276 Ga0496124_0037721
1277 Ga0496125_0001475
1278 Ga0496125_0009290
1279 Ga0496125_0012399
1280 Ga0496125_0012472
1281 Ga0496125_0045364
1282 Ga0496126_0000913
1283 Ga0496126_0032202
1284 Ga0501031_0037701
1285 Ga0501032_0005214
1286 Ga0501032_0016205
1287 Ga0501032_0017375
1288 Ga0501032_0048436
1289 Ga0501033_0001723
1290 Ga0501033_0005108
1291 Ga0501034_0000521
1292 Ga0501034_0007682
1293 Ga0501034_0009730
1294 Ga0501034_0014956
1295 Ga0501034_0022350
1296 Ga0501034_0041727
1297 Ga0501034_0135595
1298 Ga0501036_0027814
1299 Ga0501036_0041912
1300 Ga0501036_0059017
1301 Ga0501036_0077230
1302 Ga0501037_0035956
1303 Ga0501037_0059619
1304 Ga0501038_0001563
1305 Ga0501038_0006223
1306 Ga0501038_0015956
1307 Ga0501038_0190851
1308 Ga0501039_0017388
1309 Ga0501039_0024068
1310 Ga0501039_0066515
1311 Ga0501042_0036100
1312 Ga0501043_0009768
1313 Ga0501043_0016408
1314 Ga0501043_0023271
1315 Ga0501043_0026485
1316 Ga0501043_0031800
1317 Ga0501043_0084877
1318 Ga0501046_0003875
1319 Ga0501046_0004129
1320 Ga0501047_0005660
1321 Ga0501047_0007103
1322 Ga0501047_0040857
1323 Ga0501047_0044769
1324 Ga0501047_0061680
1325 Ga0501047_0091774
1326 Ga0501047_0099175
1327 Ga0501048_0033636
1328 Ga0501048_0145225
1329 Ga0501067_0021653
1330 Ga0501069_0000559
1331 Ga0501070_0011009
1332 Ga0501070_0033622
1333 Ga0501070_0040497
1334 Ga0501070_0056101
1335 Ga0501070_0056592
1336 Ga0501070_0089487
1337 Ga0501070_0090312
1338 Ga0501070_0134897
1339 Ga0501071_0010240
1340 Ga0501071_0055605
1341 Ga0501072_0014884
1342 Ga0501073_0033345
1343 Ga0501073_0055366
1344 Ga0501073_0095842
1345 Ga0501073_0105334
1346 Ga0501074_0011471
1347 Ga0501074_0045027
1348 Ga0501074_0074660
1349 Ga0501076_0192187
1350 Ga0501225_0019101
1351 Ga0501079_0088971
1352 Ga0501080_0007181
1353 Ga0501080_0025316
1354 Ga0501080_0083733
1355 Ga0501080_0095923
1356 Ga0501080_0106868
1357 Ga0501080_0134390
1358 Ga0501083_0010617
1359 Ga0501035_0004891
1360 Ga0501035_0024640
1361 Ga0501035_0025400
1362 Ga0501035_0031392
1363 Ga0501035_0050164
1364 Ga0501035_0066898
1365 Ga0501035_0122499
1366 Ga0501044_0004108
1367 Ga0501044_0006723
1368 Ga0501044_0009324
1369 Ga0501044_0169216
1370 Ga0501045_0011376
1371 nmdc:mga00v17_105035_c1
1372 nmdc:mga00v17_32326_c1
1373 nmdc:mga00v17_32479_c1
1374 nmdc:mga00v17_476_c1
1375 nmdc:mga0sz30_84315_c1
1376 Ga0500651_0001642
1377 Ga0500568_0006147
1378 Ga0500620_008421
1379 Ga0500634_0000363
1380 Ga0501084_0235396
1381 Ga0501082_0000107
1382 Ga0466962_0064733
1383 2525558490
1384 2547503502
1385 2572255794
1386 2578457118
1387 2595448977
1388 2595452866
1389 2630650472
1390 2643816049
1391 2643881015
1392 2643909293
1393 2643914855
1394 2643939125
1395 2643977603
1396 2644077816
1397 2644530081
1398 2644661785
1399 2644697087
1400 2644699927
1401 2721029040
1402 2735835380
1403 2739229508
1404 2747950747
1405 2748018587
1406 2765580376
1407 2816518588
1408 2819661173
1409 2842395319
1410 2842759099
1411 2842782250
1412 2842917031
1413 2842922537
1414 2852652261
1415 2852687033
1416 2857445698
1417 2874223051
1418 2884342222
1419 2884411826
1420 2894416001
1421 2895501795
1422 2895517655
1423 2895525219
1424 2895526163
1425 2919087893
1426 2919092959
1427 2919131186
1428 2919137354
1429 2919407899
1430 2919517002
1431 2919678864
1432 2923517292
1433 2928498947
1434 2929196426
1435 2931383488
1436 2937615029
1437 2939589690
1438 2939614042
1439 2939624234
1440 2939630670
1441 2941474678
1442 2941478877
1443 2941492494
1444 2953996995
1445 2961049816
1446 2961066503
1447 2974307755
1448 2977248475
1449 2984517039
1450 2987608653
1451 2995953247
1452 8002869917
1453 8003017402
1454 8021624978
1455 8021626759
1456 8021650087

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00365

PFK

Phosphofructokinase

42

397

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k2q-assembly1.cif.gz_A crystal structure of pyrophosphate-dependent phosphofructokinase from marinobacter aquaeolei, northeast structural genomics consortium target mqr88 0.9776 3 415
3hno-assembly4.cif.gz_D-5 crystal structure of pyrophosphate-dependent phosphofructokinase from nitrosospira multiformis. northeast structural genomics consortium target id nmr42 0.9693 2 416
3hno-assembly1.cif.gz_C crystal structure of pyrophosphate-dependent phosphofructokinase from nitrosospira multiformis. northeast structural genomics consortium target id nmr42 0.9674 5 416
3k2q-assembly1.cif.gz_A crystal structure of pyrophosphate-dependent phosphofructokinase from marinobacter aquaeolei, northeast structural genomics consortium target mqr88 0.9653 3 415
3hno-assembly4.cif.gz_D-5 crystal structure of pyrophosphate-dependent phosphofructokinase from nitrosospira multiformis. northeast structural genomics consortium target id nmr42 0.9645 2 416
ID Description Score Start End Superfamily
3k2qC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphofructokinase domain 0.9733 139 385 3.40.50.460
3k2qC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphofructokinase domain 0.9678 139 385 3.40.50.460
3k2qC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9677 3 415 3.40.50.450
3k2qC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9461 3 415 3.40.50.450
af_A0A0R4ITA8_404_544_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9026 5 148 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A2R7NRU1-F1-model_v4 deleted 0.9958 1 241
AF-A0A2R7NRU1-F1-model_v4 deleted 0.9917 1 241
AF-T1AJY1-F1-model_v4 6-phosphofructokinase 0.9887 3 202 GO:0003872
GO:0006002
GO:0046872
AF-A0A3C0T6E7-F1-model_v4 6-phosphofructokinase (EC 2.7.1.11) 0.9861 4 154 GO:0003872
GO:0046872
GO:0047334
AF-A0A7C5WE77-F1-model_v4 Diphosphate--fructose-6-phosphate 1-phosphotransferase (EC 2.7.1.90) 0.9832 4 178 GO:0003872
GO:0046872
GO:0047334

Map