F477871

General Info

Members Datasets Scaffolds Average Seq Length
729 300 711 291

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0000008|Ga0373925_0000008_219777_220739
Length 320
Sequence MSEPWGKSEPSERASLGFHASGGGQGRSLLLDEIALATARLAEAGVDSPRADAELIAAHVHNVKRGELHSVPDKDFDARFWVDIGRRENREPLQHITGQAYFRYLELDVGPGVFVPRPETEVMTGWAIDKLRAMNVAEPVAVDLGTGSGAIALSIAQEVPRATVHAVEGDPLARSWAERNITKHVDGYTAGRVLLHAGDFTTPDPRAGLGQLAGLAGRVDLVVSNPPYIPLGSIVPPEVAEYDPPAALWSGGDGLDALRAVERVARWLLRPGGLVAVEHADVQGTAVFWIFAEEAGWRDTANHKDLTRKDRFVTAMWPGE

Samples

Sample ID Description Type Environment
1 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
2 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
3 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
4 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
5 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
6 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
7 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
8 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
9 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
10 2891562705 Microbispora tritici MT50 Isolate Unclassified
11 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
12 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
13 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
14 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
15 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
95 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
96 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
112 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
164 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
165 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
166 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
169 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
170 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
183 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
184 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
192 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
193 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
194 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
222 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
223 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
226 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
234 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
235 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
236 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
237 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
238 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
239 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
291 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
292 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
293 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
294 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
295 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
296 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
297 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
298 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
299 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
300 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.98
Metatranscriptomes 0.55
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 3.84
Rhizosphere 90.4
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10009771 3300005327 Bacteria 7705
2 Ga0070658_10099642 3300005327 Bacteria 2401
3 Ga0070676_10083182 3300005328 Bacteria 1946
4 Ga0070683_100024421 3300005329 Bacteria 5414
5 Ga0070683_100242718 3300005329 Bacteria 1713
6 Ga0070670_100292811 3300005331 Bacteria 1423
7 Ga0068869_100027085 3300005334 Bacteria 3994
8 Ga0070666_10031474 3300005335 Bacteria 3502
9 Ga0070680_100090788 3300005336 Bacteria 2528
10 Ga0070682_100091405 3300005337 Bacteria 1992
11 Ga0070660_100088562 3300005339 Bacteria 2438
12 Ga0070660_100126026 3300005339 Bacteria 2046
13 Ga0070689_100025233 3300005340 Bacteria 4464
14 Ga0070692_10055486 3300005345 Bacteria 2072
15 Ga0070692_10077983 3300005345 Bacteria 1778
16 Ga0070669_100259968 3300005353 Bacteria 1385
17 Ga0070675_100017217 3300005354 Bacteria 5741
18 Ga0070671_100440103 3300005355 Bacteria 1118
19 Ga0070673_100068458 3300005364 Bacteria 2842
20 Ga0070688_100085208 3300005365 Bacteria 2054
21 Ga0070659_100004629 3300005366 Bacteria 9827
22 Ga0070659_100012169 3300005366 Bacteria 6376
23 Ga0070667_100027789 3300005367 Bacteria 4707
24 Ga0070667_100031436 3300005367 Bacteria 4427
25 Ga0070709_10002704 3300005434 Bacteria 9582
26 Ga0070709_10006521 3300005434 Bacteria 6362
27 Ga0070709_10011999 3300005434 Bacteria 4844
28 Ga0070709_10038718 3300005434 Bacteria 2922
29 Ga0070709_10350455 3300005434 Bacteria 1091
30 Ga0070714_100002366 3300005435 Bacteria 13874
31 Ga0070714_100008688 3300005435 Bacteria 7941
32 Ga0070714_100070347 3300005435 Bacteria 3025
33 Ga0070714_100074060 3300005435 Bacteria 2951
34 Ga0070714_100162994 3300005435 Bacteria 2018
35 Ga0070714_100177425 3300005435 Bacteria 1937
36 Ga0070714_100211609 3300005435 Bacteria 1777
37 Ga0070714_100325441 3300005435 Bacteria 1438
38 Ga0070714_100506711 3300005435 Bacteria 1151
39 Ga0070714_100545505 3300005435 Bacteria 1109
40 Ga0070714_100643380 3300005435 Bacteria 1020
41 Ga0070713_100089884 3300005436 Bacteria 2639
42 Ga0070713_100143456 3300005436 Bacteria 2117
43 Ga0070713_100146278 3300005436 Bacteria 2098
44 Ga0070713_100155586 3300005436 Bacteria 2037
45 Ga0070713_100332685 3300005436 Bacteria 1405
46 Ga0070713_100502143 3300005436 Bacteria 1145
47 Ga0070710_10004727 3300005437 Bacteria 6436
48 Ga0070710_10010496 3300005437 Bacteria 4552
49 Ga0070710_10026567 3300005437 Bacteria 3077
50 Ga0070710_10051207 3300005437 Bacteria 2318
51 Ga0070711_100024014 3300005439 Bacteria 3973
52 Ga0070711_100024412 3300005439 Bacteria 3942
53 Ga0070711_100033050 3300005439 Bacteria 3443
54 Ga0070711_100086715 3300005439 Bacteria 2245
55 Ga0070711_100226688 3300005439 Bacteria 1455
56 Ga0070705_100106334 3300005440 Bacteria 1783
57 Ga0070700_100028218 3300005441 Bacteria 3336
58 Ga0070694_100212168 3300005444 Bacteria 1448
59 Ga0070708_100002852 3300005445 Bacteria 13430
60 Ga0070708_100006587 3300005445 Bacteria 9244
61 Ga0070708_100392092 3300005445 Bacteria 1309
62 Ga0070663_100008724 3300005455 Bacteria 6250
63 Ga0070678_100284186 3300005456 Bacteria 1400
64 Ga0070681_10043624 3300005458 Bacteria 4491
65 Ga0070681_10107771 3300005458 Bacteria 2726
66 Ga0070685_10004937 3300005466 Bacteria 6749
67 Ga0070685_10021753 3300005466 Bacteria 3488
68 Ga0070706_100010462 3300005467 Bacteria 8610
69 Ga0070706_100017170 3300005467 Bacteria 6684
70 Ga0070706_100078402 3300005467 Bacteria 3059
71 Ga0070706_100088320 3300005467 Bacteria 2874
72 Ga0070706_100094755 3300005467 Bacteria 2770
73 Ga0070706_100360191 3300005467 Bacteria 1355
74 Ga0070707_100001170 3300005468 Bacteria 25835
75 Ga0070707_100005202 3300005468 Bacteria 12177
76 Ga0070707_100029663 3300005468 Bacteria 5207
77 Ga0070707_100036729 3300005468 Bacteria 4675
78 Ga0070707_100037150 3300005468 Bacteria 4648
79 Ga0070707_100090829 3300005468 Bacteria 2956
80 Ga0070707_100377937 3300005468 Bacteria 1376
81 Ga0070698_100000350 3300005471 Bacteria 47668
82 Ga0070698_100000723 3300005471 Bacteria 35434
83 Ga0070698_100000957 3300005471 Bacteria 31599
84 Ga0070698_100008863 3300005471 Bacteria 10815
85 Ga0070698_100044247 3300005471 Bacteria 4560
86 Ga0070698_100115763 3300005471 Bacteria 2645
87 Ga0070698_100158856 3300005471 Bacteria 2205
88 Ga0070698_100280982 3300005471 Bacteria 1596
89 Ga0070699_100152922 3300005518 Bacteria 2041
90 Ga0070679_100024563 3300005530 Bacteria 5907
91 Ga0070679_100510331 3300005530 Bacteria 1146
92 Ga0070684_100183217 3300005535 Bacteria 1904
93 Ga0070684_100220276 3300005535 Bacteria 1731
94 Ga0070697_100005931 3300005536 Bacteria 9437
95 Ga0070697_100046324 3300005536 Bacteria 3524
96 Ga0070697_100131407 3300005536 Bacteria 2100
97 Ga0068853_100011285 3300005539 Bacteria 7249
98 Ga0068853_100082924 3300005539 Bacteria 2808
99 Ga0070672_100014724 3300005543 Bacteria 5548
100 Ga0070686_100017086 3300005544 Bacteria 4234
101 Ga0070695_100038148 3300005545 Bacteria 3030
102 Ga0070695_100049545 3300005545 Bacteria 2689
103 Ga0070696_100113989 3300005546 Bacteria 1949
104 Ga0070665_100148679 3300005548 Bacteria 2345
105 Ga0068855_100282567 3300005563 Bacteria 1842
106 Ga0068855_100350083 3300005563 Bacteria 1627
107 Ga0070664_100046581 3300005564 Bacteria 3662
108 Ga0068856_100043631 3300005614 Bacteria 4412
109 Ga0068856_100061196 3300005614 Bacteria 3719
110 Ga0068859_100054396 3300005617 Bacteria 4025
111 Ga0068859_100086257 3300005617 Bacteria 3186
112 Ga0068864_100209015 3300005618 Bacteria 1796
113 Ga0068866_10007968 3300005718 Bacteria 4448
114 Ga0068861_100307086 3300005719 Bacteria 1376
115 Ga0068863_100111980 3300005841 Bacteria 2599
116 Ga0068863_100448863 3300005841 Bacteria 1266
117 Ga0068860_100110471 3300005843 Bacteria 2628
118 Ga0081540_1000250 3300005983 Bacteria 56639
119 Ga0081540_1000386 3300005983 Bacteria 44292
120 Ga0070717_10000595 3300006028 Bacteria 23178
121 Ga0070717_10009690 3300006028 Bacteria 7250
122 Ga0070717_10011331 3300006028 Bacteria 6765
123 Ga0070717_10057455 3300006028 Bacteria 3216
124 Ga0070717_10060467 3300006028 Bacteria 3137
125 Ga0070717_10106768 3300006028 Bacteria 2384
126 Ga0070717_10222771 3300006028 Bacteria 1658
127 Ga0070717_10276882 3300006028 Bacteria 1487
128 Ga0070717_10475002 3300006028 Bacteria 1128
129 Ga0070717_10544602 3300006028 Bacteria 1051
130 Ga0070715_10005611 3300006163 Bacteria 4199
131 Ga0070715_10025036 3300006163 Bacteria 2360
132 Ga0070715_10030715 3300006163 Bacteria 2175
133 Ga0070716_100000685 3300006173 Bacteria 14478
134 Ga0070716_100001892 3300006173 Bacteria 9499
135 Ga0070716_100046503 3300006173 Bacteria 2443
136 Ga0070716_100083470 3300006173 Bacteria 1913
137 Ga0070716_100132338 3300006173 Bacteria 1578
138 Ga0070716_100214954 3300006173 Bacteria 1287
139 Ga0070712_100001777 3300006175 Bacteria 13190
140 Ga0070712_100029417 3300006175 Bacteria 3681
141 Ga0070712_100029817 3300006175 Bacteria 3660
142 Ga0070712_100042878 3300006175 Bacteria 3112
143 Ga0070712_100054448 3300006175 Bacteria 2797
144 Ga0097621_100007903 3300006237 Bacteria 7629
145 Ga0097621_100082567 3300006237 Bacteria 2676
146 Ga0097621_100258256 3300006237 Bacteria 1528
147 Ga0075431_100404941 3300006847 Bacteria 1365
148 Ga0075433_10101566 3300006852 Bacteria 2546
149 Ga0075434_100165210 3300006871 Bacteria 2233
150 Ga0075429_100043208 3300006880 Bacteria 3921
151 Ga0075436_100072291 3300006914 Bacteria 2386
152 Ga0075436_100141277 3300006914 Bacteria 1692
153 Ga0097620_100054396 3300006931 Bacteria 4025
154 Ga0097620_100086260 3300006931 Bacteria 3186
155 Ga0075435_100066923 3300007076 Bacteria 2924
156 Ga0075435_100144057 3300007076 Bacteria 2000
157 Ga0075435_100207018 3300007076 Bacteria 1663
158 Ga0099795_10045308 3300007788 Bacteria 1581
159 Ga0105240_10195121 3300009093 Bacteria 2378
160 Ga0111539_10058081 3300009094 Bacteria 4591
161 Ga0105247_10009095 3300009101 Bacteria 6046
162 Ga0114129_10156011 3300009147 Bacteria 3121
163 Ga0114129_10240302 3300009147 Bacteria 2435
164 Ga0105243_10039299 3300009148 Bacteria 3687
165 Ga0105241_10000322 3300009174 Bacteria 36168
166 Ga0105241_10075160 3300009174 Bacteria 2632
167 Ga0105241_10115484 3300009174 Bacteria 2155
168 Ga0105241_10221210 3300009174 Bacteria 1591
169 Ga0105242_10030525 3300009176 Bacteria 4304
170 Ga0105242_10411908 3300009176 Bacteria 1264
171 Ga0105248_10023243 3300009177 Bacteria 6885
172 Ga0105237_10199501 3300009545 Bacteria 2000
173 Ga0105237_10371724 3300009545 Bacteria 1434
174 Ga0105237_10492355 3300009545 Bacteria 1232
175 Ga0105249_10217050 3300009553 Bacteria 1880
176 Ga0105246_10039028 3300011119 Bacteria 3196
177 Ga0105246_10042791 3300011119 Bacteria 3068
178 Ga0157323_1001231 3300012495 Bacteria 1248
179 Ga0157342_1000213 3300012507 Bacteria 3148
180 Ga0157338_1000575 3300012515 Bacteria 2239
181 Ga0157370_10098808 3300013104 Bacteria 2736
182 Ga0157370_10270515 3300013104 Bacteria 1570
183 Ga0157369_10037673 3300013105 Bacteria 5293
184 Ga0157369_10170008 3300013105 Bacteria 2297
185 Ga0157374_10017896 3300013296 Bacteria 6246
186 Ga0157374_10431359 3300013296 Bacteria 1318
187 Ga0157378_10029606 3300013297 Bacteria 4835
188 Ga0163162_10158023 3300013306 Bacteria 2388
189 Ga0163162_10158913 3300013306 Bacteria 2381
190 Ga0157375_10029877 3300013308 Bacteria 5131
191 Ga0163163_10105634 3300014325 Bacteria 2842
192 Ga0163163_10441676 3300014325 Bacteria 1361
193 Ga0157379_10004934 3300014968 Bacteria 11448
194 Ga0157379_10011513 3300014968 Bacteria 7720
195 Ga0157376_10002413 3300014969 Bacteria 12626
196 Ga0157376_10118718 3300014969 Bacteria 2341
197 Ga0163161_10029215 3300017792 Bacteria 3919
198 Ga0206354_11210166 3300020081 Bacteria 1593
199 Ga0206353_10985336 3300020082 Bacteria 1444
200 Ga0213875_10000956 3300021388 Bacteria 20645
201 Ga0213875_10001237 3300021388 Bacteria 17240
202 Ga0213875_10004658 3300021388 Bacteria 7473
203 Ga0213875_10060207 3300021388 Bacteria 1776
204 Ga0224712_10008572 3300022467 Bacteria 3038
205 Ga0224712_10019898 3300022467 Bacteria 2271
206 Ga0224572_1004952 3300024225 Bacteria 2353
207 Ga0209148_1000401 3300025254 Bacteria 50504
208 Ga0207653_10002100 3300025885 Bacteria 6350
209 Ga0207692_10006206 3300025898 Bacteria 4839
210 Ga0207692_10008220 3300025898 Bacteria 4314
211 Ga0207692_10021468 3300025898 Bacteria 2954
212 Ga0207692_10076769 3300025898 Bacteria 1776
213 Ga0207642_10057235 3300025899 Bacteria 1792
214 Ga0207710_10065844 3300025900 Bacteria 1652
215 Ga0207688_10056819 3300025901 Bacteria 2199
216 Ga0207647_10055704 3300025904 Bacteria 2429
217 Ga0207685_10001956 3300025905 Bacteria 4562
218 Ga0207685_10012548 3300025905 Bacteria 2589
219 Ga0207699_10000107 3300025906 Bacteria 58818
220 Ga0207699_10003816 3300025906 Bacteria 7191
221 Ga0207699_10006820 3300025906 Bacteria 5555
222 Ga0207699_10011658 3300025906 Bacteria 4447
223 Ga0207699_10019626 3300025906 Bacteria 3609
224 Ga0207699_10035780 3300025906 Bacteria 2827
225 Ga0207645_10046014 3300025907 Bacteria 2788
226 Ga0207643_10006315 3300025908 Bacteria 6346
227 Ga0207705_10005871 3300025909 Bacteria 9139
228 Ga0207684_10001220 3300025910 Bacteria 28611
229 Ga0207684_10009531 3300025910 Bacteria 8569
230 Ga0207684_10023313 3300025910 Bacteria 5284
231 Ga0207684_10051337 3300025910 Bacteria 3499
232 Ga0207684_10089043 3300025910 Bacteria 2630
233 Ga0207654_10000003 3300025911 Bacteria 1030378
234 Ga0207654_10016701 3300025911 Bacteria 3826
235 Ga0207707_10045221 3300025912 Bacteria 3837
236 Ga0207707_10109248 3300025912 Bacteria 2418
237 Ga0207671_10026763 3300025914 Bacteria 4317
238 Ga0207693_10000536 3300025915 Bacteria 34408
239 Ga0207693_10003679 3300025915 Bacteria 13088
240 Ga0207693_10052608 3300025915 Bacteria 3195
241 Ga0207693_10062238 3300025915 Bacteria 2924
242 Ga0207693_10074287 3300025915 Bacteria 2662
243 Ga0207693_10182535 3300025915 Bacteria 1651
244 Ga0207693_10244888 3300025915 Bacteria 1407
245 Ga0207663_10002641 3300025916 Bacteria 8627
246 Ga0207663_10031759 3300025916 Bacteria 3128
247 Ga0207663_10040846 3300025916 Bacteria 2822
248 Ga0207663_10043707 3300025916 Bacteria 2745
249 Ga0207663_10082180 3300025916 Bacteria 2112
250 Ga0207663_10249605 3300025916 Bacteria 1305
251 Ga0207660_10029377 3300025917 Bacteria 3770
252 Ga0207660_10031722 3300025917 Bacteria 3642
253 Ga0207657_10006580 3300025919 Bacteria 12034
254 Ga0207657_10011368 3300025919 Bacteria 8843
255 Ga0207657_10031634 3300025919 Bacteria 4789
256 Ga0207652_10009647 3300025921 Bacteria 7765
257 Ga0207652_10097622 3300025921 Bacteria 2590
258 Ga0207652_10148156 3300025921 Bacteria 2101
259 Ga0207646_10000071 3300025922 Bacteria 141799
260 Ga0207646_10004644 3300025922 Bacteria 14825
261 Ga0207646_10028949 3300025922 Bacteria 5039
262 Ga0207646_10061721 3300025922 Bacteria 3345
263 Ga0207646_10062919 3300025922 Bacteria 3312
264 Ga0207687_10027601 3300025927 Bacteria 3811
265 Ga0207700_10001550 3300025928 Bacteria 13035
266 Ga0207700_10005025 3300025928 Bacteria 7868
267 Ga0207700_10008932 3300025928 Bacteria 6236
268 Ga0207700_10014749 3300025928 Bacteria 5131
269 Ga0207700_10027203 3300025928 Bacteria 4001
270 Ga0207700_10037702 3300025928 Bacteria 3503
271 Ga0207700_10082623 3300025928 Bacteria 2512
272 Ga0207700_10228877 3300025928 Bacteria 1579
273 Ga0207700_10288239 3300025928 Bacteria 1414
274 Ga0207700_10365186 3300025928 Bacteria 1259
275 Ga0207664_10000271 3300025929 Bacteria 39054
276 Ga0207664_10001093 3300025929 Bacteria 18092
277 Ga0207664_10002438 3300025929 Bacteria 12308
278 Ga0207664_10015657 3300025929 Bacteria 5512
279 Ga0207664_10019650 3300025929 Bacteria 4997
280 Ga0207664_10039991 3300025929 Bacteria 3643
281 Ga0207664_10065794 3300025929 Bacteria 2903
282 Ga0207664_10123767 3300025929 Bacteria 2168
283 Ga0207664_10163236 3300025929 Bacteria 1901
284 Ga0207664_10299627 3300025929 Bacteria 1414
285 Ga0207664_10337047 3300025929 Bacteria 1333
286 Ga0207664_10360866 3300025929 Bacteria 1287
287 Ga0207644_10082655 3300025931 Bacteria 2376
288 Ga0207644_10300170 3300025931 Bacteria 1294
289 Ga0207690_10001961 3300025932 Bacteria 12627
290 Ga0207706_10017461 3300025933 Bacteria 6465
291 Ga0207670_10256510 3300025936 Bacteria 1353
292 Ga0207669_10057412 3300025937 Bacteria 2370
293 Ga0207665_10001112 3300025939 Bacteria 18027
294 Ga0207665_10001335 3300025939 Bacteria 16622
295 Ga0207665_10024497 3300025939 Bacteria 3979
296 Ga0207665_10075627 3300025939 Bacteria 2307
297 Ga0207665_10149661 3300025939 Bacteria 1671
298 Ga0207665_10192011 3300025939 Bacteria 1484
299 Ga0207665_10216128 3300025939 Bacteria 1403
300 Ga0207691_10039540 3300025940 Bacteria 4364
301 Ga0207711_10048902 3300025941 Bacteria 3619
302 Ga0207689_10022170 3300025942 Bacteria 5340
303 Ga0207661_10037177 3300025944 Bacteria 3806
304 Ga0207661_10086843 3300025944 Bacteria 2597
305 Ga0207661_10135661 3300025944 Bacteria 2113
306 Ga0207661_10181656 3300025944 Bacteria 1838
307 Ga0207679_10173374 3300025945 Bacteria 1778
308 Ga0207667_10015792 3300025949 Bacteria 8560
309 Ga0207667_10087836 3300025949 Bacteria 3216
310 Ga0207668_10176044 3300025972 Bacteria 1683
311 Ga0207677_10150012 3300026023 Bacteria 1797
312 Ga0207639_10067133 3300026041 Bacteria 2790
313 Ga0207639_10494789 3300026041 Bacteria 1116
314 Ga0207678_10003646 3300026067 Bacteria 13847
315 Ga0207678_10050513 3300026067 Bacteria 3592
316 Ga0207708_10014032 3300026075 Bacteria 5985
317 Ga0207708_10339513 3300026075 Bacteria 1230
318 Ga0207702_10046299 3300026078 Bacteria 3661
319 Ga0207702_10047438 3300026078 Bacteria 3620
320 Ga0207641_10050492 3300026088 Bacteria 3519
321 Ga0207648_10045889 3300026089 Bacteria 3832
322 Ga0207676_10011596 3300026095 Bacteria 6303
323 Ga0207674_10019631 3300026116 Bacteria 7318
324 Ga0207674_10182913 3300026116 Bacteria 2047
325 Ga0207675_100036167 3300026118 Bacteria 4606
326 Ga0207683_10009297 3300026121 Bacteria 8374
327 Ga0207428_10064810 3300027907 Bacteria 2884
328 Ga0268266_10297934 3300028379 Bacteria 1503
329 Ga0268266_10801224 3300028379 Bacteria 910
330 Ga0265337_1000159 3300028556 Bacteria 34586
331 Ga0265326_10000487 3300028558 Bacteria 15286
332 Ga0265319_1006829 3300028563 Bacteria 5220
333 Ga0265334_10000745 3300028573 Bacteria 16295
334 Ga0265318_10020736 3300028577 Bacteria 2648
335 Ga0265323_10007256 3300028653 Bacteria 4619
336 Ga0265322_10003714 3300028654 Bacteria 4595
337 Ga0265336_10005196 3300028666 Bacteria 4829
338 Ga0265338_10000246 3300028800 Bacteria 99261
339 Ga0265338_10001163 3300028800 Bacteria 43486
340 Ga0265338_10006190 3300028800 Bacteria 15341
341 Ga0265338_10007955 3300028800 Bacteria 12990
342 Ga0265332_10001531 3300031238 Bacteria 12819
343 Ga0265320_10002564 3300031240 Bacteria 12628
344 Ga0265340_10002368 3300031247 Bacteria 10730
345 Ga0265316_10041857 3300031344 Bacteria 3663
346 Ga0265313_10016183 3300031595 Bacteria 4299
347 Ga0307514_10053243 3300031649 Bacteria 3124
348 Ga0265314_10008867 3300031711 Bacteria 8586
349 Ga0265342_10030403 3300031712 Bacteria 3346
350 Ga0307516_10162015 3300031730 Bacteria 1986
351 Ga0307411_10350715 3300032005 Bacteria 1203
352 Ga0373926_0001049 3300035083 Bacteria 8117
353 Ga0373926_0007106 3300035083 Bacteria 3726
354 Ga0373934_0000290 3300035086 Bacteria 18043
355 Ga0373934_0006360 3300035086 Bacteria 4381
356 Ga0373934_0010966 3300035086 Bacteria 3408
357 Ga0373934_0013804 3300035086 Bacteria 3056
358 Ga0373934_0023058 3300035086 Bacteria 2404
359 Ga0373940_0014450 3300035088 Bacteria 1926
360 Ga0373944_0001695 3300035089 Bacteria 5576
361 Ga0373944_0080296 3300035089 Bacteria 1076
362 Ga0373951_0019994 3300035091 Bacteria 1531
363 Ga0373923_0006704 3300035111 Bacteria 4002
364 Ga0373923_0011154 3300035111 Bacteria 3289
365 Ga0373923_0014709 3300035111 Bacteria 2944
366 Ga0373923_0049710 3300035111 Bacteria 1754
367 Ga0373923_0053487 3300035111 Bacteria 1698
368 Ga0373936_0019346 3300035113 Bacteria 2638
369 Ga0373936_0038331 3300035113 Bacteria 1915
370 Ga0373936_0049912 3300035113 Bacteria 1691
371 Ga0373936_0079042 3300035113 Bacteria 1367
372 Ga0373939_0038958 3300035114 Bacteria 1420
373 Ga0373945_0006188 3300035116 Bacteria 3850
374 Ga0373945_0034052 3300035116 Bacteria 1813
375 Ga0373945_0037758 3300035116 Bacteria 1735
376 Ga0373953_0000281 3300035117 Bacteria 14084
377 Ga0373953_0001460 3300035117 Bacteria 6858
378 Ga0373953_0014187 3300035117 Bacteria 2861
379 Ga0373953_0016162 3300035117 Bacteria 2720
380 Ga0373954_0000410 3300035118 Bacteria 16026
381 Ga0373954_0012939 3300035118 Bacteria 3715
382 Ga0373954_0030493 3300035118 Bacteria 2486
383 Ga0373954_0036378 3300035118 Bacteria 2285
384 Ga0373954_0037013 3300035118 Bacteria 2266
385 Ga0373954_0041952 3300035118 Bacteria 2134
386 Ga0373956_0001346 3300035119 Bacteria 10126
387 Ga0373956_0001566 3300035119 Bacteria 9430
388 Ga0373956_0009092 3300035119 Bacteria 4029
389 Ga0373956_0013201 3300035119 Bacteria 3436
390 Ga0373956_0079576 3300035119 Bacteria 1502
391 Ga0373957_0002779 3300035120 Bacteria 5038
392 Ga0373957_0007398 3300035120 Bacteria 3513
393 Ga0373943_0000958 3300035170 Bacteria 12807
394 Ga0373943_0015727 3300035170 Bacteria 3440
395 Ga0373946_0002228 3300035171 Bacteria 6838
396 Ga0373946_0004794 3300035171 Bacteria 4868
397 Ga0373955_0000041 3300035172 Bacteria 51219
398 Ga0373955_0008076 3300035172 Bacteria 4867
399 Ga0373955_0009353 3300035172 Bacteria 4586
400 Ga0373955_0015270 3300035172 Bacteria 3755
401 Ga0373955_0048774 3300035172 Bacteria 2297
402 Ga0373955_0218982 3300035172 Bacteria 1136
403 Ga0373924_0002565 3300035410 Bacteria 6131
404 Ga0373924_0010064 3300035410 Bacteria 3481
405 Ga0373924_0018922 3300035410 Bacteria 2662
406 Ga0373924_0090093 3300035410 Bacteria 1311
407 Ga0373931_0014660 3300035691 Bacteria 3835
408 Ga0373931_0082238 3300035691 Bacteria 1780
409 Ga0373935_0009024 3300035692 Bacteria 5965
410 Ga0373935_0019782 3300035692 Bacteria 4108
411 Ga0373935_0036404 3300035692 Bacteria 3076
412 Ga0373935_0111228 3300035692 Bacteria 1818
413 Ga0373935_0140611 3300035692 Bacteria 1630
414 Ga0373927_0018103 3300035695 Bacteria 4633
415 Ga0373927_0082561 3300035695 Bacteria 2083
416 Ga0373933_0000246 3300035724 Bacteria 35782
417 Ga0373933_0000589 3300035724 Bacteria 22706
418 Ga0373933_0014754 3300035724 Bacteria 4348
419 Ga0373933_0036089 3300035724 Bacteria 2891
420 Ga0373947_0000015 3300035725 Bacteria 129181
421 Ga0373947_0015270 3300035725 Bacteria 4408
422 Ga0373947_0047457 3300035725 Bacteria 2573
423 Ga0373947_0100955 3300035725 Bacteria 1813
424 Ga0373947_0159606 3300035725 Bacteria 1457
425 Ga0373937_0000172 3300036401 Bacteria 63213
426 Ga0373937_0031728 3300036401 Bacteria 4788
427 Ga0373937_0062750 3300036401 Bacteria 3416
428 Ga0373937_0230427 3300036401 Bacteria 1744
429 Ga0373937_0269045 3300036401 Bacteria 1608
430 Ga0373937_0697680 3300036401 Bacteria 961
431 Ga0373925_0000008 3300037068 Bacteria 249158
432 Ga0373925_0002980 3300037068 Bacteria 13363
433 Ga0373925_0018624 3300037068 Bacteria 5048
434 Ga0373925_0022968 3300037068 Bacteria 4551
435 Ga0373925_0054778 3300037068 Bacteria 2983
436 Ga0373925_0074548 3300037068 Bacteria 2570
437 Ga0373925_0076000 3300037068 Bacteria 2546
438 Ga0373925_0103440 3300037068 Bacteria 2192
439 Ga0373925_0106514 3300037068 Bacteria 2161
440 Ga0373925_0108976 3300037068 Bacteria 2137
441 Ga0395900_0456786 3300037418 Bacteria 1233
442 Ga0395898_0256882 3300037466 Bacteria 1666
443 Ga0436364_0123513 3300037853 Bacteria 2014
444 Ga0436364_0180190 3300037853 Bacteria 1920
445 Ga0436364_0397052 3300037853 Bacteria 1179
446 Ga0436364_0584067 3300037853 Bacteria 157477
447 Ga0436364_0644067 3300037853 Bacteria 7596
448 Ga0436364_1380199 3300037853 Bacteria 2987
449 Ga0436364_1502227 3300037853 Bacteria 2944
450 Ga0436360_0730294 3300039438 Bacteria 871
451 Ga0436363_0686281 3300039450 Bacteria 1103
452 Ga0436363_1174479 3300039450 Bacteria 1093
453 Ga0436363_1612024 3300039450 Bacteria 1664
454 Ga0451853_2794855 3300041512 Bacteria 1526
455 Ga0466969_0136010 3300044656 Bacteria 1138
456 Ga0466966_0012618 3300044684 Bacteria 5600
457 Ga0466961_0053362 3300044693 Bacteria 2579
458 Ga0466963_0026301 3300044694 Bacteria 3721
459 Ga0466963_0514740 3300044694 Bacteria 845
460 Ga0466959_0109711 3300045049 Bacteria 1970
461 Ga0466967_0059991 3300045976 Bacteria 3369
462 Ga0466967_0070331 3300045976 Bacteria 3131
463 Ga0495592_0000417 3300046454 Bacteria 32303
464 Ga0495592_0006283 3300046454 Bacteria 8839
465 Ga0495592_0022578 3300046454 Bacteria 4786
466 Ga0495592_0026450 3300046454 Bacteria 4399
467 Ga0495592_0034414 3300046454 Bacteria 3818
468 Ga0495592_0074035 3300046454 Bacteria 2474
469 Ga0495592_0077847 3300046454 Bacteria 2403
470 Ga0495603_0005458 3300046455 Bacteria 7590
471 Ga0495603_0177565 3300046455 Bacteria 1233
472 Ga0495629_0031840 3300046459 Bacteria 3734
473 Ga0495629_0036601 3300046459 Bacteria 3463
474 Ga0495629_0213410 3300046459 Bacteria 1332
475 Ga0495641_0022457 3300046461 Bacteria 3156
476 Ga0495641_0039201 3300046461 Bacteria 2210
477 Ga0495651_0000118 3300046462 Bacteria 58414
478 Ga0495651_0001369 3300046462 Bacteria 18875
479 Ga0495651_0003084 3300046462 Bacteria 12869
480 Ga0495651_0011483 3300046462 Bacteria 6802
481 Ga0495651_0039548 3300046462 Bacteria 3671
482 Ga0495651_0116926 3300046462 Bacteria 1963
483 Ga0495651_0349492 3300046462 Bacteria 977
484 Ga0495653_0004695 3300046463 Bacteria 11060
485 Ga0495653_0016444 3300046463 Bacteria 6024
486 Ga0495653_0024624 3300046463 Bacteria 4846
487 Ga0495653_0025994 3300046463 Bacteria 4698
488 Ga0495653_0117168 3300046463 Bacteria 1903
489 Ga0495653_0131455 3300046463 Bacteria 1771
490 Ga0495580_0084392 3300046472 Bacteria 2212
491 Ga0495580_0491011 3300046472 Bacteria 820
492 Ga0495582_0016884 3300046473 Bacteria 3997
493 Ga0495639_0002595 3300046475 Bacteria 7868
494 Ga0495639_0014969 3300046475 Bacteria 3362
495 Ga0495639_0068572 3300046475 Bacteria 1635
496 Ga0495662_0001119 3300046476 Bacteria 13196
497 Ga0495662_0011609 3300046476 Bacteria 4306
498 Ga0495662_0021421 3300046476 Bacteria 3124
499 Ga0495662_0067218 3300046476 Bacteria 1734
500 Ga0495664_0003380 3300046477 Bacteria 8668
501 Ga0495664_0004752 3300046477 Bacteria 7426
502 Ga0495664_0013461 3300046477 Bacteria 4638
503 Ga0495664_0091433 3300046477 Bacteria 1829
504 Ga0495664_0104692 3300046477 Bacteria 1705
505 Ga0495594_0080164 3300046499 Bacteria 1822
506 Ga0495594_0215063 3300046499 Bacteria 1096
507 Ga0495608_0000156 3300046511 Bacteria 48856
508 Ga0495608_0011647 3300046511 Bacteria 6117
509 Ga0495608_0023347 3300046511 Bacteria 4238
510 Ga0495608_0032494 3300046511 Bacteria 3527
511 Ga0495608_0075294 3300046511 Bacteria 2200
512 Ga0495618_0020398 3300046514 Bacteria 4079
513 Ga0495618_0024807 3300046514 Bacteria 3717
514 Ga0495618_0046067 3300046514 Bacteria 2752
515 Ga0495628_0000655 3300046516 Bacteria 31697
516 Ga0495628_0042494 3300046516 Bacteria 3625
517 Ga0495628_0052004 3300046516 Bacteria 3237
518 Ga0495628_0077236 3300046516 Bacteria 2590
519 Ga0495628_0079637 3300046516 Bacteria 2547
520 Ga0495628_0112294 3300046516 Bacteria 2095
521 Ga0495630_0046639 3300046517 Bacteria 3239
522 Ga0495630_0078629 3300046517 Bacteria 2487
523 Ga0495630_0089251 3300046517 Bacteria 2328
524 Ga0495666_0025606 3300046526 Bacteria 2913
525 Ga0495666_0031604 3300046526 Bacteria 2593
526 Ga0495652_0000436 3300046529 Bacteria 48806
527 Ga0495652_0006632 3300046529 Bacteria 10749
528 Ga0495652_0025949 3300046529 Bacteria 5177
529 Ga0495652_0036265 3300046529 Bacteria 4289
530 Ga0495652_0039756 3300046529 Bacteria 4066
531 Ga0495652_0060564 3300046529 Bacteria 3198
532 Ga0495652_0071084 3300046529 Bacteria 2906
533 Ga0495652_0195392 3300046529 Bacteria 1540
534 Ga0495652_0204783 3300046529 Bacteria 1494
535 Ga0495665_0005365 3300046531 Bacteria 6907
536 Ga0495665_0005528 3300046531 Bacteria 6807
537 Ga0495665_0045817 3300046531 Bacteria 2323
538 Ga0495640_0006891 3300046533 Bacteria 8950
539 Ga0495640_0032871 3300046533 Bacteria 3691
540 Ga0495640_0036510 3300046533 Bacteria 3471
541 Ga0495640_0049003 3300046533 Bacteria 2915
542 Ga0495640_0066427 3300046533 Bacteria 2432
543 Ga0495586_0010763 3300046535 Bacteria 4863
544 Ga0495586_0028163 3300046535 Bacteria 3007
545 Ga0495586_0076951 3300046535 Bacteria 1829
546 Ga0495587_0000045 3300046536 Bacteria 108362
547 Ga0495587_0008083 3300046536 Bacteria 6783
548 Ga0495587_0008932 3300046536 Bacteria 6432
549 Ga0495587_0016389 3300046536 Bacteria 4610
550 Ga0495587_0021977 3300046536 Bacteria 3932
551 Ga0495587_0029180 3300046536 Bacteria 3350
552 Ga0495645_0027909 3300046543 Bacteria 4101
553 Ga0495645_0072391 3300046543 Bacteria 2483
554 Ga0495645_0082093 3300046543 Bacteria 2312
555 Ga0495645_0154282 3300046543 Bacteria 1592
556 Ga0495645_0198259 3300046543 Bacteria 1363
557 Ga0495645_0206632 3300046543 Bacteria 1328
558 Ga0495667_0000051 3300046559 Bacteria 109277
559 Ga0495667_0000582 3300046559 Bacteria 23327
560 Ga0495667_0026112 3300046559 Bacteria 3934
561 Ga0495667_0030093 3300046559 Bacteria 3650
562 Ga0495667_0036695 3300046559 Bacteria 3269
563 Ga0495667_0044919 3300046559 Bacteria 2925
564 Ga0495667_0209516 3300046559 Bacteria 1246
565 Ga0495634_0011770 3300046642 Bacteria 6361
566 Ga0495634_0024496 3300046642 Bacteria 4234
567 Ga0495634_0029565 3300046642 Bacteria 3792
568 Ga0495635_0008687 3300046663 Bacteria 7096
569 Ga0495635_0020163 3300046663 Bacteria 4646
570 Ga0495635_0054760 3300046663 Bacteria 2747
571 Ga0495635_0146840 3300046663 Bacteria 1605
572 Ga0495635_0364778 3300046663 Bacteria 962
573 Ga0495657_0000044 3300046675 Bacteria 108383
574 Ga0495657_0002604 3300046675 Bacteria 15088
575 Ga0495657_0015482 3300046675 Bacteria 5580
576 Ga0495657_0019907 3300046675 Bacteria 4834
577 Ga0495657_0123039 3300046675 Bacteria 1632
578 Ga0495599_0000127 3300046678 Bacteria 48710
579 Ga0495599_0002458 3300046678 Bacteria 10799
580 Ga0495599_0023220 3300046678 Bacteria 3875
581 Ga0495599_0048662 3300046678 Bacteria 2657
582 Ga0495599_0146518 3300046678 Bacteria 1463
583 Ga0495623_0004402 3300046679 Bacteria 9255
584 Ga0495623_0006558 3300046679 Bacteria 7578
585 Ga0495623_0011331 3300046679 Bacteria 5768
586 Ga0495623_0027825 3300046679 Bacteria 3639
587 Ga0495623_0109564 3300046679 Bacteria 1675
588 Ga0495646_0012163 3300046680 Bacteria 5472
589 Ga0495646_0022004 3300046680 Bacteria 4024
590 Ga0495646_0032318 3300046680 Bacteria 3256
591 Ga0495647_0009779 3300046681 Bacteria 3256
592 Ga0495658_0023317 3300046683 Bacteria 3284
593 Ga0495658_0042525 3300046683 Bacteria 2537
594 Ga0495613_0015792 3300046689 Bacteria 5620
595 Ga0495613_0027087 3300046689 Bacteria 4265
596 Ga0495613_0198978 3300046689 Bacteria 1413
597 Ga0495624_0011079 3300046690 Bacteria 6206
598 Ga0495624_0012215 3300046690 Bacteria 5880
599 Ga0495624_0017955 3300046690 Bacteria 4740
600 Ga0495624_0126074 3300046690 Bacteria 1571
601 Ga0495600_0003470 3300046809 Bacteria 9277
602 Ga0495600_0004056 3300046809 Bacteria 8707
603 Ga0495600_0010281 3300046809 Bacteria 5803
604 Ga0495600_0017757 3300046809 Bacteria 4528
605 Ga0495600_0021267 3300046809 Bacteria 4152
606 Ga0495600_0053116 3300046809 Bacteria 2646
607 Ga0495600_0113704 3300046809 Bacteria 1762
608 Ga0495581_0007508 3300047315 Bacteria 6305
609 Ga0495581_0037248 3300047315 Bacteria 2814
610 Ga0495581_0104077 3300047315 Bacteria 1649
611 Ga0495604_0000046 3300047317 Bacteria 110553
612 Ga0495604_0002826 3300047317 Bacteria 13937
613 Ga0495604_0003684 3300047317 Bacteria 12216
614 Ga0495604_0026106 3300047317 Bacteria 4650
615 Ga0495604_0061083 3300047317 Bacteria 2883
616 Ga0495604_0073132 3300047317 Bacteria 2588
617 Ga0495604_0083187 3300047317 Bacteria 2392
618 Ga0495674_0010747 3300047319 Bacteria 8658
619 Ga0495674_0033338 3300047319 Bacteria 4666
620 Ga0495674_0054936 3300047319 Bacteria 3494
621 Ga0495672_0004454 3300047320 Bacteria 11454
622 Ga0495676_0027520 3300047321 Bacteria 4872
623 Ga0495676_0029398 3300047321 Bacteria 4679
624 Ga0495676_0088314 3300047321 Bacteria 2325
625 Ga0495676_0233356 3300047321 Bacteria 1263
626 Ga0495680_0000945 3300047322 Bacteria 32299
627 Ga0495680_0003754 3300047322 Bacteria 14788
628 Ga0495680_0015977 3300047322 Bacteria 6459
629 Ga0495680_0021235 3300047322 Bacteria 5438
630 Ga0495680_0032786 3300047322 Bacteria 4212
631 Ga0495680_0033036 3300047322 Bacteria 4193
632 Ga0495680_0066575 3300047322 Bacteria 2756
633 Ga0495675_0000499 3300047444 Bacteria 25470
634 Ga0495675_0036092 3300047444 Bacteria 3155
635 Ga0495675_0049337 3300047444 Bacteria 2676
636 Ga0495675_0121489 3300047444 Bacteria 1626
637 Ga0495684_0012002 3300047471 Bacteria 6681
638 Ga0495684_0026204 3300047471 Bacteria 4479
639 Ga0495684_0032291 3300047471 Bacteria 4018
640 Ga0495684_0135878 3300047471 Bacteria 1845
641 Ga0495684_0158051 3300047471 Bacteria 1692
642 Ga0495686_0011517 3300047472 Bacteria 6230
643 Ga0495593_0015172 3300047673 Bacteria 4372
644 Ga0495593_0019542 3300047673 Bacteria 3798
645 Ga0495593_0066165 3300047673 Bacteria 1883
646 Ga0495602_0000665 3300048088 Bacteria 32273
647 Ga0495602_0001500 3300048088 Bacteria 23247
648 Ga0495602_0084491 3300048088 Bacteria 2655
649 Ga0495602_0088740 3300048088 Bacteria 2573
650 Ga0495602_0266378 3300048088 Bacteria 1268
651 Ga0495614_0037856 3300048089 Bacteria 2070
652 Ga0496101_0099527 3300048904 Bacteria 2173
653 Ga0496101_0173821 3300048904 Bacteria 1656
654 Ga0496102_0338477 3300048905 Bacteria 1417
655 Ga0496103_0021733 3300048906 Bacteria 3861
656 Ga0496104_0002603 3300048907 Bacteria 15549
657 Ga0496104_0015791 3300048907 Bacteria 6849
658 Ga0496104_0084730 3300048907 Bacteria 3024
659 Ga0496105_0015581 3300048908 Bacteria 6062
660 Ga0496105_0032722 3300048908 Bacteria 4268
661 Ga0496105_0116334 3300048908 Bacteria 2206
662 Ga0496106_0165819 3300048909 Bacteria 1749
663 Ga0496108_0003847 3300048911 Bacteria 12046
664 Ga0496108_0005347 3300048911 Bacteria 10381
665 Ga0496108_0129577 3300048911 Bacteria 2168
666 Ga0496108_0202100 3300048911 Bacteria 1724
667 Ga0496109_0019488 3300048912 Bacteria 5986
668 Ga0496109_0053525 3300048912 Bacteria 3681
669 Ga0496110_0008423 3300048913 Bacteria 8297
670 Ga0496110_0030734 3300048913 Bacteria 4631
671 Ga0496111_0003445 3300048914 Bacteria 9784
672 Ga0496112_0000614 3300048915 Bacteria 24602
673 Ga0496112_0077090 3300048915 Bacteria 3296
674 Ga0496112_0373541 3300048915 Bacteria 1367
675 Ga0496113_0016263 3300048916 Bacteria 5135
676 Ga0496113_0221947 3300048916 Bacteria 1506
677 Ga0496114_0010063 3300048917 Bacteria 7520
678 Ga0496114_0155286 3300048917 Bacteria 1987
679 Ga0496115_0114397 3300048918 Bacteria 2217
680 Ga0496126_0077381 3300048929 Bacteria 2949
681 Ga0496126_0085900 3300048929 Bacteria 2773
682 Ga0501040_0090992 3300049576 Bacteria 2121
683 nmdc:mga05p37_14396_c1 3300050507 Bacteria 9497
684 nmdc:mga05p37_654885_c1 3300050507 Bacteria 1175
685 nmdc:mga08y16_362405_c1 3300050511 Bacteria 1488
686 nmdc:mga0n895_135214_c1 3300050512 Bacteria 2492
687 nmdc:mga0n895_177728_c1 3300050512 Bacteria 2160
688 nmdc:mga0rr50_63990_c1 3300050513 Bacteria 2780
689 nmdc:mga0rr50_68983_c1 3300050513 Bacteria 2689
690 nmdc:mga0a205_251378_c1 3300050515 Bacteria 1647
691 Ga0495601_0015740 3300053077 Bacteria 4575
692 Ga0495601_0090400 3300053077 Bacteria 1969
693 Ga0495612_0004463 3300053078 Bacteria 5807
694 Ga0495595_0000195 3300053084 Bacteria 24720
695 Ga0495595_0007726 3300053084 Bacteria 4405
696 Ga0495595_0020438 3300053084 Bacteria 2882
697 Ga0495595_0045598 3300053084 Bacteria 2017
698 Ga0495619_0024309 3300053085 Bacteria 3885
699 Ga0495619_0026025 3300053085 Bacteria 3762
700 Ga0495619_0085308 3300053085 Bacteria 2132
701 Ga0495619_0114575 3300053085 Bacteria 1845
702 Ga0495619_0184119 3300053085 Bacteria 1445
703 Ga0500651_0000161 3300053093 Bacteria 43186
704 Ga0500641_0071322 3300053096 Bacteria 1462
705 Ga0500556_0000007 3300053104 Bacteria 331400
706 Ga0500559_0004968 3300053136 Bacteria 6182
707 Ga0500559_0056402 3300053136 Bacteria 1743
708 Ga0500568_0000021 3300053139 Bacteria 185406
709 Ga0500573_0109538 3300053140 Bacteria 1546
710 Ga0500577_0066615 3300053142 Bacteria 1401
711 Ga0500620_000119 3300053155 Bacteria 15657

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046472 Ga0495580_0491011 Ga0495580_0491011_31_774 201
2 3300039438 Ga0436360_0730294 Ga0436360_0730294_12_779 209
3 3300031730 Ga0307516_10162015 Ga0307516_101620153 223
4 3300041512 Ga0451853_2794855 Ga0451853_2794855_690_1511 223
5 3300044694 Ga0466963_0514740 Ga0466963_0514740_12_824 224
6 3300045976 Ga0466967_0070331 Ga0466967_0070331_2204_3031 224
7 3300048915 Ga0496112_0373541 Ga0496112_0373541_13_828 225
8 iso_pu_bacteria 2902799365 2902801942 234
9 3300013105 Ga0157369_10037673 Ga0157369_100376734 235
10 3300014325 Ga0163163_10441676 Ga0163163_104416762 235
11 3300021388 Ga0213875_10001237 Ga0213875_100012372 235
12 3300025937 Ga0207669_10057412 Ga0207669_100574122 236
13 iso_pu_bacteria 2939582691 2939584137 236
14 3300032005 Ga0307411_10350715 Ga0307411_103507152 237
15 3300047320 Ga0495672_0004454 Ga0495672_0004454_5723_6541 237
16 3300048917 Ga0496114_0155286 Ga0496114_0155286_813_1703 237
17 iso_pu_bacteria 2873314349 2873321671 237
18 3300035086 Ga0373934_0023058 Ga0373934_0023058_1517_2389 239
19 3300035111 Ga0373923_0014709 Ga0373923_0014709_617_1489 239
20 3300035118 Ga0373954_0030493 Ga0373954_0030493_1596_2468 239
21 3300037853 Ga0436364_0123513 Ga0436364_0123513_241_1113 239
22 3300046679 Ga0495623_0109564 Ga0495623_0109564_84_956 239
23 iso_pu_bacteria 8056060235 8056061732 239
24 3300005435 Ga0070714_100070347 Ga0070714_1000703472 240
25 3300005436 Ga0070713_100146278 Ga0070713_1001462783 240
26 3300005467 Ga0070706_100078402 Ga0070706_1000784023 240
27 3300005468 Ga0070707_100005202 Ga0070707_1000052024 240
28 3300005471 Ga0070698_100280982 Ga0070698_1002809822 240
29 3300025910 Ga0207684_10051337 Ga0207684_100513373 240
30 3300035119 Ga0373956_0001566 Ga0373956_0001566_5774_6697 240
31 3300005337 Ga0070682_100091405 Ga0070682_1000914052 241
32 3300005437 Ga0070710_10026567 Ga0070710_100265673 241
33 3300005471 Ga0070698_100000723 Ga0070698_10000072313 241
34 3300006163 Ga0070715_10025036 Ga0070715_100250362 241
35 3300006173 Ga0070716_100046503 Ga0070716_1000465032 241
36 3300009176 Ga0105242_10411908 Ga0105242_104119082 241
37 3300025905 Ga0207685_10012548 Ga0207685_100125483 241
38 3300025906 Ga0207699_10019626 Ga0207699_100196264 241
39 3300025928 Ga0207700_10082623 Ga0207700_100826232 241
40 3300025929 Ga0207664_10123767 Ga0207664_101237672 241
41 3300025939 Ga0207665_10075627 Ga0207665_100756272 241
42 3300035113 Ga0373936_0038331 Ga0373936_0038331_299_1177 241
43 3300035116 Ga0373945_0037758 Ga0373945_0037758_195_1073 241
44 3300035117 Ga0373953_0014187 Ga0373953_0014187_1568_2446 241
45 3300035172 Ga0373955_0009353 Ga0373955_0009353_460_1338 241
46 3300035410 Ga0373924_0018922 Ga0373924_0018922_258_1136 241
47 3300035692 Ga0373935_0019782 Ga0373935_0019782_1659_2537 241
48 3300035724 Ga0373933_0036089 Ga0373933_0036089_1847_2725 241
49 3300036401 Ga0373937_0230427 Ga0373937_0230427_489_1367 241
50 3300037068 Ga0373925_0103440 Ga0373925_0103440_1034_1912 241
51 3300039450 Ga0436363_0686281 Ga0436363_0686281_94_972 241
52 3300044684 Ga0466966_0012618 Ga0466966_0012618_3400_4266 241
53 3300044693 Ga0466961_0053362 Ga0466961_0053362_157_1023 241
54 3300045049 Ga0466959_0109711 Ga0466959_0109711_78_944 241
55 3300046454 Ga0495592_0026450 Ga0495592_0026450_3020_3898 241
56 3300046463 Ga0495653_0025994 Ga0495653_0025994_2426_3304 241
57 3300046477 Ga0495664_0003380 Ga0495664_0003380_2765_3643 241
58 3300046511 Ga0495608_0011647 Ga0495608_0011647_3528_4406 241
59 3300046514 Ga0495618_0020398 Ga0495618_0020398_1693_2571 241
60 3300046516 Ga0495628_0077236 Ga0495628_0077236_299_1177 241
61 3300046529 Ga0495652_0006632 Ga0495652_0006632_6156_7034 241
62 3300046533 Ga0495640_0036510 Ga0495640_0036510_1056_1934 241
63 3300046535 Ga0495586_0028163 Ga0495586_0028163_768_1646 241
64 3300046536 Ga0495587_0008932 Ga0495587_0008932_670_1548 241
65 3300046543 Ga0495645_0072391 Ga0495645_0072391_344_1222 241
66 3300046642 Ga0495634_0011770 Ga0495634_0011770_3535_4413 241
67 3300046678 Ga0495599_0023220 Ga0495599_0023220_501_1379 241
68 3300046680 Ga0495646_0032318 Ga0495646_0032318_1810_2688 241
69 3300046690 Ga0495624_0126074 Ga0495624_0126074_392_1270 241
70 3300046809 Ga0495600_0017757 Ga0495600_0017757_2271_3149 241
71 3300047317 Ga0495604_0073132 Ga0495604_0073132_774_1652 241
72 3300047321 Ga0495676_0233356 Ga0495676_0233356_208_1086 241
73 3300047322 Ga0495680_0021235 Ga0495680_0021235_564_1442 241
74 3300047471 Ga0495684_0012002 Ga0495684_0012002_1093_1971 241
75 3300053078 Ga0495612_0004463 Ga0495612_0004463_42_920 241
76 3300053084 Ga0495595_0007726 Ga0495595_0007726_1682_2560 241
77 iso_pu_bacteria 2643221961 2645720388 241
78 iso_pu_bacteria 2643221962 2645723329 241
79 iso_pu_bacteria 2675903060 2676494796 241
80 iso_pu_bacteria 2856741275 2856743442 241
81 iso_pu_bacteria 2884693830 2884695592 241
82 iso_pu_bacteria 2891395885 2891404505 241
83 iso_pu_bacteria 2891554331 2891561831 241
84 iso_pu_bacteria 2891562705 2891565750 241
85 iso_pu_bacteria 2895427314 2895438669 241
86 iso_pu_bacteria 2895442618 2895445701 241
87 iso_pu_bacteria 8055066027 8055072677 241
88 iso_pu_bacteria 8055172936 8055178008 241
89 3300005434 Ga0070709_10011999 Ga0070709_100119993 242
90 3300005439 Ga0070711_100086715 Ga0070711_1000867152 242
91 3300005456 Ga0070678_100284186 Ga0070678_1002841862 242
92 3300005614 Ga0068856_100061196 Ga0068856_1000611963 242
93 3300006028 Ga0070717_10106768 Ga0070717_101067682 242
94 3300006163 Ga0070715_10005611 Ga0070715_100056114 242
95 3300006173 Ga0070716_100214954 Ga0070716_1002149542 242
96 3300006175 Ga0070712_100042878 Ga0070712_1000428782 242
97 3300025906 Ga0207699_10006820 Ga0207699_100068204 242
98 3300025915 Ga0207693_10003679 Ga0207693_100036792 242
99 3300025916 Ga0207663_10249605 Ga0207663_102496052 242
100 3300025928 Ga0207700_10008932 Ga0207700_100089322 242
101 3300025929 Ga0207664_10015657 Ga0207664_100156574 242
102 3300025939 Ga0207665_10001112 Ga0207665_100011122 242
103 3300026075 Ga0207708_10339513 Ga0207708_103395131 242
104 3300028379 Ga0268266_10801224 Ga0268266_108012241 242
105 3300048904 Ga0496101_0173821 Ga0496101_0173821_461_1333 242
106 3300048907 Ga0496104_0002603 Ga0496104_0002603_5232_6104 242
107 3300048911 Ga0496108_0003847 Ga0496108_0003847_2183_3055 242
108 3300048915 Ga0496112_0000614 Ga0496112_0000614_12087_12959 242
109 3300048916 Ga0496113_0016263 Ga0496113_0016263_2686_3558 242
110 iso_pu_bacteria 2837268691 2837272330 242
111 3300005329 Ga0070683_100024421 Ga0070683_1000244214 243
112 3300005329 Ga0070683_100242718 Ga0070683_1002427181 243
113 3300005339 Ga0070660_100088562 Ga0070660_1000885622 243
114 3300005345 Ga0070692_10077983 Ga0070692_100779832 243
115 3300005434 Ga0070709_10038718 Ga0070709_100387184 243
116 3300005434 Ga0070709_10350455 Ga0070709_103504551 243
117 3300005435 Ga0070714_100008688 Ga0070714_1000086888 243
118 3300005435 Ga0070714_100074060 Ga0070714_1000740602 243
119 3300005435 Ga0070714_100162994 Ga0070714_1001629942 243
120 3300005435 Ga0070714_100177425 Ga0070714_1001774252 243
121 3300005435 Ga0070714_100325441 Ga0070714_1003254412 243
122 3300005435 Ga0070714_100506711 Ga0070714_1005067112 243
123 3300005435 Ga0070714_100643380 Ga0070714_1006433801 243
124 3300005436 Ga0070713_100143456 Ga0070713_1001434562 243
125 3300005436 Ga0070713_100502143 Ga0070713_1005021431 243
126 3300005458 Ga0070681_10107771 Ga0070681_101077712 243
127 3300005471 Ga0070698_100000957 Ga0070698_1000009579 243
128 3300005535 Ga0070684_100220276 Ga0070684_1002202762 243
129 3300005536 Ga0070697_100131407 Ga0070697_1001314071 243
130 3300005614 Ga0068856_100043631 Ga0068856_1000436314 243
131 3300005843 Ga0068860_100110471 Ga0068860_1001104712 243
132 3300006028 Ga0070717_10222771 Ga0070717_102227712 243
133 3300006028 Ga0070717_10544602 Ga0070717_105446022 243
134 3300006173 Ga0070716_100132338 Ga0070716_1001323382 243
135 3300006237 Ga0097621_100007903 Ga0097621_1000079033 243
136 3300006847 Ga0075431_100404941 Ga0075431_1004049412 243
137 3300006880 Ga0075429_100043208 Ga0075429_1000432082 243
138 3300007076 Ga0075435_100207018 Ga0075435_1002070182 243
139 3300009093 Ga0105240_10195121 Ga0105240_101951212 243
140 3300009101 Ga0105247_10009095 Ga0105247_100090952 243
141 3300009147 Ga0114129_10156011 Ga0114129_101560114 243
142 3300009174 Ga0105241_10115484 Ga0105241_101154842 243
143 3300009545 Ga0105237_10492355 Ga0105237_104923552 243
144 3300011119 Ga0105246_10039028 Ga0105246_100390282 243
145 3300013104 Ga0157370_10098808 Ga0157370_100988083 243
146 3300013104 Ga0157370_10270515 Ga0157370_102705152 243
147 3300013105 Ga0157369_10170008 Ga0157369_101700082 243
148 3300013296 Ga0157374_10017896 Ga0157374_100178964 243
149 3300013306 Ga0163162_10158023 Ga0163162_101580233 243
150 3300013308 Ga0157375_10029877 Ga0157375_100298774 243
151 3300014325 Ga0163163_10105634 Ga0163163_101056343 243
152 3300014968 Ga0157379_10004934 Ga0157379_100049346 243
153 3300014969 Ga0157376_10002413 Ga0157376_100024137 243
154 3300020082 Ga0206353_10985336 Ga0206353_109853362 243
155 3300021388 Ga0213875_10000956 Ga0213875_1000095620 243
156 3300022467 Ga0224712_10019898 Ga0224712_100198983 243
157 3300025900 Ga0207710_10065844 Ga0207710_100658442 243
158 3300025906 Ga0207699_10011658 Ga0207699_100116584 243
159 3300025910 Ga0207684_10023313 Ga0207684_100233134 243
160 3300025912 Ga0207707_10045221 Ga0207707_100452214 243
161 3300025912 Ga0207707_10109248 Ga0207707_101092482 243
162 3300025915 Ga0207693_10052608 Ga0207693_100526084 243
163 3300025917 Ga0207660_10031722 Ga0207660_100317222 243
164 3300025919 Ga0207657_10031634 Ga0207657_100316344 243
165 3300025921 Ga0207652_10009647 Ga0207652_100096477 243
166 3300025921 Ga0207652_10148156 Ga0207652_101481562 243
167 3300025927 Ga0207687_10027601 Ga0207687_100276013 243
168 3300025928 Ga0207700_10027203 Ga0207700_100272033 243
169 3300025928 Ga0207700_10228877 Ga0207700_102288772 243
170 3300025929 Ga0207664_10002438 Ga0207664_1000243812 243
171 3300025929 Ga0207664_10019650 Ga0207664_100196504 243
172 3300025929 Ga0207664_10065794 Ga0207664_100657943 243
173 3300025929 Ga0207664_10163236 Ga0207664_101632362 243
174 3300025941 Ga0207711_10048902 Ga0207711_100489022 243
175 3300025944 Ga0207661_10037177 Ga0207661_100371774 243
176 3300025944 Ga0207661_10181656 Ga0207661_101816562 243
177 3300025945 Ga0207679_10173374 Ga0207679_101733742 243
178 3300026067 Ga0207678_10050513 Ga0207678_100505132 243
179 3300026078 Ga0207702_10046299 Ga0207702_100462993 243
180 3300026088 Ga0207641_10050492 Ga0207641_100504922 243
181 3300026095 Ga0207676_10011596 Ga0207676_100115969 243
182 3300028556 Ga0265337_1000159 Ga0265337_100015915 243
183 3300028558 Ga0265326_10000487 Ga0265326_100004877 243
184 3300028563 Ga0265319_1006829 Ga0265319_10068294 243
185 3300028573 Ga0265334_10000745 Ga0265334_100007459 243
186 3300028577 Ga0265318_10020736 Ga0265318_100207362 243
187 3300028653 Ga0265323_10007256 Ga0265323_100072566 243
188 3300028654 Ga0265322_10003714 Ga0265322_100037143 243
189 3300028666 Ga0265336_10005196 Ga0265336_100051962 243
190 3300028800 Ga0265338_10000246 Ga0265338_1000024655 243
191 3300028800 Ga0265338_10006190 Ga0265338_100061904 243
192 3300028800 Ga0265338_10007955 Ga0265338_1000795512 243
193 3300031238 Ga0265332_10001531 Ga0265332_100015312 243
194 3300031240 Ga0265320_10002564 Ga0265320_100025649 243
195 3300031247 Ga0265340_10002368 Ga0265340_100023682 243
196 3300031344 Ga0265316_10041857 Ga0265316_100418572 243
197 3300031595 Ga0265313_10016183 Ga0265313_100161834 243
198 3300031711 Ga0265314_10008867 Ga0265314_100088679 243
199 3300031712 Ga0265342_10030403 Ga0265342_100304033 243
200 3300035111 Ga0373923_0049710 Ga0373923_0049710_13_876 243
201 3300035725 Ga0373947_0047457 Ga0373947_0047457_803_1666 243
202 3300036401 Ga0373937_0269045 Ga0373937_0269045_393_1277 243
203 3300037418 Ga0395900_0456786 Ga0395900_0456786_160_1044 243
204 3300037466 Ga0395898_0256882 Ga0395898_0256882_203_1087 243
205 3300037853 Ga0436364_0584067 Ga0436364_0584067_69181_70092 243
206 3300039450 Ga0436363_1174479 Ga0436363_1174479_147_1019 243
207 3300044656 Ga0466969_0136010 Ga0466969_0136010_254_1123 243
208 3300044694 Ga0466963_0026301 Ga0466963_0026301_1710_2594 243
209 3300046454 Ga0495592_0022578 Ga0495592_0022578_2310_3173 243
210 3300046455 Ga0495603_0177565 Ga0495603_0177565_315_1178 243
211 3300046462 Ga0495651_0001369 Ga0495651_0001369_8242_9105 243
212 3300046476 Ga0495662_0067218 Ga0495662_0067218_145_1008 243
213 3300046477 Ga0495664_0091433 Ga0495664_0091433_954_1817 243
214 3300046499 Ga0495594_0215063 Ga0495594_0215063_186_1049 243
215 3300046511 Ga0495608_0032494 Ga0495608_0032494_1516_2379 243
216 3300046517 Ga0495630_0078629 Ga0495630_0078629_1396_2259 243
217 3300046529 Ga0495652_0025949 Ga0495652_0025949_3119_3982 243
218 3300046533 Ga0495640_0066427 Ga0495640_0066427_83_946 243
219 3300046536 Ga0495587_0008083 Ga0495587_0008083_747_1610 243
220 3300046663 Ga0495635_0054760 Ga0495635_0054760_1802_2665 243
221 3300046675 Ga0495657_0019907 Ga0495657_0019907_2142_3005 243
222 3300046678 Ga0495599_0002458 Ga0495599_0002458_1702_2565 243
223 3300046683 Ga0495658_0042525 Ga0495658_0042525_1530_2393 243
224 3300046689 Ga0495613_0198978 Ga0495613_0198978_538_1401 243
225 3300046809 Ga0495600_0113704 Ga0495600_0113704_849_1712 243
226 3300047315 Ga0495581_0104077 Ga0495581_0104077_25_888 243
227 3300047317 Ga0495604_0083187 Ga0495604_0083187_1447_2310 243
228 3300047319 Ga0495674_0054936 Ga0495674_0054936_2341_3204 243
229 3300047322 Ga0495680_0066575 Ga0495680_0066575_1811_2674 243
230 3300047444 Ga0495675_0121489 Ga0495675_0121489_751_1614 243
231 3300047471 Ga0495684_0032291 Ga0495684_0032291_1647_2510 243
232 3300048905 Ga0496102_0338477 Ga0496102_0338477_381_1244 243
233 3300048907 Ga0496104_0015791 Ga0496104_0015791_2733_3596 243
234 3300048908 Ga0496105_0015581 Ga0496105_0015581_2468_3331 243
235 3300048911 Ga0496108_0005347 Ga0496108_0005347_6672_7535 243
236 3300048912 Ga0496109_0019488 Ga0496109_0019488_3718_4581 243
237 3300048913 Ga0496110_0030734 Ga0496110_0030734_2220_3083 243
238 3300048914 Ga0496111_0003445 Ga0496111_0003445_7814_8677 243
239 3300048916 Ga0496113_0221947 Ga0496113_0221947_480_1343 243
240 3300048929 Ga0496126_0077381 Ga0496126_0077381_121_1005 243
241 3300048929 Ga0496126_0085900 Ga0496126_0085900_901_1782 243
242 3300049576 Ga0501040_0090992 Ga0501040_0090992_677_1531 243
243 3300050507 nmdc:mga05p37_654885_c1 nmdc:mga05p37_654885_c1_32_898 243
244 3300050513 nmdc:mga0rr50_68983_c1 nmdc:mga0rr50_68983_c1_567_1430 243
245 3300053077 Ga0495601_0090400 Ga0495601_0090400_1087_1950 243
246 3300053085 Ga0495619_0085308 Ga0495619_0085308_1235_2098 243
247 3300053096 Ga0500641_0071322 Ga0500641_0071322_597_1448 243
248 3300005327 Ga0070658_10099642 Ga0070658_100996423 244
249 3300005328 Ga0070676_10083182 Ga0070676_100831822 244
250 3300005331 Ga0070670_100292811 Ga0070670_1002928112 244
251 3300005334 Ga0068869_100027085 Ga0068869_1000270854 244
252 3300005335 Ga0070666_10031474 Ga0070666_100314742 244
253 3300005336 Ga0070680_100090788 Ga0070680_1000907882 244
254 3300005340 Ga0070689_100025233 Ga0070689_1000252334 244
255 3300005345 Ga0070692_10055486 Ga0070692_100554863 244
256 3300005353 Ga0070669_100259968 Ga0070669_1002599682 244
257 3300005354 Ga0070675_100017217 Ga0070675_1000172174 244
258 3300005364 Ga0070673_100068458 Ga0070673_1000684582 244
259 3300005365 Ga0070688_100085208 Ga0070688_1000852082 244
260 3300005366 Ga0070659_100012169 Ga0070659_1000121693 244
261 3300005367 Ga0070667_100027789 Ga0070667_1000277892 244
262 3300005434 Ga0070709_10002704 Ga0070709_100027042 244
263 3300005434 Ga0070709_10006521 Ga0070709_100065214 244
264 3300005435 Ga0070714_100002366 Ga0070714_1000023664 244
265 3300005435 Ga0070714_100211609 Ga0070714_1002116092 244
266 3300005435 Ga0070714_100545505 Ga0070714_1005455051 244
267 3300005436 Ga0070713_100089884 Ga0070713_1000898842 244
268 3300005436 Ga0070713_100155586 Ga0070713_1001555863 244
269 3300005436 Ga0070713_100332685 Ga0070713_1003326852 244
270 3300005437 Ga0070710_10004727 Ga0070710_100047273 244
271 3300005437 Ga0070710_10010496 Ga0070710_100104964 244
272 3300005437 Ga0070710_10051207 Ga0070710_100512072 244
273 3300005439 Ga0070711_100024014 Ga0070711_1000240143 244
274 3300005439 Ga0070711_100024412 Ga0070711_1000244123 244
275 3300005439 Ga0070711_100033050 Ga0070711_1000330502 244
276 3300005439 Ga0070711_100226688 Ga0070711_1002266882 244
277 3300005440 Ga0070705_100106334 Ga0070705_1001063342 244
278 3300005441 Ga0070700_100028218 Ga0070700_1000282183 244
279 3300005444 Ga0070694_100212168 Ga0070694_1002121682 244
280 3300005445 Ga0070708_100002852 Ga0070708_1000028522 244
281 3300005445 Ga0070708_100006587 Ga0070708_1000065874 244
282 3300005445 Ga0070708_100392092 Ga0070708_1003920921 244
283 3300005455 Ga0070663_100008724 Ga0070663_1000087245 244
284 3300005458 Ga0070681_10043624 Ga0070681_100436242 244
285 3300005466 Ga0070685_10021753 Ga0070685_100217534 244
286 3300005467 Ga0070706_100010462 Ga0070706_1000104624 244
287 3300005467 Ga0070706_100017170 Ga0070706_1000171704 244
288 3300005467 Ga0070706_100094755 Ga0070706_1000947551 244
289 3300005467 Ga0070706_100360191 Ga0070706_1003601912 244
290 3300005468 Ga0070707_100001170 Ga0070707_10000117011 244
291 3300005468 Ga0070707_100036729 Ga0070707_1000367293 244
292 3300005468 Ga0070707_100037150 Ga0070707_1000371504 244
293 3300005468 Ga0070707_100090829 Ga0070707_1000908293 244
294 3300005468 Ga0070707_100377937 Ga0070707_1003779372 244
295 3300005471 Ga0070698_100000350 Ga0070698_10000035036 244
296 3300005471 Ga0070698_100008863 Ga0070698_1000088631 244
297 3300005471 Ga0070698_100044247 Ga0070698_1000442473 244
298 3300005471 Ga0070698_100115763 Ga0070698_1001157633 244
299 3300005471 Ga0070698_100158856 Ga0070698_1001588562 244
300 3300005518 Ga0070699_100152922 Ga0070699_1001529222 244
301 3300005530 Ga0070679_100024563 Ga0070679_1000245634 244
302 3300005535 Ga0070684_100183217 Ga0070684_1001832172 244
303 3300005536 Ga0070697_100005931 Ga0070697_1000059312 244
304 3300005536 Ga0070697_100046324 Ga0070697_1000463241 244
305 3300005539 Ga0068853_100082924 Ga0068853_1000829242 244
306 3300005543 Ga0070672_100014724 Ga0070672_1000147244 244
307 3300005544 Ga0070686_100017086 Ga0070686_1000170864 244
308 3300005545 Ga0070695_100038148 Ga0070695_1000381483 244
309 3300005545 Ga0070695_100049545 Ga0070695_1000495453 244
310 3300005546 Ga0070696_100113989 Ga0070696_1001139892 244
311 3300005548 Ga0070665_100148679 Ga0070665_1001486792 244
312 3300005563 Ga0068855_100350083 Ga0068855_1003500832 244
313 3300005564 Ga0070664_100046581 Ga0070664_1000465812 244
314 3300005617 Ga0068859_100054396 Ga0068859_1000543963 244
315 3300005618 Ga0068864_100209015 Ga0068864_1002090152 244
316 3300005718 Ga0068866_10007968 Ga0068866_100079683 244
317 3300005719 Ga0068861_100307086 Ga0068861_1003070862 244
318 3300005841 Ga0068863_100111980 Ga0068863_1001119803 244
319 3300005841 Ga0068863_100448863 Ga0068863_1004488632 244
320 3300005983 Ga0081540_1000250 Ga0081540_100025041 244
321 3300005983 Ga0081540_1000386 Ga0081540_100038635 244
322 3300006028 Ga0070717_10000595 Ga0070717_1000059524 244
323 3300006028 Ga0070717_10009690 Ga0070717_100096906 244
324 3300006028 Ga0070717_10057455 Ga0070717_100574553 244
325 3300006028 Ga0070717_10060467 Ga0070717_100604672 244
326 3300006028 Ga0070717_10276882 Ga0070717_102768822 244
327 3300006028 Ga0070717_10475002 Ga0070717_104750022 244
328 3300006163 Ga0070715_10030715 Ga0070715_100307152 244
329 3300006173 Ga0070716_100000685 Ga0070716_10000068512 244
330 3300006173 Ga0070716_100001892 Ga0070716_1000018928 244
331 3300006173 Ga0070716_100083470 Ga0070716_1000834702 244
332 3300006175 Ga0070712_100001777 Ga0070712_10000177710 244
333 3300006175 Ga0070712_100029417 Ga0070712_1000294172 244
334 3300006175 Ga0070712_100029817 Ga0070712_1000298174 244
335 3300006175 Ga0070712_100054448 Ga0070712_1000544483 244
336 3300006237 Ga0097621_100082567 Ga0097621_1000825672 244
337 3300006237 Ga0097621_100258256 Ga0097621_1002582562 244
338 3300006852 Ga0075433_10101566 Ga0075433_101015662 244
339 3300006871 Ga0075434_100165210 Ga0075434_1001652102 244
340 3300006914 Ga0075436_100072291 Ga0075436_1000722912 244
341 3300006914 Ga0075436_100141277 Ga0075436_1001412772 244
342 3300006931 Ga0097620_100054396 Ga0097620_1000543963 244
343 3300007076 Ga0075435_100066923 Ga0075435_1000669232 244
344 3300007076 Ga0075435_100144057 Ga0075435_1001440572 244
345 3300007788 Ga0099795_10045308 Ga0099795_100453082 244
346 3300009094 Ga0111539_10058081 Ga0111539_100580812 244
347 3300009147 Ga0114129_10240302 Ga0114129_102403022 244
348 3300009148 Ga0105243_10039299 Ga0105243_100392992 244
349 3300009174 Ga0105241_10075160 Ga0105241_100751602 244
350 3300009174 Ga0105241_10221210 Ga0105241_102212102 244
351 3300009176 Ga0105242_10030525 Ga0105242_100305253 244
352 3300009177 Ga0105248_10023243 Ga0105248_100232434 244
353 3300009545 Ga0105237_10199501 Ga0105237_101995012 244
354 3300009545 Ga0105237_10371724 Ga0105237_103717242 244
355 3300009553 Ga0105249_10217050 Ga0105249_102170502 244
356 3300011119 Ga0105246_10042791 Ga0105246_100427913 244
357 3300012495 Ga0157323_1001231 Ga0157323_10012312 244
358 3300012507 Ga0157342_1000213 Ga0157342_10002133 244
359 3300012515 Ga0157338_1000575 Ga0157338_10005752 244
360 3300013296 Ga0157374_10431359 Ga0157374_104313592 244
361 3300013297 Ga0157378_10029606 Ga0157378_100296062 244
362 3300013306 Ga0163162_10158913 Ga0163162_101589132 244
363 3300014969 Ga0157376_10118718 Ga0157376_101187182 244
364 3300017792 Ga0163161_10029215 Ga0163161_100292153 244
365 3300020081 Ga0206354_11210166 Ga0206354_112101662 244
366 3300021388 Ga0213875_10004658 Ga0213875_100046585 244
367 3300021388 Ga0213875_10060207 Ga0213875_100602072 244
368 3300022467 Ga0224712_10008572 Ga0224712_100085722 244
369 3300024225 Ga0224572_1004952 Ga0224572_10049522 244
370 3300025885 Ga0207653_10002100 Ga0207653_100021002 244
371 3300025898 Ga0207692_10006206 Ga0207692_100062063 244
372 3300025898 Ga0207692_10008220 Ga0207692_100082203 244
373 3300025898 Ga0207692_10021468 Ga0207692_100214682 244
374 3300025898 Ga0207692_10076769 Ga0207692_100767692 244
375 3300025899 Ga0207642_10057235 Ga0207642_100572352 244
376 3300025901 Ga0207688_10056819 Ga0207688_100568192 244
377 3300025904 Ga0207647_10055704 Ga0207647_100557042 244
378 3300025905 Ga0207685_10001956 Ga0207685_100019562 244
379 3300025906 Ga0207699_10000107 Ga0207699_1000010752 244
380 3300025906 Ga0207699_10003816 Ga0207699_100038162 244
381 3300025906 Ga0207699_10035780 Ga0207699_100357802 244
382 3300025907 Ga0207645_10046014 Ga0207645_100460142 244
383 3300025908 Ga0207643_10006315 Ga0207643_100063152 244
384 3300025910 Ga0207684_10009531 Ga0207684_100095314 244
385 3300025910 Ga0207684_10089043 Ga0207684_100890432 244
386 3300025911 Ga0207654_10016701 Ga0207654_100167013 244
387 3300025914 Ga0207671_10026763 Ga0207671_100267632 244
388 3300025915 Ga0207693_10000536 Ga0207693_1000053626 244
389 3300025915 Ga0207693_10062238 Ga0207693_100622383 244
390 3300025915 Ga0207693_10074287 Ga0207693_100742872 244
391 3300025915 Ga0207693_10182535 Ga0207693_101825352 244
392 3300025915 Ga0207693_10244888 Ga0207693_102448882 244
393 3300025916 Ga0207663_10002641 Ga0207663_100026412 244
394 3300025916 Ga0207663_10031759 Ga0207663_100317593 244
395 3300025916 Ga0207663_10040846 Ga0207663_100408462 244
396 3300025916 Ga0207663_10043707 Ga0207663_100437072 244
397 3300025916 Ga0207663_10082180 Ga0207663_100821802 244
398 3300025917 Ga0207660_10029377 Ga0207660_100293774 244
399 3300025919 Ga0207657_10011368 Ga0207657_100113683 244
400 3300025921 Ga0207652_10097622 Ga0207652_100976222 244
401 3300025922 Ga0207646_10000071 Ga0207646_1000007141 244
402 3300025922 Ga0207646_10028949 Ga0207646_100289494 244
403 3300025922 Ga0207646_10061721 Ga0207646_100617213 244
404 3300025922 Ga0207646_10062919 Ga0207646_100629194 244
405 3300025928 Ga0207700_10001550 Ga0207700_100015502 244
406 3300025928 Ga0207700_10005025 Ga0207700_100050253 244
407 3300025928 Ga0207700_10014749 Ga0207700_100147494 244
408 3300025928 Ga0207700_10037702 Ga0207700_100377022 244
409 3300025928 Ga0207700_10288239 Ga0207700_102882392 244
410 3300025928 Ga0207700_10365186 Ga0207700_103651862 244
411 3300025929 Ga0207664_10000271 Ga0207664_1000027128 244
412 3300025929 Ga0207664_10001093 Ga0207664_1000109315 244
413 3300025929 Ga0207664_10039991 Ga0207664_100399912 244
414 3300025929 Ga0207664_10299627 Ga0207664_102996272 244
415 3300025929 Ga0207664_10337047 Ga0207664_103370472 244
416 3300025929 Ga0207664_10360866 Ga0207664_103608662 244
417 3300025931 Ga0207644_10082655 Ga0207644_100826552 244
418 3300025931 Ga0207644_10300170 Ga0207644_103001702 244
419 3300025933 Ga0207706_10017461 Ga0207706_100174617 244
420 3300025936 Ga0207670_10256510 Ga0207670_102565102 244
421 3300025939 Ga0207665_10001335 Ga0207665_1000133515 244
422 3300025939 Ga0207665_10024497 Ga0207665_100244973 244
423 3300025939 Ga0207665_10149661 Ga0207665_101496612 244
424 3300025939 Ga0207665_10192011 Ga0207665_101920112 244
425 3300025939 Ga0207665_10216128 Ga0207665_102161282 244
426 3300025940 Ga0207691_10039540 Ga0207691_100395402 244
427 3300025942 Ga0207689_10022170 Ga0207689_100221703 244
428 3300025944 Ga0207661_10086843 Ga0207661_100868432 244
429 3300025944 Ga0207661_10135661 Ga0207661_101356612 244
430 3300025949 Ga0207667_10087836 Ga0207667_100878362 244
431 3300025972 Ga0207668_10176044 Ga0207668_101760442 244
432 3300026023 Ga0207677_10150012 Ga0207677_101500122 244
433 3300026041 Ga0207639_10067133 Ga0207639_100671333 244
434 3300026067 Ga0207678_10003646 Ga0207678_100036463 244
435 3300026075 Ga0207708_10014032 Ga0207708_100140324 244
436 3300026078 Ga0207702_10047438 Ga0207702_100474384 244
437 3300026089 Ga0207648_10045889 Ga0207648_100458892 244
438 3300026116 Ga0207674_10019631 Ga0207674_100196313 244
439 3300026118 Ga0207675_100036167 Ga0207675_1000361673 244
440 3300026121 Ga0207683_10009297 Ga0207683_100092973 244
441 3300027907 Ga0207428_10064810 Ga0207428_100648102 244
442 3300028379 Ga0268266_10297934 Ga0268266_102979342 244
443 3300028800 Ga0265338_10001163 Ga0265338_1000116340 244
444 3300035083 Ga0373926_0001049 Ga0373926_0001049_6591_7451 244
445 3300035083 Ga0373926_0007106 Ga0373926_0007106_1319_2194 244
446 3300035086 Ga0373934_0000290 Ga0373934_0000290_14104_15003 244
447 3300035086 Ga0373934_0006360 Ga0373934_0006360_3336_4223 244
448 3300035086 Ga0373934_0010966 Ga0373934_0010966_2085_2960 244
449 3300035086 Ga0373934_0013804 Ga0373934_0013804_113_1000 244
450 3300035088 Ga0373940_0014450 Ga0373940_0014450_107_994 244
451 3300035089 Ga0373944_0001695 Ga0373944_0001695_2117_2992 244
452 3300035089 Ga0373944_0080296 Ga0373944_0080296_28_915 244
453 3300035091 Ga0373951_0019994 Ga0373951_0019994_20_907 244
454 3300035111 Ga0373923_0006704 Ga0373923_0006704_1858_2733 244
455 3300035111 Ga0373923_0011154 Ga0373923_0011154_1491_2378 244
456 3300035111 Ga0373923_0053487 Ga0373923_0053487_376_1239 244
457 3300035113 Ga0373936_0019346 Ga0373936_0019346_1469_2344 244
458 3300035113 Ga0373936_0049912 Ga0373936_0049912_631_1518 244
459 3300035113 Ga0373936_0079042 Ga0373936_0079042_412_1299 244
460 3300035114 Ga0373939_0038958 Ga0373939_0038958_120_1007 244
461 3300035116 Ga0373945_0006188 Ga0373945_0006188_1656_2531 244
462 3300035116 Ga0373945_0034052 Ga0373945_0034052_179_1066 244
463 3300035117 Ga0373953_0000281 Ga0373953_0000281_3779_4678 244
464 3300035117 Ga0373953_0001460 Ga0373953_0001460_2149_3036 244
465 3300035117 Ga0373953_0016162 Ga0373953_0016162_734_1609 244
466 3300035118 Ga0373954_0000410 Ga0373954_0000410_1451_2350 244
467 3300035118 Ga0373954_0012939 Ga0373954_0012939_2056_2943 244
468 3300035118 Ga0373954_0036378 Ga0373954_0036378_643_1518 244
469 3300035118 Ga0373954_0037013 Ga0373954_0037013_1063_1950 244
470 3300035119 Ga0373956_0001346 Ga0373956_0001346_4862_5761 244
471 3300035119 Ga0373956_0009092 Ga0373956_0009092_2616_3491 244
472 3300035119 Ga0373956_0013201 Ga0373956_0013201_266_1153 244
473 3300035119 Ga0373956_0079576 Ga0373956_0079576_35_922 244
474 3300035120 Ga0373957_0002779 Ga0373957_0002779_3337_4236 244
475 3300035120 Ga0373957_0007398 Ga0373957_0007398_597_1484 244
476 3300035170 Ga0373943_0000958 Ga0373943_0000958_9761_10636 244
477 3300035170 Ga0373943_0015727 Ga0373943_0015727_2348_3235 244
478 3300035171 Ga0373946_0002228 Ga0373946_0002228_5908_6795 244
479 3300035171 Ga0373946_0004794 Ga0373946_0004794_1813_2688 244
480 3300035172 Ga0373955_0000041 Ga0373955_0000041_36180_37079 244
481 3300035172 Ga0373955_0008076 Ga0373955_0008076_1404_2291 244
482 3300035172 Ga0373955_0048774 Ga0373955_0048774_1262_2137 244
483 3300035172 Ga0373955_0218982 Ga0373955_0218982_206_1093 244
484 3300035410 Ga0373924_0002565 Ga0373924_0002565_4241_5140 244
485 3300035410 Ga0373924_0010064 Ga0373924_0010064_1456_2343 244
486 3300035410 Ga0373924_0090093 Ga0373924_0090093_381_1268 244
487 3300035691 Ga0373931_0014660 Ga0373931_0014660_934_1821 244
488 3300035691 Ga0373931_0082238 Ga0373931_0082238_159_1034 244
489 3300035692 Ga0373935_0009024 Ga0373935_0009024_1319_2179 244
490 3300035692 Ga0373935_0036404 Ga0373935_0036404_264_1139 244
491 3300035692 Ga0373935_0111228 Ga0373935_0111228_207_1094 244
492 3300035692 Ga0373935_0140611 Ga0373935_0140611_716_1603 244
493 3300035695 Ga0373927_0018103 Ga0373927_0018103_2158_3033 244
494 3300035695 Ga0373927_0082561 Ga0373927_0082561_334_1221 244
495 3300035724 Ga0373933_0000246 Ga0373933_0000246_3579_4478 244
496 3300035724 Ga0373933_0000589 Ga0373933_0000589_2553_3440 244
497 3300035724 Ga0373933_0014754 Ga0373933_0014754_2726_3601 244
498 3300035725 Ga0373947_0000015 Ga0373947_0000015_21365_22225 244
499 3300035725 Ga0373947_0015270 Ga0373947_0015270_264_1139 244
500 3300035725 Ga0373947_0100955 Ga0373947_0100955_97_984 244
501 3300035725 Ga0373947_0159606 Ga0373947_0159606_365_1252 244
502 3300036401 Ga0373937_0000172 Ga0373937_0000172_14141_15040 244
503 3300036401 Ga0373937_0031728 Ga0373937_0031728_2615_3502 244
504 3300036401 Ga0373937_0697680 Ga0373937_0697680_31_918 244
505 3300037068 Ga0373925_0018624 Ga0373925_0018624_2478_3353 244
506 3300037068 Ga0373925_0054778 Ga0373925_0054778_1505_2392 244
507 3300037068 Ga0373925_0074548 Ga0373925_0074548_360_1229 244
508 3300037068 Ga0373925_0076000 Ga0373925_0076000_1503_2378 244
509 3300037068 Ga0373925_0106514 Ga0373925_0106514_1100_1987 244
510 3300037068 Ga0373925_0108976 Ga0373925_0108976_1141_2028 244
511 3300037853 Ga0436364_0180190 Ga0436364_0180190_245_1129 244
512 3300037853 Ga0436364_0397052 Ga0436364_0397052_58_933 244
513 3300037853 Ga0436364_0644067 Ga0436364_0644067_4589_5464 244
514 3300037853 Ga0436364_1380199 Ga0436364_1380199_1381_2271 244
515 3300037853 Ga0436364_1502227 Ga0436364_1502227_1247_2122 244
516 3300039450 Ga0436363_1612024 Ga0436363_1612024_558_1424 244
517 3300045976 Ga0466967_0059991 Ga0466967_0059991_440_1309 244
518 3300046454 Ga0495592_0000417 Ga0495592_0000417_14141_15040 244
519 3300046454 Ga0495592_0034414 Ga0495592_0034414_777_1664 244
520 3300046454 Ga0495592_0074035 Ga0495592_0074035_1382_2269 244
521 3300046454 Ga0495592_0077847 Ga0495592_0077847_1061_1936 244
522 3300046455 Ga0495603_0005458 Ga0495603_0005458_6481_7356 244
523 3300046459 Ga0495629_0031840 Ga0495629_0031840_995_1870 244
524 3300046459 Ga0495629_0036601 Ga0495629_0036601_1290_2177 244
525 3300046459 Ga0495629_0213410 Ga0495629_0213410_389_1276 244
526 3300046461 Ga0495641_0022457 Ga0495641_0022457_928_1803 244
527 3300046461 Ga0495641_0039201 Ga0495641_0039201_681_1568 244
528 3300046462 Ga0495651_0000118 Ga0495651_0000118_43375_44274 244
529 3300046462 Ga0495651_0011483 Ga0495651_0011483_4711_5586 244
530 3300046462 Ga0495651_0039548 Ga0495651_0039548_875_1750 244
531 3300046462 Ga0495651_0116926 Ga0495651_0116926_29_916 244
532 3300046462 Ga0495651_0349492 Ga0495651_0349492_28_903 244
533 3300046463 Ga0495653_0004695 Ga0495653_0004695_5555_6454 244
534 3300046463 Ga0495653_0024624 Ga0495653_0024624_2239_3114 244
535 3300046463 Ga0495653_0117168 Ga0495653_0117168_361_1236 244
536 3300046463 Ga0495653_0131455 Ga0495653_0131455_22_897 244
537 3300046472 Ga0495580_0084392 Ga0495580_0084392_578_1465 244
538 3300046473 Ga0495582_0016884 Ga0495582_0016884_1968_2855 244
539 3300046475 Ga0495639_0002595 Ga0495639_0002595_211_1098 244
540 3300046475 Ga0495639_0014969 Ga0495639_0014969_1680_2555 244
541 3300046475 Ga0495639_0068572 Ga0495639_0068572_178_1065 244
542 3300046476 Ga0495662_0001119 Ga0495662_0001119_5688_6575 244
543 3300046476 Ga0495662_0011609 Ga0495662_0011609_1987_2862 244
544 3300046476 Ga0495662_0021421 Ga0495662_0021421_1318_2205 244
545 3300046477 Ga0495664_0004752 Ga0495664_0004752_4520_5407 244
546 3300046477 Ga0495664_0013461 Ga0495664_0013461_1565_2440 244
547 3300046477 Ga0495664_0104692 Ga0495664_0104692_431_1306 244
548 3300046499 Ga0495594_0080164 Ga0495594_0080164_489_1376 244
549 3300046511 Ga0495608_0000156 Ga0495608_0000156_33832_34731 244
550 3300046511 Ga0495608_0023347 Ga0495608_0023347_1630_2517 244
551 3300046511 Ga0495608_0075294 Ga0495608_0075294_268_1143 244
552 3300046514 Ga0495618_0024807 Ga0495618_0024807_811_1698 244
553 3300046514 Ga0495618_0046067 Ga0495618_0046067_333_1208 244
554 3300046516 Ga0495628_0000655 Ga0495628_0000655_15458_16357 244
555 3300046516 Ga0495628_0042494 Ga0495628_0042494_1432_2319 244
556 3300046516 Ga0495628_0052004 Ga0495628_0052004_1736_2599 244
557 3300046516 Ga0495628_0079637 Ga0495628_0079637_387_1262 244
558 3300046517 Ga0495630_0046639 Ga0495630_0046639_833_1708 244
559 3300046517 Ga0495630_0089251 Ga0495630_0089251_1305_2180 244
560 3300046526 Ga0495666_0025606 Ga0495666_0025606_1558_2445 244
561 3300046526 Ga0495666_0031604 Ga0495666_0031604_402_1289 244
562 3300046529 Ga0495652_0000436 Ga0495652_0000436_14141_15040 244
563 3300046529 Ga0495652_0036265 Ga0495652_0036265_1909_2784 244
564 3300046529 Ga0495652_0060564 Ga0495652_0060564_777_1664 244
565 3300046529 Ga0495652_0071084 Ga0495652_0071084_1281_2156 244
566 3300046529 Ga0495652_0195392 Ga0495652_0195392_354_1229 244
567 3300046529 Ga0495652_0204783 Ga0495652_0204783_402_1289 244
568 3300046531 Ga0495665_0005365 Ga0495665_0005365_5688_6575 244
569 3300046531 Ga0495665_0005528 Ga0495665_0005528_4193_5080 244
570 3300046531 Ga0495665_0045817 Ga0495665_0045817_438_1313 244
571 3300046533 Ga0495640_0006891 Ga0495640_0006891_2358_3245 244
572 3300046533 Ga0495640_0032871 Ga0495640_0032871_1885_2760 244
573 3300046533 Ga0495640_0049003 Ga0495640_0049003_897_1772 244
574 3300046535 Ga0495586_0010763 Ga0495586_0010763_894_1781 244
575 3300046535 Ga0495586_0076951 Ga0495586_0076951_711_1574 244
576 3300046536 Ga0495587_0000045 Ga0495587_0000045_93323_94222 244
577 3300046536 Ga0495587_0021977 Ga0495587_0021977_3021_3896 244
578 3300046536 Ga0495587_0029180 Ga0495587_0029180_2003_2890 244
579 3300046543 Ga0495645_0082093 Ga0495645_0082093_1201_2076 244
580 3300046543 Ga0495645_0154282 Ga0495645_0154282_614_1501 244
581 3300046543 Ga0495645_0198259 Ga0495645_0198259_271_1158 244
582 3300046543 Ga0495645_0206632 Ga0495645_0206632_289_1152 244
583 3300046559 Ga0495667_0000051 Ga0495667_0000051_94238_95137 244
584 3300046559 Ga0495667_0026112 Ga0495667_0026112_1019_1894 244
585 3300046559 Ga0495667_0030093 Ga0495667_0030093_573_1460 244
586 3300046559 Ga0495667_0036695 Ga0495667_0036695_543_1418 244
587 3300046559 Ga0495667_0044919 Ga0495667_0044919_52_927 244
588 3300046559 Ga0495667_0209516 Ga0495667_0209516_92_952 244
589 3300046642 Ga0495634_0024496 Ga0495634_0024496_1334_2209 244
590 3300046642 Ga0495634_0029565 Ga0495634_0029565_1196_2083 244
591 3300046663 Ga0495635_0020163 Ga0495635_0020163_2242_3117 244
592 3300046663 Ga0495635_0146840 Ga0495635_0146840_320_1195 244
593 3300046663 Ga0495635_0364778 Ga0495635_0364778_29_916 244
594 3300046675 Ga0495657_0000044 Ga0495657_0000044_93344_94243 244
595 3300046675 Ga0495657_0015482 Ga0495657_0015482_2655_3542 244
596 3300046675 Ga0495657_0123039 Ga0495657_0123039_666_1541 244
597 3300046678 Ga0495599_0000127 Ga0495599_0000127_33709_34608 244
598 3300046678 Ga0495599_0048662 Ga0495599_0048662_141_1028 244
599 3300046678 Ga0495599_0146518 Ga0495599_0146518_371_1258 244
600 3300046679 Ga0495623_0004402 Ga0495623_0004402_2260_3159 244
601 3300046679 Ga0495623_0011331 Ga0495623_0011331_2196_3083 244
602 3300046679 Ga0495623_0027825 Ga0495623_0027825_326_1213 244
603 3300046680 Ga0495646_0012163 Ga0495646_0012163_2237_3124 244
604 3300046680 Ga0495646_0022004 Ga0495646_0022004_918_1805 244
605 3300046681 Ga0495647_0009779 Ga0495647_0009779_2233_3108 244
606 3300046683 Ga0495658_0023317 Ga0495658_0023317_333_1220 244
607 3300046689 Ga0495613_0015792 Ga0495613_0015792_2349_3236 244
608 3300046689 Ga0495613_0027087 Ga0495613_0027087_2517_3404 244
609 3300046690 Ga0495624_0011079 Ga0495624_0011079_3009_3884 244
610 3300046690 Ga0495624_0012215 Ga0495624_0012215_918_1805 244
611 3300046690 Ga0495624_0017955 Ga0495624_0017955_2164_3051 244
612 3300046809 Ga0495600_0003470 Ga0495600_0003470_1428_2315 244
613 3300046809 Ga0495600_0004056 Ga0495600_0004056_1715_2614 244
614 3300046809 Ga0495600_0021267 Ga0495600_0021267_851_1738 244
615 3300046809 Ga0495600_0053116 Ga0495600_0053116_333_1208 244
616 3300047315 Ga0495581_0007508 Ga0495581_0007508_3694_4581 244
617 3300047315 Ga0495581_0037248 Ga0495581_0037248_1277_2152 244
618 3300047317 Ga0495604_0000046 Ga0495604_0000046_94256_95155 244
619 3300047317 Ga0495604_0003684 Ga0495604_0003684_8137_9024 244
620 3300047317 Ga0495604_0026106 Ga0495604_0026106_2216_3103 244
621 3300047317 Ga0495604_0061083 Ga0495604_0061083_476_1351 244
622 3300047319 Ga0495674_0033338 Ga0495674_0033338_2207_3082 244
623 3300047321 Ga0495676_0027520 Ga0495676_0027520_875_1762 244
624 3300047321 Ga0495676_0029398 Ga0495676_0029398_1573_2448 244
625 3300047321 Ga0495676_0088314 Ga0495676_0088314_388_1275 244
626 3300047322 Ga0495680_0000945 Ga0495680_0000945_17260_18159 244
627 3300047322 Ga0495680_0015977 Ga0495680_0015977_1462_2337 244
628 3300047322 Ga0495680_0032786 Ga0495680_0032786_1370_2245 244
629 3300047322 Ga0495680_0033036 Ga0495680_0033036_2020_2907 244
630 3300047444 Ga0495675_0000499 Ga0495675_0000499_10458_11357 244
631 3300047444 Ga0495675_0049337 Ga0495675_0049337_881_1768 244
632 3300047471 Ga0495684_0026204 Ga0495684_0026204_2041_2916 244
633 3300047471 Ga0495684_0135878 Ga0495684_0135878_592_1467 244
634 3300047471 Ga0495684_0158051 Ga0495684_0158051_777_1664 244
635 3300047673 Ga0495593_0015172 Ga0495593_0015172_1967_2854 244
636 3300047673 Ga0495593_0019542 Ga0495593_0019542_1809_2684 244
637 3300047673 Ga0495593_0066165 Ga0495593_0066165_168_1055 244
638 3300048088 Ga0495602_0000665 Ga0495602_0000665_14141_15040 244
639 3300048088 Ga0495602_0084491 Ga0495602_0084491_267_1154 244
640 3300048088 Ga0495602_0088740 Ga0495602_0088740_926_1801 244
641 3300048088 Ga0495602_0266378 Ga0495602_0266378_38_913 244
642 3300048089 Ga0495614_0037856 Ga0495614_0037856_447_1334 244
643 3300048904 Ga0496101_0099527 Ga0496101_0099527_489_1376 244
644 3300048906 Ga0496103_0021733 Ga0496103_0021733_2408_3295 244
645 3300048907 Ga0496104_0084730 Ga0496104_0084730_1624_2511 244
646 3300048908 Ga0496105_0032722 Ga0496105_0032722_1850_2737 244
647 3300048908 Ga0496105_0116334 Ga0496105_0116334_180_1055 244
648 3300048909 Ga0496106_0165819 Ga0496106_0165819_270_1145 244
649 3300048911 Ga0496108_0129577 Ga0496108_0129577_1046_1921 244
650 3300048911 Ga0496108_0202100 Ga0496108_0202100_332_1219 244
651 3300048912 Ga0496109_0053525 Ga0496109_0053525_1541_2428 244
652 3300048913 Ga0496110_0008423 Ga0496110_0008423_4151_5038 244
653 3300048915 Ga0496112_0077090 Ga0496112_0077090_1864_2751 244
654 3300048917 Ga0496114_0010063 Ga0496114_0010063_5990_6877 244
655 3300048918 Ga0496115_0114397 Ga0496115_0114397_291_1178 244
656 3300050507 nmdc:mga05p37_14396_c1 nmdc:mga05p37_14396_c1_916_1815 244
657 3300050511 nmdc:mga08y16_362405_c1 nmdc:mga08y16_362405_c1_402_1301 244
658 3300050512 nmdc:mga0n895_135214_c1 nmdc:mga0n895_135214_c1_299_1186 244
659 3300050512 nmdc:mga0n895_177728_c1 nmdc:mga0n895_177728_c1_741_1640 244
660 3300050513 nmdc:mga0rr50_63990_c1 nmdc:mga0rr50_63990_c1_664_1551 244
661 3300050515 nmdc:mga0a205_251378_c1 nmdc:mga0a205_251378_c1_291_1178 244
662 3300053077 Ga0495601_0015740 Ga0495601_0015740_448_1335 244
663 3300053084 Ga0495595_0000195 Ga0495595_0000195_6599_7498 244
664 3300053084 Ga0495595_0020438 Ga0495595_0020438_125_1012 244
665 3300053084 Ga0495595_0045598 Ga0495595_0045598_205_1080 244
666 3300053085 Ga0495619_0024309 Ga0495619_0024309_2259_3158 244
667 3300053085 Ga0495619_0114575 Ga0495619_0114575_88_963 244
668 3300053085 Ga0495619_0184119 Ga0495619_0184119_444_1304 244
669 3300053104 Ga0500556_0000007 Ga0500556_0000007_252610_253494 244
670 3300005467 Ga0070706_100088320 Ga0070706_1000883203 245
671 3300005468 Ga0070707_100029663 Ga0070707_1000296633 245
672 3300006028 Ga0070717_10011331 Ga0070717_100113316 245
673 3300025910 Ga0207684_10001220 Ga0207684_1000122025 245
674 3300025922 Ga0207646_10004644 Ga0207646_100046446 245
675 3300037068 Ga0373925_0002980 Ga0373925_0002980_9928_10845 245
676 3300053140 Ga0500573_0109538 Ga0500573_0109538_416_1312 245
677 3300035118 Ga0373954_0041952 Ga0373954_0041952_172_1080 246
678 3300035172 Ga0373955_0015270 Ga0373955_0015270_1912_2820 246
679 3300036401 Ga0373937_0062750 Ga0373937_0062750_367_1275 246
680 3300037068 Ga0373925_0022968 Ga0373925_0022968_749_1657 246
681 3300046454 Ga0495592_0006283 Ga0495592_0006283_4800_5708 246
682 3300046462 Ga0495651_0003084 Ga0495651_0003084_11444_12352 246
683 3300046463 Ga0495653_0016444 Ga0495653_0016444_3085_3993 246
684 3300046516 Ga0495628_0112294 Ga0495628_0112294_482_1390 246
685 3300046529 Ga0495652_0039756 Ga0495652_0039756_2696_3604 246
686 3300046536 Ga0495587_0016389 Ga0495587_0016389_1803_2711 246
687 3300046543 Ga0495645_0027909 Ga0495645_0027909_137_1045 246
688 3300046559 Ga0495667_0000582 Ga0495667_0000582_8510_9418 246
689 3300046663 Ga0495635_0008687 Ga0495635_0008687_2540_3448 246
690 3300046675 Ga0495657_0002604 Ga0495657_0002604_14104_15012 246
691 3300046679 Ga0495623_0006558 Ga0495623_0006558_645_1553 246
692 3300046809 Ga0495600_0010281 Ga0495600_0010281_1972_2880 246
693 3300047317 Ga0495604_0002826 Ga0495604_0002826_11410_12318 246
694 3300047319 Ga0495674_0010747 Ga0495674_0010747_4966_5874 246
695 3300047322 Ga0495680_0003754 Ga0495680_0003754_13735_14643 246
696 3300047444 Ga0495675_0036092 Ga0495675_0036092_1464_2372 246
697 3300047472 Ga0495686_0011517 Ga0495686_0011517_3983_4867 246
698 3300048088 Ga0495602_0001500 Ga0495602_0001500_10449_11357 246
699 3300053085 Ga0495619_0026025 Ga0495619_0026025_760_1668 246
700 3300053139 Ga0500568_0000021 Ga0500568_0000021_106600_107484 246
701 3300053136 Ga0500559_0004968 Ga0500559_0004968_873_1721 248
702 3300053136 Ga0500559_0056402 Ga0500559_0056402_872_1720 248
703 3300037068 Ga0373925_0000008 Ga0373925_0000008_219777_220739 249
704 3300005355 Ga0070671_100440103 Ga0070671_1004401031 252
705 iso_pu_bacteria 2939657138 2939657443 253
706 3300009174 Ga0105241_10000322 Ga0105241_1000032230 256
707 3300025254 Ga0209148_1000401 Ga0209148_100040110 256
708 3300025911 Ga0207654_10000003 Ga0207654_10000003547 256
709 3300026116 Ga0207674_10182913 Ga0207674_101829132 256
710 3300053093 Ga0500651_0000161 Ga0500651_0000161_28289_29161 256
711 3300053155 Ga0500620_000119 Ga0500620_000119_6870_7742 256
712 3300053142 Ga0500577_0066615 Ga0500577_0066615_93_995 258
713 3300031649 Ga0307514_10053243 Ga0307514_100532432 261
714 3300005327 Ga0070658_10009771 Ga0070658_100097716 263
715 3300005339 Ga0070660_100126026 Ga0070660_1001260262 263
716 3300005366 Ga0070659_100004629 Ga0070659_1000046296 263
717 3300005367 Ga0070667_100031436 Ga0070667_1000314365 263
718 3300005466 Ga0070685_10004937 Ga0070685_100049375 263
719 3300005530 Ga0070679_100510331 Ga0070679_1005103312 263
720 3300005539 Ga0068853_100011285 Ga0068853_10001128510 263
721 3300005563 Ga0068855_100282567 Ga0068855_1002825673 263
722 3300005617 Ga0068859_100086257 Ga0068859_1000862572 263
723 3300006931 Ga0097620_100086260 Ga0097620_1000862602 263
724 3300014968 Ga0157379_10011513 Ga0157379_100115133 263
725 3300025909 Ga0207705_10005871 Ga0207705_100058715 263
726 3300025919 Ga0207657_10006580 Ga0207657_100065807 263
727 3300025932 Ga0207690_10001961 Ga0207690_100019616 263
728 3300025949 Ga0207667_10015792 Ga0207667_100157923 263
729 3300026041 Ga0207639_10494789 Ga0207639_104947892 263

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17827

PrmC_N

PrmC N-terminal domain

34

98

0.96

PF05175

MTS

Methyltransferase small domain

111

233

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r6k-assembly1.cif.gz_q state e2 nucleolar 60s ribosomal intermediate - model for noc2/noc3 region 0.7913 115 166
3cjq-assembly2.cif.gz_D ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 0.7784 115 262
2zbp-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-l-methionine 0.7774 115 262
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.7361 115 263
6zxy-assembly1.cif.gz_B structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme 0.7327 115 262
ID Description Score Start End Superfamily
af_Q9Y5R4_126_337_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8342 86 262 3.40.50.150
af_P9WHV3_83_284_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8249 84 262 3.40.50.150
af_Q9FMI5_170_376_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8239 84 262 3.40.50.150
af_Q2FWE1_84_278_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8163 84 261 3.40.50.150
af_Q2FXZ4_114_311_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8086 117 263 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A354EAN8-F1-model_v4 deleted 0.9392 164 262
AF-A0A660Y4S7-F1-model_v4 Peptide chain release factor N(5)-glutamine methyltransferase 0.9291 160 261 GO:0003676
GO:0008168
GO:0032259
AF-A0A537ZZM8-F1-model_v4 Uncharacterized protein 0.9253 164 261 GO:0036009
AF-A0A7Y2EZU6-F1-model_v4 Peptide chain release factor N(5)-glutamine methyltransferase 0.9242 167 263 GO:0003676
GO:0008168
GO:0032259
AF-A0A7X9E3Y0-F1-model_v4 Peptide chain release factor N(5)-glutamine methyltransferase 0.9205 164 263 GO:0003676
GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
86.95 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map