F477871
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 729 | 300 | 711 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_0000008|Ga0373925_0000008_219777_220739 |
| Length | 320 |
| Sequence | MSEPWGKSEPSERASLGFHASGGGQGRSLLLDEIALATARLAEAGVDSPRADAELIAAHVHNVKRGELHSVPDKDFDARFWVDIGRRENREPLQHITGQAYFRYLELDVGPGVFVPRPETEVMTGWAIDKLRAMNVAEPVAVDLGTGSGAIALSIAQEVPRATVHAVEGDPLARSWAERNITKHVDGYTAGRVLLHAGDFTTPDPRAGLGQLAGLAGRVDLVVSNPPYIPLGSIVPPEVAEYDPPAALWSGGDGLDALRAVERVARWLLRPGGLVAVEHADVQGTAVFWIFAEEAGWRDTANHKDLTRKDRFVTAMWPGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 2 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 3 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 4 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 5 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 6 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 7 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 8 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 9 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 10 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 11 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 12 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 13 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 14 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 15 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 77 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 78 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 95 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 96 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 97 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 112 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 166 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 169 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 183 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 186 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 190 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 192 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 193 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 201 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 202 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 203 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 204 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 209 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 210 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 213 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 214 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 215 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 218 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 280 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 291 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 292 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 293 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 294 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 295 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 296 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 297 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 298 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 299 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 300 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.98 |
| Metatranscriptomes | 0.55 |
| Isolates | 2.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.37 |
| Nodule | 0 |
| Rhizoplane | 3.84 |
| Rhizosphere | 90.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.39 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10009771 | 3300005327 | Bacteria | 7705 |
| 2 | Ga0070658_10099642 | 3300005327 | Bacteria | 2401 |
| 3 | Ga0070676_10083182 | 3300005328 | Bacteria | 1946 |
| 4 | Ga0070683_100024421 | 3300005329 | Bacteria | 5414 |
| 5 | Ga0070683_100242718 | 3300005329 | Bacteria | 1713 |
| 6 | Ga0070670_100292811 | 3300005331 | Bacteria | 1423 |
| 7 | Ga0068869_100027085 | 3300005334 | Bacteria | 3994 |
| 8 | Ga0070666_10031474 | 3300005335 | Bacteria | 3502 |
| 9 | Ga0070680_100090788 | 3300005336 | Bacteria | 2528 |
| 10 | Ga0070682_100091405 | 3300005337 | Bacteria | 1992 |
| 11 | Ga0070660_100088562 | 3300005339 | Bacteria | 2438 |
| 12 | Ga0070660_100126026 | 3300005339 | Bacteria | 2046 |
| 13 | Ga0070689_100025233 | 3300005340 | Bacteria | 4464 |
| 14 | Ga0070692_10055486 | 3300005345 | Bacteria | 2072 |
| 15 | Ga0070692_10077983 | 3300005345 | Bacteria | 1778 |
| 16 | Ga0070669_100259968 | 3300005353 | Bacteria | 1385 |
| 17 | Ga0070675_100017217 | 3300005354 | Bacteria | 5741 |
| 18 | Ga0070671_100440103 | 3300005355 | Bacteria | 1118 |
| 19 | Ga0070673_100068458 | 3300005364 | Bacteria | 2842 |
| 20 | Ga0070688_100085208 | 3300005365 | Bacteria | 2054 |
| 21 | Ga0070659_100004629 | 3300005366 | Bacteria | 9827 |
| 22 | Ga0070659_100012169 | 3300005366 | Bacteria | 6376 |
| 23 | Ga0070667_100027789 | 3300005367 | Bacteria | 4707 |
| 24 | Ga0070667_100031436 | 3300005367 | Bacteria | 4427 |
| 25 | Ga0070709_10002704 | 3300005434 | Bacteria | 9582 |
| 26 | Ga0070709_10006521 | 3300005434 | Bacteria | 6362 |
| 27 | Ga0070709_10011999 | 3300005434 | Bacteria | 4844 |
| 28 | Ga0070709_10038718 | 3300005434 | Bacteria | 2922 |
| 29 | Ga0070709_10350455 | 3300005434 | Bacteria | 1091 |
| 30 | Ga0070714_100002366 | 3300005435 | Bacteria | 13874 |
| 31 | Ga0070714_100008688 | 3300005435 | Bacteria | 7941 |
| 32 | Ga0070714_100070347 | 3300005435 | Bacteria | 3025 |
| 33 | Ga0070714_100074060 | 3300005435 | Bacteria | 2951 |
| 34 | Ga0070714_100162994 | 3300005435 | Bacteria | 2018 |
| 35 | Ga0070714_100177425 | 3300005435 | Bacteria | 1937 |
| 36 | Ga0070714_100211609 | 3300005435 | Bacteria | 1777 |
| 37 | Ga0070714_100325441 | 3300005435 | Bacteria | 1438 |
| 38 | Ga0070714_100506711 | 3300005435 | Bacteria | 1151 |
| 39 | Ga0070714_100545505 | 3300005435 | Bacteria | 1109 |
| 40 | Ga0070714_100643380 | 3300005435 | Bacteria | 1020 |
| 41 | Ga0070713_100089884 | 3300005436 | Bacteria | 2639 |
| 42 | Ga0070713_100143456 | 3300005436 | Bacteria | 2117 |
| 43 | Ga0070713_100146278 | 3300005436 | Bacteria | 2098 |
| 44 | Ga0070713_100155586 | 3300005436 | Bacteria | 2037 |
| 45 | Ga0070713_100332685 | 3300005436 | Bacteria | 1405 |
| 46 | Ga0070713_100502143 | 3300005436 | Bacteria | 1145 |
| 47 | Ga0070710_10004727 | 3300005437 | Bacteria | 6436 |
| 48 | Ga0070710_10010496 | 3300005437 | Bacteria | 4552 |
| 49 | Ga0070710_10026567 | 3300005437 | Bacteria | 3077 |
| 50 | Ga0070710_10051207 | 3300005437 | Bacteria | 2318 |
| 51 | Ga0070711_100024014 | 3300005439 | Bacteria | 3973 |
| 52 | Ga0070711_100024412 | 3300005439 | Bacteria | 3942 |
| 53 | Ga0070711_100033050 | 3300005439 | Bacteria | 3443 |
| 54 | Ga0070711_100086715 | 3300005439 | Bacteria | 2245 |
| 55 | Ga0070711_100226688 | 3300005439 | Bacteria | 1455 |
| 56 | Ga0070705_100106334 | 3300005440 | Bacteria | 1783 |
| 57 | Ga0070700_100028218 | 3300005441 | Bacteria | 3336 |
| 58 | Ga0070694_100212168 | 3300005444 | Bacteria | 1448 |
| 59 | Ga0070708_100002852 | 3300005445 | Bacteria | 13430 |
| 60 | Ga0070708_100006587 | 3300005445 | Bacteria | 9244 |
| 61 | Ga0070708_100392092 | 3300005445 | Bacteria | 1309 |
| 62 | Ga0070663_100008724 | 3300005455 | Bacteria | 6250 |
| 63 | Ga0070678_100284186 | 3300005456 | Bacteria | 1400 |
| 64 | Ga0070681_10043624 | 3300005458 | Bacteria | 4491 |
| 65 | Ga0070681_10107771 | 3300005458 | Bacteria | 2726 |
| 66 | Ga0070685_10004937 | 3300005466 | Bacteria | 6749 |
| 67 | Ga0070685_10021753 | 3300005466 | Bacteria | 3488 |
| 68 | Ga0070706_100010462 | 3300005467 | Bacteria | 8610 |
| 69 | Ga0070706_100017170 | 3300005467 | Bacteria | 6684 |
| 70 | Ga0070706_100078402 | 3300005467 | Bacteria | 3059 |
| 71 | Ga0070706_100088320 | 3300005467 | Bacteria | 2874 |
| 72 | Ga0070706_100094755 | 3300005467 | Bacteria | 2770 |
| 73 | Ga0070706_100360191 | 3300005467 | Bacteria | 1355 |
| 74 | Ga0070707_100001170 | 3300005468 | Bacteria | 25835 |
| 75 | Ga0070707_100005202 | 3300005468 | Bacteria | 12177 |
| 76 | Ga0070707_100029663 | 3300005468 | Bacteria | 5207 |
| 77 | Ga0070707_100036729 | 3300005468 | Bacteria | 4675 |
| 78 | Ga0070707_100037150 | 3300005468 | Bacteria | 4648 |
| 79 | Ga0070707_100090829 | 3300005468 | Bacteria | 2956 |
| 80 | Ga0070707_100377937 | 3300005468 | Bacteria | 1376 |
| 81 | Ga0070698_100000350 | 3300005471 | Bacteria | 47668 |
| 82 | Ga0070698_100000723 | 3300005471 | Bacteria | 35434 |
| 83 | Ga0070698_100000957 | 3300005471 | Bacteria | 31599 |
| 84 | Ga0070698_100008863 | 3300005471 | Bacteria | 10815 |
| 85 | Ga0070698_100044247 | 3300005471 | Bacteria | 4560 |
| 86 | Ga0070698_100115763 | 3300005471 | Bacteria | 2645 |
| 87 | Ga0070698_100158856 | 3300005471 | Bacteria | 2205 |
| 88 | Ga0070698_100280982 | 3300005471 | Bacteria | 1596 |
| 89 | Ga0070699_100152922 | 3300005518 | Bacteria | 2041 |
| 90 | Ga0070679_100024563 | 3300005530 | Bacteria | 5907 |
| 91 | Ga0070679_100510331 | 3300005530 | Bacteria | 1146 |
| 92 | Ga0070684_100183217 | 3300005535 | Bacteria | 1904 |
| 93 | Ga0070684_100220276 | 3300005535 | Bacteria | 1731 |
| 94 | Ga0070697_100005931 | 3300005536 | Bacteria | 9437 |
| 95 | Ga0070697_100046324 | 3300005536 | Bacteria | 3524 |
| 96 | Ga0070697_100131407 | 3300005536 | Bacteria | 2100 |
| 97 | Ga0068853_100011285 | 3300005539 | Bacteria | 7249 |
| 98 | Ga0068853_100082924 | 3300005539 | Bacteria | 2808 |
| 99 | Ga0070672_100014724 | 3300005543 | Bacteria | 5548 |
| 100 | Ga0070686_100017086 | 3300005544 | Bacteria | 4234 |
| 101 | Ga0070695_100038148 | 3300005545 | Bacteria | 3030 |
| 102 | Ga0070695_100049545 | 3300005545 | Bacteria | 2689 |
| 103 | Ga0070696_100113989 | 3300005546 | Bacteria | 1949 |
| 104 | Ga0070665_100148679 | 3300005548 | Bacteria | 2345 |
| 105 | Ga0068855_100282567 | 3300005563 | Bacteria | 1842 |
| 106 | Ga0068855_100350083 | 3300005563 | Bacteria | 1627 |
| 107 | Ga0070664_100046581 | 3300005564 | Bacteria | 3662 |
| 108 | Ga0068856_100043631 | 3300005614 | Bacteria | 4412 |
| 109 | Ga0068856_100061196 | 3300005614 | Bacteria | 3719 |
| 110 | Ga0068859_100054396 | 3300005617 | Bacteria | 4025 |
| 111 | Ga0068859_100086257 | 3300005617 | Bacteria | 3186 |
| 112 | Ga0068864_100209015 | 3300005618 | Bacteria | 1796 |
| 113 | Ga0068866_10007968 | 3300005718 | Bacteria | 4448 |
| 114 | Ga0068861_100307086 | 3300005719 | Bacteria | 1376 |
| 115 | Ga0068863_100111980 | 3300005841 | Bacteria | 2599 |
| 116 | Ga0068863_100448863 | 3300005841 | Bacteria | 1266 |
| 117 | Ga0068860_100110471 | 3300005843 | Bacteria | 2628 |
| 118 | Ga0081540_1000250 | 3300005983 | Bacteria | 56639 |
| 119 | Ga0081540_1000386 | 3300005983 | Bacteria | 44292 |
| 120 | Ga0070717_10000595 | 3300006028 | Bacteria | 23178 |
| 121 | Ga0070717_10009690 | 3300006028 | Bacteria | 7250 |
| 122 | Ga0070717_10011331 | 3300006028 | Bacteria | 6765 |
| 123 | Ga0070717_10057455 | 3300006028 | Bacteria | 3216 |
| 124 | Ga0070717_10060467 | 3300006028 | Bacteria | 3137 |
| 125 | Ga0070717_10106768 | 3300006028 | Bacteria | 2384 |
| 126 | Ga0070717_10222771 | 3300006028 | Bacteria | 1658 |
| 127 | Ga0070717_10276882 | 3300006028 | Bacteria | 1487 |
| 128 | Ga0070717_10475002 | 3300006028 | Bacteria | 1128 |
| 129 | Ga0070717_10544602 | 3300006028 | Bacteria | 1051 |
| 130 | Ga0070715_10005611 | 3300006163 | Bacteria | 4199 |
| 131 | Ga0070715_10025036 | 3300006163 | Bacteria | 2360 |
| 132 | Ga0070715_10030715 | 3300006163 | Bacteria | 2175 |
| 133 | Ga0070716_100000685 | 3300006173 | Bacteria | 14478 |
| 134 | Ga0070716_100001892 | 3300006173 | Bacteria | 9499 |
| 135 | Ga0070716_100046503 | 3300006173 | Bacteria | 2443 |
| 136 | Ga0070716_100083470 | 3300006173 | Bacteria | 1913 |
| 137 | Ga0070716_100132338 | 3300006173 | Bacteria | 1578 |
| 138 | Ga0070716_100214954 | 3300006173 | Bacteria | 1287 |
| 139 | Ga0070712_100001777 | 3300006175 | Bacteria | 13190 |
| 140 | Ga0070712_100029417 | 3300006175 | Bacteria | 3681 |
| 141 | Ga0070712_100029817 | 3300006175 | Bacteria | 3660 |
| 142 | Ga0070712_100042878 | 3300006175 | Bacteria | 3112 |
| 143 | Ga0070712_100054448 | 3300006175 | Bacteria | 2797 |
| 144 | Ga0097621_100007903 | 3300006237 | Bacteria | 7629 |
| 145 | Ga0097621_100082567 | 3300006237 | Bacteria | 2676 |
| 146 | Ga0097621_100258256 | 3300006237 | Bacteria | 1528 |
| 147 | Ga0075431_100404941 | 3300006847 | Bacteria | 1365 |
| 148 | Ga0075433_10101566 | 3300006852 | Bacteria | 2546 |
| 149 | Ga0075434_100165210 | 3300006871 | Bacteria | 2233 |
| 150 | Ga0075429_100043208 | 3300006880 | Bacteria | 3921 |
| 151 | Ga0075436_100072291 | 3300006914 | Bacteria | 2386 |
| 152 | Ga0075436_100141277 | 3300006914 | Bacteria | 1692 |
| 153 | Ga0097620_100054396 | 3300006931 | Bacteria | 4025 |
| 154 | Ga0097620_100086260 | 3300006931 | Bacteria | 3186 |
| 155 | Ga0075435_100066923 | 3300007076 | Bacteria | 2924 |
| 156 | Ga0075435_100144057 | 3300007076 | Bacteria | 2000 |
| 157 | Ga0075435_100207018 | 3300007076 | Bacteria | 1663 |
| 158 | Ga0099795_10045308 | 3300007788 | Bacteria | 1581 |
| 159 | Ga0105240_10195121 | 3300009093 | Bacteria | 2378 |
| 160 | Ga0111539_10058081 | 3300009094 | Bacteria | 4591 |
| 161 | Ga0105247_10009095 | 3300009101 | Bacteria | 6046 |
| 162 | Ga0114129_10156011 | 3300009147 | Bacteria | 3121 |
| 163 | Ga0114129_10240302 | 3300009147 | Bacteria | 2435 |
| 164 | Ga0105243_10039299 | 3300009148 | Bacteria | 3687 |
| 165 | Ga0105241_10000322 | 3300009174 | Bacteria | 36168 |
| 166 | Ga0105241_10075160 | 3300009174 | Bacteria | 2632 |
| 167 | Ga0105241_10115484 | 3300009174 | Bacteria | 2155 |
| 168 | Ga0105241_10221210 | 3300009174 | Bacteria | 1591 |
| 169 | Ga0105242_10030525 | 3300009176 | Bacteria | 4304 |
| 170 | Ga0105242_10411908 | 3300009176 | Bacteria | 1264 |
| 171 | Ga0105248_10023243 | 3300009177 | Bacteria | 6885 |
| 172 | Ga0105237_10199501 | 3300009545 | Bacteria | 2000 |
| 173 | Ga0105237_10371724 | 3300009545 | Bacteria | 1434 |
| 174 | Ga0105237_10492355 | 3300009545 | Bacteria | 1232 |
| 175 | Ga0105249_10217050 | 3300009553 | Bacteria | 1880 |
| 176 | Ga0105246_10039028 | 3300011119 | Bacteria | 3196 |
| 177 | Ga0105246_10042791 | 3300011119 | Bacteria | 3068 |
| 178 | Ga0157323_1001231 | 3300012495 | Bacteria | 1248 |
| 179 | Ga0157342_1000213 | 3300012507 | Bacteria | 3148 |
| 180 | Ga0157338_1000575 | 3300012515 | Bacteria | 2239 |
| 181 | Ga0157370_10098808 | 3300013104 | Bacteria | 2736 |
| 182 | Ga0157370_10270515 | 3300013104 | Bacteria | 1570 |
| 183 | Ga0157369_10037673 | 3300013105 | Bacteria | 5293 |
| 184 | Ga0157369_10170008 | 3300013105 | Bacteria | 2297 |
| 185 | Ga0157374_10017896 | 3300013296 | Bacteria | 6246 |
| 186 | Ga0157374_10431359 | 3300013296 | Bacteria | 1318 |
| 187 | Ga0157378_10029606 | 3300013297 | Bacteria | 4835 |
| 188 | Ga0163162_10158023 | 3300013306 | Bacteria | 2388 |
| 189 | Ga0163162_10158913 | 3300013306 | Bacteria | 2381 |
| 190 | Ga0157375_10029877 | 3300013308 | Bacteria | 5131 |
| 191 | Ga0163163_10105634 | 3300014325 | Bacteria | 2842 |
| 192 | Ga0163163_10441676 | 3300014325 | Bacteria | 1361 |
| 193 | Ga0157379_10004934 | 3300014968 | Bacteria | 11448 |
| 194 | Ga0157379_10011513 | 3300014968 | Bacteria | 7720 |
| 195 | Ga0157376_10002413 | 3300014969 | Bacteria | 12626 |
| 196 | Ga0157376_10118718 | 3300014969 | Bacteria | 2341 |
| 197 | Ga0163161_10029215 | 3300017792 | Bacteria | 3919 |
| 198 | Ga0206354_11210166 | 3300020081 | Bacteria | 1593 |
| 199 | Ga0206353_10985336 | 3300020082 | Bacteria | 1444 |
| 200 | Ga0213875_10000956 | 3300021388 | Bacteria | 20645 |
| 201 | Ga0213875_10001237 | 3300021388 | Bacteria | 17240 |
| 202 | Ga0213875_10004658 | 3300021388 | Bacteria | 7473 |
| 203 | Ga0213875_10060207 | 3300021388 | Bacteria | 1776 |
| 204 | Ga0224712_10008572 | 3300022467 | Bacteria | 3038 |
| 205 | Ga0224712_10019898 | 3300022467 | Bacteria | 2271 |
| 206 | Ga0224572_1004952 | 3300024225 | Bacteria | 2353 |
| 207 | Ga0209148_1000401 | 3300025254 | Bacteria | 50504 |
| 208 | Ga0207653_10002100 | 3300025885 | Bacteria | 6350 |
| 209 | Ga0207692_10006206 | 3300025898 | Bacteria | 4839 |
| 210 | Ga0207692_10008220 | 3300025898 | Bacteria | 4314 |
| 211 | Ga0207692_10021468 | 3300025898 | Bacteria | 2954 |
| 212 | Ga0207692_10076769 | 3300025898 | Bacteria | 1776 |
| 213 | Ga0207642_10057235 | 3300025899 | Bacteria | 1792 |
| 214 | Ga0207710_10065844 | 3300025900 | Bacteria | 1652 |
| 215 | Ga0207688_10056819 | 3300025901 | Bacteria | 2199 |
| 216 | Ga0207647_10055704 | 3300025904 | Bacteria | 2429 |
| 217 | Ga0207685_10001956 | 3300025905 | Bacteria | 4562 |
| 218 | Ga0207685_10012548 | 3300025905 | Bacteria | 2589 |
| 219 | Ga0207699_10000107 | 3300025906 | Bacteria | 58818 |
| 220 | Ga0207699_10003816 | 3300025906 | Bacteria | 7191 |
| 221 | Ga0207699_10006820 | 3300025906 | Bacteria | 5555 |
| 222 | Ga0207699_10011658 | 3300025906 | Bacteria | 4447 |
| 223 | Ga0207699_10019626 | 3300025906 | Bacteria | 3609 |
| 224 | Ga0207699_10035780 | 3300025906 | Bacteria | 2827 |
| 225 | Ga0207645_10046014 | 3300025907 | Bacteria | 2788 |
| 226 | Ga0207643_10006315 | 3300025908 | Bacteria | 6346 |
| 227 | Ga0207705_10005871 | 3300025909 | Bacteria | 9139 |
| 228 | Ga0207684_10001220 | 3300025910 | Bacteria | 28611 |
| 229 | Ga0207684_10009531 | 3300025910 | Bacteria | 8569 |
| 230 | Ga0207684_10023313 | 3300025910 | Bacteria | 5284 |
| 231 | Ga0207684_10051337 | 3300025910 | Bacteria | 3499 |
| 232 | Ga0207684_10089043 | 3300025910 | Bacteria | 2630 |
| 233 | Ga0207654_10000003 | 3300025911 | Bacteria | 1030378 |
| 234 | Ga0207654_10016701 | 3300025911 | Bacteria | 3826 |
| 235 | Ga0207707_10045221 | 3300025912 | Bacteria | 3837 |
| 236 | Ga0207707_10109248 | 3300025912 | Bacteria | 2418 |
| 237 | Ga0207671_10026763 | 3300025914 | Bacteria | 4317 |
| 238 | Ga0207693_10000536 | 3300025915 | Bacteria | 34408 |
| 239 | Ga0207693_10003679 | 3300025915 | Bacteria | 13088 |
| 240 | Ga0207693_10052608 | 3300025915 | Bacteria | 3195 |
| 241 | Ga0207693_10062238 | 3300025915 | Bacteria | 2924 |
| 242 | Ga0207693_10074287 | 3300025915 | Bacteria | 2662 |
| 243 | Ga0207693_10182535 | 3300025915 | Bacteria | 1651 |
| 244 | Ga0207693_10244888 | 3300025915 | Bacteria | 1407 |
| 245 | Ga0207663_10002641 | 3300025916 | Bacteria | 8627 |
| 246 | Ga0207663_10031759 | 3300025916 | Bacteria | 3128 |
| 247 | Ga0207663_10040846 | 3300025916 | Bacteria | 2822 |
| 248 | Ga0207663_10043707 | 3300025916 | Bacteria | 2745 |
| 249 | Ga0207663_10082180 | 3300025916 | Bacteria | 2112 |
| 250 | Ga0207663_10249605 | 3300025916 | Bacteria | 1305 |
| 251 | Ga0207660_10029377 | 3300025917 | Bacteria | 3770 |
| 252 | Ga0207660_10031722 | 3300025917 | Bacteria | 3642 |
| 253 | Ga0207657_10006580 | 3300025919 | Bacteria | 12034 |
| 254 | Ga0207657_10011368 | 3300025919 | Bacteria | 8843 |
| 255 | Ga0207657_10031634 | 3300025919 | Bacteria | 4789 |
| 256 | Ga0207652_10009647 | 3300025921 | Bacteria | 7765 |
| 257 | Ga0207652_10097622 | 3300025921 | Bacteria | 2590 |
| 258 | Ga0207652_10148156 | 3300025921 | Bacteria | 2101 |
| 259 | Ga0207646_10000071 | 3300025922 | Bacteria | 141799 |
| 260 | Ga0207646_10004644 | 3300025922 | Bacteria | 14825 |
| 261 | Ga0207646_10028949 | 3300025922 | Bacteria | 5039 |
| 262 | Ga0207646_10061721 | 3300025922 | Bacteria | 3345 |
| 263 | Ga0207646_10062919 | 3300025922 | Bacteria | 3312 |
| 264 | Ga0207687_10027601 | 3300025927 | Bacteria | 3811 |
| 265 | Ga0207700_10001550 | 3300025928 | Bacteria | 13035 |
| 266 | Ga0207700_10005025 | 3300025928 | Bacteria | 7868 |
| 267 | Ga0207700_10008932 | 3300025928 | Bacteria | 6236 |
| 268 | Ga0207700_10014749 | 3300025928 | Bacteria | 5131 |
| 269 | Ga0207700_10027203 | 3300025928 | Bacteria | 4001 |
| 270 | Ga0207700_10037702 | 3300025928 | Bacteria | 3503 |
| 271 | Ga0207700_10082623 | 3300025928 | Bacteria | 2512 |
| 272 | Ga0207700_10228877 | 3300025928 | Bacteria | 1579 |
| 273 | Ga0207700_10288239 | 3300025928 | Bacteria | 1414 |
| 274 | Ga0207700_10365186 | 3300025928 | Bacteria | 1259 |
| 275 | Ga0207664_10000271 | 3300025929 | Bacteria | 39054 |
| 276 | Ga0207664_10001093 | 3300025929 | Bacteria | 18092 |
| 277 | Ga0207664_10002438 | 3300025929 | Bacteria | 12308 |
| 278 | Ga0207664_10015657 | 3300025929 | Bacteria | 5512 |
| 279 | Ga0207664_10019650 | 3300025929 | Bacteria | 4997 |
| 280 | Ga0207664_10039991 | 3300025929 | Bacteria | 3643 |
| 281 | Ga0207664_10065794 | 3300025929 | Bacteria | 2903 |
| 282 | Ga0207664_10123767 | 3300025929 | Bacteria | 2168 |
| 283 | Ga0207664_10163236 | 3300025929 | Bacteria | 1901 |
| 284 | Ga0207664_10299627 | 3300025929 | Bacteria | 1414 |
| 285 | Ga0207664_10337047 | 3300025929 | Bacteria | 1333 |
| 286 | Ga0207664_10360866 | 3300025929 | Bacteria | 1287 |
| 287 | Ga0207644_10082655 | 3300025931 | Bacteria | 2376 |
| 288 | Ga0207644_10300170 | 3300025931 | Bacteria | 1294 |
| 289 | Ga0207690_10001961 | 3300025932 | Bacteria | 12627 |
| 290 | Ga0207706_10017461 | 3300025933 | Bacteria | 6465 |
| 291 | Ga0207670_10256510 | 3300025936 | Bacteria | 1353 |
| 292 | Ga0207669_10057412 | 3300025937 | Bacteria | 2370 |
| 293 | Ga0207665_10001112 | 3300025939 | Bacteria | 18027 |
| 294 | Ga0207665_10001335 | 3300025939 | Bacteria | 16622 |
| 295 | Ga0207665_10024497 | 3300025939 | Bacteria | 3979 |
| 296 | Ga0207665_10075627 | 3300025939 | Bacteria | 2307 |
| 297 | Ga0207665_10149661 | 3300025939 | Bacteria | 1671 |
| 298 | Ga0207665_10192011 | 3300025939 | Bacteria | 1484 |
| 299 | Ga0207665_10216128 | 3300025939 | Bacteria | 1403 |
| 300 | Ga0207691_10039540 | 3300025940 | Bacteria | 4364 |
| 301 | Ga0207711_10048902 | 3300025941 | Bacteria | 3619 |
| 302 | Ga0207689_10022170 | 3300025942 | Bacteria | 5340 |
| 303 | Ga0207661_10037177 | 3300025944 | Bacteria | 3806 |
| 304 | Ga0207661_10086843 | 3300025944 | Bacteria | 2597 |
| 305 | Ga0207661_10135661 | 3300025944 | Bacteria | 2113 |
| 306 | Ga0207661_10181656 | 3300025944 | Bacteria | 1838 |
| 307 | Ga0207679_10173374 | 3300025945 | Bacteria | 1778 |
| 308 | Ga0207667_10015792 | 3300025949 | Bacteria | 8560 |
| 309 | Ga0207667_10087836 | 3300025949 | Bacteria | 3216 |
| 310 | Ga0207668_10176044 | 3300025972 | Bacteria | 1683 |
| 311 | Ga0207677_10150012 | 3300026023 | Bacteria | 1797 |
| 312 | Ga0207639_10067133 | 3300026041 | Bacteria | 2790 |
| 313 | Ga0207639_10494789 | 3300026041 | Bacteria | 1116 |
| 314 | Ga0207678_10003646 | 3300026067 | Bacteria | 13847 |
| 315 | Ga0207678_10050513 | 3300026067 | Bacteria | 3592 |
| 316 | Ga0207708_10014032 | 3300026075 | Bacteria | 5985 |
| 317 | Ga0207708_10339513 | 3300026075 | Bacteria | 1230 |
| 318 | Ga0207702_10046299 | 3300026078 | Bacteria | 3661 |
| 319 | Ga0207702_10047438 | 3300026078 | Bacteria | 3620 |
| 320 | Ga0207641_10050492 | 3300026088 | Bacteria | 3519 |
| 321 | Ga0207648_10045889 | 3300026089 | Bacteria | 3832 |
| 322 | Ga0207676_10011596 | 3300026095 | Bacteria | 6303 |
| 323 | Ga0207674_10019631 | 3300026116 | Bacteria | 7318 |
| 324 | Ga0207674_10182913 | 3300026116 | Bacteria | 2047 |
| 325 | Ga0207675_100036167 | 3300026118 | Bacteria | 4606 |
| 326 | Ga0207683_10009297 | 3300026121 | Bacteria | 8374 |
| 327 | Ga0207428_10064810 | 3300027907 | Bacteria | 2884 |
| 328 | Ga0268266_10297934 | 3300028379 | Bacteria | 1503 |
| 329 | Ga0268266_10801224 | 3300028379 | Bacteria | 910 |
| 330 | Ga0265337_1000159 | 3300028556 | Bacteria | 34586 |
| 331 | Ga0265326_10000487 | 3300028558 | Bacteria | 15286 |
| 332 | Ga0265319_1006829 | 3300028563 | Bacteria | 5220 |
| 333 | Ga0265334_10000745 | 3300028573 | Bacteria | 16295 |
| 334 | Ga0265318_10020736 | 3300028577 | Bacteria | 2648 |
| 335 | Ga0265323_10007256 | 3300028653 | Bacteria | 4619 |
| 336 | Ga0265322_10003714 | 3300028654 | Bacteria | 4595 |
| 337 | Ga0265336_10005196 | 3300028666 | Bacteria | 4829 |
| 338 | Ga0265338_10000246 | 3300028800 | Bacteria | 99261 |
| 339 | Ga0265338_10001163 | 3300028800 | Bacteria | 43486 |
| 340 | Ga0265338_10006190 | 3300028800 | Bacteria | 15341 |
| 341 | Ga0265338_10007955 | 3300028800 | Bacteria | 12990 |
| 342 | Ga0265332_10001531 | 3300031238 | Bacteria | 12819 |
| 343 | Ga0265320_10002564 | 3300031240 | Bacteria | 12628 |
| 344 | Ga0265340_10002368 | 3300031247 | Bacteria | 10730 |
| 345 | Ga0265316_10041857 | 3300031344 | Bacteria | 3663 |
| 346 | Ga0265313_10016183 | 3300031595 | Bacteria | 4299 |
| 347 | Ga0307514_10053243 | 3300031649 | Bacteria | 3124 |
| 348 | Ga0265314_10008867 | 3300031711 | Bacteria | 8586 |
| 349 | Ga0265342_10030403 | 3300031712 | Bacteria | 3346 |
| 350 | Ga0307516_10162015 | 3300031730 | Bacteria | 1986 |
| 351 | Ga0307411_10350715 | 3300032005 | Bacteria | 1203 |
| 352 | Ga0373926_0001049 | 3300035083 | Bacteria | 8117 |
| 353 | Ga0373926_0007106 | 3300035083 | Bacteria | 3726 |
| 354 | Ga0373934_0000290 | 3300035086 | Bacteria | 18043 |
| 355 | Ga0373934_0006360 | 3300035086 | Bacteria | 4381 |
| 356 | Ga0373934_0010966 | 3300035086 | Bacteria | 3408 |
| 357 | Ga0373934_0013804 | 3300035086 | Bacteria | 3056 |
| 358 | Ga0373934_0023058 | 3300035086 | Bacteria | 2404 |
| 359 | Ga0373940_0014450 | 3300035088 | Bacteria | 1926 |
| 360 | Ga0373944_0001695 | 3300035089 | Bacteria | 5576 |
| 361 | Ga0373944_0080296 | 3300035089 | Bacteria | 1076 |
| 362 | Ga0373951_0019994 | 3300035091 | Bacteria | 1531 |
| 363 | Ga0373923_0006704 | 3300035111 | Bacteria | 4002 |
| 364 | Ga0373923_0011154 | 3300035111 | Bacteria | 3289 |
| 365 | Ga0373923_0014709 | 3300035111 | Bacteria | 2944 |
| 366 | Ga0373923_0049710 | 3300035111 | Bacteria | 1754 |
| 367 | Ga0373923_0053487 | 3300035111 | Bacteria | 1698 |
| 368 | Ga0373936_0019346 | 3300035113 | Bacteria | 2638 |
| 369 | Ga0373936_0038331 | 3300035113 | Bacteria | 1915 |
| 370 | Ga0373936_0049912 | 3300035113 | Bacteria | 1691 |
| 371 | Ga0373936_0079042 | 3300035113 | Bacteria | 1367 |
| 372 | Ga0373939_0038958 | 3300035114 | Bacteria | 1420 |
| 373 | Ga0373945_0006188 | 3300035116 | Bacteria | 3850 |
| 374 | Ga0373945_0034052 | 3300035116 | Bacteria | 1813 |
| 375 | Ga0373945_0037758 | 3300035116 | Bacteria | 1735 |
| 376 | Ga0373953_0000281 | 3300035117 | Bacteria | 14084 |
| 377 | Ga0373953_0001460 | 3300035117 | Bacteria | 6858 |
| 378 | Ga0373953_0014187 | 3300035117 | Bacteria | 2861 |
| 379 | Ga0373953_0016162 | 3300035117 | Bacteria | 2720 |
| 380 | Ga0373954_0000410 | 3300035118 | Bacteria | 16026 |
| 381 | Ga0373954_0012939 | 3300035118 | Bacteria | 3715 |
| 382 | Ga0373954_0030493 | 3300035118 | Bacteria | 2486 |
| 383 | Ga0373954_0036378 | 3300035118 | Bacteria | 2285 |
| 384 | Ga0373954_0037013 | 3300035118 | Bacteria | 2266 |
| 385 | Ga0373954_0041952 | 3300035118 | Bacteria | 2134 |
| 386 | Ga0373956_0001346 | 3300035119 | Bacteria | 10126 |
| 387 | Ga0373956_0001566 | 3300035119 | Bacteria | 9430 |
| 388 | Ga0373956_0009092 | 3300035119 | Bacteria | 4029 |
| 389 | Ga0373956_0013201 | 3300035119 | Bacteria | 3436 |
| 390 | Ga0373956_0079576 | 3300035119 | Bacteria | 1502 |
| 391 | Ga0373957_0002779 | 3300035120 | Bacteria | 5038 |
| 392 | Ga0373957_0007398 | 3300035120 | Bacteria | 3513 |
| 393 | Ga0373943_0000958 | 3300035170 | Bacteria | 12807 |
| 394 | Ga0373943_0015727 | 3300035170 | Bacteria | 3440 |
| 395 | Ga0373946_0002228 | 3300035171 | Bacteria | 6838 |
| 396 | Ga0373946_0004794 | 3300035171 | Bacteria | 4868 |
| 397 | Ga0373955_0000041 | 3300035172 | Bacteria | 51219 |
| 398 | Ga0373955_0008076 | 3300035172 | Bacteria | 4867 |
| 399 | Ga0373955_0009353 | 3300035172 | Bacteria | 4586 |
| 400 | Ga0373955_0015270 | 3300035172 | Bacteria | 3755 |
| 401 | Ga0373955_0048774 | 3300035172 | Bacteria | 2297 |
| 402 | Ga0373955_0218982 | 3300035172 | Bacteria | 1136 |
| 403 | Ga0373924_0002565 | 3300035410 | Bacteria | 6131 |
| 404 | Ga0373924_0010064 | 3300035410 | Bacteria | 3481 |
| 405 | Ga0373924_0018922 | 3300035410 | Bacteria | 2662 |
| 406 | Ga0373924_0090093 | 3300035410 | Bacteria | 1311 |
| 407 | Ga0373931_0014660 | 3300035691 | Bacteria | 3835 |
| 408 | Ga0373931_0082238 | 3300035691 | Bacteria | 1780 |
| 409 | Ga0373935_0009024 | 3300035692 | Bacteria | 5965 |
| 410 | Ga0373935_0019782 | 3300035692 | Bacteria | 4108 |
| 411 | Ga0373935_0036404 | 3300035692 | Bacteria | 3076 |
| 412 | Ga0373935_0111228 | 3300035692 | Bacteria | 1818 |
| 413 | Ga0373935_0140611 | 3300035692 | Bacteria | 1630 |
| 414 | Ga0373927_0018103 | 3300035695 | Bacteria | 4633 |
| 415 | Ga0373927_0082561 | 3300035695 | Bacteria | 2083 |
| 416 | Ga0373933_0000246 | 3300035724 | Bacteria | 35782 |
| 417 | Ga0373933_0000589 | 3300035724 | Bacteria | 22706 |
| 418 | Ga0373933_0014754 | 3300035724 | Bacteria | 4348 |
| 419 | Ga0373933_0036089 | 3300035724 | Bacteria | 2891 |
| 420 | Ga0373947_0000015 | 3300035725 | Bacteria | 129181 |
| 421 | Ga0373947_0015270 | 3300035725 | Bacteria | 4408 |
| 422 | Ga0373947_0047457 | 3300035725 | Bacteria | 2573 |
| 423 | Ga0373947_0100955 | 3300035725 | Bacteria | 1813 |
| 424 | Ga0373947_0159606 | 3300035725 | Bacteria | 1457 |
| 425 | Ga0373937_0000172 | 3300036401 | Bacteria | 63213 |
| 426 | Ga0373937_0031728 | 3300036401 | Bacteria | 4788 |
| 427 | Ga0373937_0062750 | 3300036401 | Bacteria | 3416 |
| 428 | Ga0373937_0230427 | 3300036401 | Bacteria | 1744 |
| 429 | Ga0373937_0269045 | 3300036401 | Bacteria | 1608 |
| 430 | Ga0373937_0697680 | 3300036401 | Bacteria | 961 |
| 431 | Ga0373925_0000008 | 3300037068 | Bacteria | 249158 |
| 432 | Ga0373925_0002980 | 3300037068 | Bacteria | 13363 |
| 433 | Ga0373925_0018624 | 3300037068 | Bacteria | 5048 |
| 434 | Ga0373925_0022968 | 3300037068 | Bacteria | 4551 |
| 435 | Ga0373925_0054778 | 3300037068 | Bacteria | 2983 |
| 436 | Ga0373925_0074548 | 3300037068 | Bacteria | 2570 |
| 437 | Ga0373925_0076000 | 3300037068 | Bacteria | 2546 |
| 438 | Ga0373925_0103440 | 3300037068 | Bacteria | 2192 |
| 439 | Ga0373925_0106514 | 3300037068 | Bacteria | 2161 |
| 440 | Ga0373925_0108976 | 3300037068 | Bacteria | 2137 |
| 441 | Ga0395900_0456786 | 3300037418 | Bacteria | 1233 |
| 442 | Ga0395898_0256882 | 3300037466 | Bacteria | 1666 |
| 443 | Ga0436364_0123513 | 3300037853 | Bacteria | 2014 |
| 444 | Ga0436364_0180190 | 3300037853 | Bacteria | 1920 |
| 445 | Ga0436364_0397052 | 3300037853 | Bacteria | 1179 |
| 446 | Ga0436364_0584067 | 3300037853 | Bacteria | 157477 |
| 447 | Ga0436364_0644067 | 3300037853 | Bacteria | 7596 |
| 448 | Ga0436364_1380199 | 3300037853 | Bacteria | 2987 |
| 449 | Ga0436364_1502227 | 3300037853 | Bacteria | 2944 |
| 450 | Ga0436360_0730294 | 3300039438 | Bacteria | 871 |
| 451 | Ga0436363_0686281 | 3300039450 | Bacteria | 1103 |
| 452 | Ga0436363_1174479 | 3300039450 | Bacteria | 1093 |
| 453 | Ga0436363_1612024 | 3300039450 | Bacteria | 1664 |
| 454 | Ga0451853_2794855 | 3300041512 | Bacteria | 1526 |
| 455 | Ga0466969_0136010 | 3300044656 | Bacteria | 1138 |
| 456 | Ga0466966_0012618 | 3300044684 | Bacteria | 5600 |
| 457 | Ga0466961_0053362 | 3300044693 | Bacteria | 2579 |
| 458 | Ga0466963_0026301 | 3300044694 | Bacteria | 3721 |
| 459 | Ga0466963_0514740 | 3300044694 | Bacteria | 845 |
| 460 | Ga0466959_0109711 | 3300045049 | Bacteria | 1970 |
| 461 | Ga0466967_0059991 | 3300045976 | Bacteria | 3369 |
| 462 | Ga0466967_0070331 | 3300045976 | Bacteria | 3131 |
| 463 | Ga0495592_0000417 | 3300046454 | Bacteria | 32303 |
| 464 | Ga0495592_0006283 | 3300046454 | Bacteria | 8839 |
| 465 | Ga0495592_0022578 | 3300046454 | Bacteria | 4786 |
| 466 | Ga0495592_0026450 | 3300046454 | Bacteria | 4399 |
| 467 | Ga0495592_0034414 | 3300046454 | Bacteria | 3818 |
| 468 | Ga0495592_0074035 | 3300046454 | Bacteria | 2474 |
| 469 | Ga0495592_0077847 | 3300046454 | Bacteria | 2403 |
| 470 | Ga0495603_0005458 | 3300046455 | Bacteria | 7590 |
| 471 | Ga0495603_0177565 | 3300046455 | Bacteria | 1233 |
| 472 | Ga0495629_0031840 | 3300046459 | Bacteria | 3734 |
| 473 | Ga0495629_0036601 | 3300046459 | Bacteria | 3463 |
| 474 | Ga0495629_0213410 | 3300046459 | Bacteria | 1332 |
| 475 | Ga0495641_0022457 | 3300046461 | Bacteria | 3156 |
| 476 | Ga0495641_0039201 | 3300046461 | Bacteria | 2210 |
| 477 | Ga0495651_0000118 | 3300046462 | Bacteria | 58414 |
| 478 | Ga0495651_0001369 | 3300046462 | Bacteria | 18875 |
| 479 | Ga0495651_0003084 | 3300046462 | Bacteria | 12869 |
| 480 | Ga0495651_0011483 | 3300046462 | Bacteria | 6802 |
| 481 | Ga0495651_0039548 | 3300046462 | Bacteria | 3671 |
| 482 | Ga0495651_0116926 | 3300046462 | Bacteria | 1963 |
| 483 | Ga0495651_0349492 | 3300046462 | Bacteria | 977 |
| 484 | Ga0495653_0004695 | 3300046463 | Bacteria | 11060 |
| 485 | Ga0495653_0016444 | 3300046463 | Bacteria | 6024 |
| 486 | Ga0495653_0024624 | 3300046463 | Bacteria | 4846 |
| 487 | Ga0495653_0025994 | 3300046463 | Bacteria | 4698 |
| 488 | Ga0495653_0117168 | 3300046463 | Bacteria | 1903 |
| 489 | Ga0495653_0131455 | 3300046463 | Bacteria | 1771 |
| 490 | Ga0495580_0084392 | 3300046472 | Bacteria | 2212 |
| 491 | Ga0495580_0491011 | 3300046472 | Bacteria | 820 |
| 492 | Ga0495582_0016884 | 3300046473 | Bacteria | 3997 |
| 493 | Ga0495639_0002595 | 3300046475 | Bacteria | 7868 |
| 494 | Ga0495639_0014969 | 3300046475 | Bacteria | 3362 |
| 495 | Ga0495639_0068572 | 3300046475 | Bacteria | 1635 |
| 496 | Ga0495662_0001119 | 3300046476 | Bacteria | 13196 |
| 497 | Ga0495662_0011609 | 3300046476 | Bacteria | 4306 |
| 498 | Ga0495662_0021421 | 3300046476 | Bacteria | 3124 |
| 499 | Ga0495662_0067218 | 3300046476 | Bacteria | 1734 |
| 500 | Ga0495664_0003380 | 3300046477 | Bacteria | 8668 |
| 501 | Ga0495664_0004752 | 3300046477 | Bacteria | 7426 |
| 502 | Ga0495664_0013461 | 3300046477 | Bacteria | 4638 |
| 503 | Ga0495664_0091433 | 3300046477 | Bacteria | 1829 |
| 504 | Ga0495664_0104692 | 3300046477 | Bacteria | 1705 |
| 505 | Ga0495594_0080164 | 3300046499 | Bacteria | 1822 |
| 506 | Ga0495594_0215063 | 3300046499 | Bacteria | 1096 |
| 507 | Ga0495608_0000156 | 3300046511 | Bacteria | 48856 |
| 508 | Ga0495608_0011647 | 3300046511 | Bacteria | 6117 |
| 509 | Ga0495608_0023347 | 3300046511 | Bacteria | 4238 |
| 510 | Ga0495608_0032494 | 3300046511 | Bacteria | 3527 |
| 511 | Ga0495608_0075294 | 3300046511 | Bacteria | 2200 |
| 512 | Ga0495618_0020398 | 3300046514 | Bacteria | 4079 |
| 513 | Ga0495618_0024807 | 3300046514 | Bacteria | 3717 |
| 514 | Ga0495618_0046067 | 3300046514 | Bacteria | 2752 |
| 515 | Ga0495628_0000655 | 3300046516 | Bacteria | 31697 |
| 516 | Ga0495628_0042494 | 3300046516 | Bacteria | 3625 |
| 517 | Ga0495628_0052004 | 3300046516 | Bacteria | 3237 |
| 518 | Ga0495628_0077236 | 3300046516 | Bacteria | 2590 |
| 519 | Ga0495628_0079637 | 3300046516 | Bacteria | 2547 |
| 520 | Ga0495628_0112294 | 3300046516 | Bacteria | 2095 |
| 521 | Ga0495630_0046639 | 3300046517 | Bacteria | 3239 |
| 522 | Ga0495630_0078629 | 3300046517 | Bacteria | 2487 |
| 523 | Ga0495630_0089251 | 3300046517 | Bacteria | 2328 |
| 524 | Ga0495666_0025606 | 3300046526 | Bacteria | 2913 |
| 525 | Ga0495666_0031604 | 3300046526 | Bacteria | 2593 |
| 526 | Ga0495652_0000436 | 3300046529 | Bacteria | 48806 |
| 527 | Ga0495652_0006632 | 3300046529 | Bacteria | 10749 |
| 528 | Ga0495652_0025949 | 3300046529 | Bacteria | 5177 |
| 529 | Ga0495652_0036265 | 3300046529 | Bacteria | 4289 |
| 530 | Ga0495652_0039756 | 3300046529 | Bacteria | 4066 |
| 531 | Ga0495652_0060564 | 3300046529 | Bacteria | 3198 |
| 532 | Ga0495652_0071084 | 3300046529 | Bacteria | 2906 |
| 533 | Ga0495652_0195392 | 3300046529 | Bacteria | 1540 |
| 534 | Ga0495652_0204783 | 3300046529 | Bacteria | 1494 |
| 535 | Ga0495665_0005365 | 3300046531 | Bacteria | 6907 |
| 536 | Ga0495665_0005528 | 3300046531 | Bacteria | 6807 |
| 537 | Ga0495665_0045817 | 3300046531 | Bacteria | 2323 |
| 538 | Ga0495640_0006891 | 3300046533 | Bacteria | 8950 |
| 539 | Ga0495640_0032871 | 3300046533 | Bacteria | 3691 |
| 540 | Ga0495640_0036510 | 3300046533 | Bacteria | 3471 |
| 541 | Ga0495640_0049003 | 3300046533 | Bacteria | 2915 |
| 542 | Ga0495640_0066427 | 3300046533 | Bacteria | 2432 |
| 543 | Ga0495586_0010763 | 3300046535 | Bacteria | 4863 |
| 544 | Ga0495586_0028163 | 3300046535 | Bacteria | 3007 |
| 545 | Ga0495586_0076951 | 3300046535 | Bacteria | 1829 |
| 546 | Ga0495587_0000045 | 3300046536 | Bacteria | 108362 |
| 547 | Ga0495587_0008083 | 3300046536 | Bacteria | 6783 |
| 548 | Ga0495587_0008932 | 3300046536 | Bacteria | 6432 |
| 549 | Ga0495587_0016389 | 3300046536 | Bacteria | 4610 |
| 550 | Ga0495587_0021977 | 3300046536 | Bacteria | 3932 |
| 551 | Ga0495587_0029180 | 3300046536 | Bacteria | 3350 |
| 552 | Ga0495645_0027909 | 3300046543 | Bacteria | 4101 |
| 553 | Ga0495645_0072391 | 3300046543 | Bacteria | 2483 |
| 554 | Ga0495645_0082093 | 3300046543 | Bacteria | 2312 |
| 555 | Ga0495645_0154282 | 3300046543 | Bacteria | 1592 |
| 556 | Ga0495645_0198259 | 3300046543 | Bacteria | 1363 |
| 557 | Ga0495645_0206632 | 3300046543 | Bacteria | 1328 |
| 558 | Ga0495667_0000051 | 3300046559 | Bacteria | 109277 |
| 559 | Ga0495667_0000582 | 3300046559 | Bacteria | 23327 |
| 560 | Ga0495667_0026112 | 3300046559 | Bacteria | 3934 |
| 561 | Ga0495667_0030093 | 3300046559 | Bacteria | 3650 |
| 562 | Ga0495667_0036695 | 3300046559 | Bacteria | 3269 |
| 563 | Ga0495667_0044919 | 3300046559 | Bacteria | 2925 |
| 564 | Ga0495667_0209516 | 3300046559 | Bacteria | 1246 |
| 565 | Ga0495634_0011770 | 3300046642 | Bacteria | 6361 |
| 566 | Ga0495634_0024496 | 3300046642 | Bacteria | 4234 |
| 567 | Ga0495634_0029565 | 3300046642 | Bacteria | 3792 |
| 568 | Ga0495635_0008687 | 3300046663 | Bacteria | 7096 |
| 569 | Ga0495635_0020163 | 3300046663 | Bacteria | 4646 |
| 570 | Ga0495635_0054760 | 3300046663 | Bacteria | 2747 |
| 571 | Ga0495635_0146840 | 3300046663 | Bacteria | 1605 |
| 572 | Ga0495635_0364778 | 3300046663 | Bacteria | 962 |
| 573 | Ga0495657_0000044 | 3300046675 | Bacteria | 108383 |
| 574 | Ga0495657_0002604 | 3300046675 | Bacteria | 15088 |
| 575 | Ga0495657_0015482 | 3300046675 | Bacteria | 5580 |
| 576 | Ga0495657_0019907 | 3300046675 | Bacteria | 4834 |
| 577 | Ga0495657_0123039 | 3300046675 | Bacteria | 1632 |
| 578 | Ga0495599_0000127 | 3300046678 | Bacteria | 48710 |
| 579 | Ga0495599_0002458 | 3300046678 | Bacteria | 10799 |
| 580 | Ga0495599_0023220 | 3300046678 | Bacteria | 3875 |
| 581 | Ga0495599_0048662 | 3300046678 | Bacteria | 2657 |
| 582 | Ga0495599_0146518 | 3300046678 | Bacteria | 1463 |
| 583 | Ga0495623_0004402 | 3300046679 | Bacteria | 9255 |
| 584 | Ga0495623_0006558 | 3300046679 | Bacteria | 7578 |
| 585 | Ga0495623_0011331 | 3300046679 | Bacteria | 5768 |
| 586 | Ga0495623_0027825 | 3300046679 | Bacteria | 3639 |
| 587 | Ga0495623_0109564 | 3300046679 | Bacteria | 1675 |
| 588 | Ga0495646_0012163 | 3300046680 | Bacteria | 5472 |
| 589 | Ga0495646_0022004 | 3300046680 | Bacteria | 4024 |
| 590 | Ga0495646_0032318 | 3300046680 | Bacteria | 3256 |
| 591 | Ga0495647_0009779 | 3300046681 | Bacteria | 3256 |
| 592 | Ga0495658_0023317 | 3300046683 | Bacteria | 3284 |
| 593 | Ga0495658_0042525 | 3300046683 | Bacteria | 2537 |
| 594 | Ga0495613_0015792 | 3300046689 | Bacteria | 5620 |
| 595 | Ga0495613_0027087 | 3300046689 | Bacteria | 4265 |
| 596 | Ga0495613_0198978 | 3300046689 | Bacteria | 1413 |
| 597 | Ga0495624_0011079 | 3300046690 | Bacteria | 6206 |
| 598 | Ga0495624_0012215 | 3300046690 | Bacteria | 5880 |
| 599 | Ga0495624_0017955 | 3300046690 | Bacteria | 4740 |
| 600 | Ga0495624_0126074 | 3300046690 | Bacteria | 1571 |
| 601 | Ga0495600_0003470 | 3300046809 | Bacteria | 9277 |
| 602 | Ga0495600_0004056 | 3300046809 | Bacteria | 8707 |
| 603 | Ga0495600_0010281 | 3300046809 | Bacteria | 5803 |
| 604 | Ga0495600_0017757 | 3300046809 | Bacteria | 4528 |
| 605 | Ga0495600_0021267 | 3300046809 | Bacteria | 4152 |
| 606 | Ga0495600_0053116 | 3300046809 | Bacteria | 2646 |
| 607 | Ga0495600_0113704 | 3300046809 | Bacteria | 1762 |
| 608 | Ga0495581_0007508 | 3300047315 | Bacteria | 6305 |
| 609 | Ga0495581_0037248 | 3300047315 | Bacteria | 2814 |
| 610 | Ga0495581_0104077 | 3300047315 | Bacteria | 1649 |
| 611 | Ga0495604_0000046 | 3300047317 | Bacteria | 110553 |
| 612 | Ga0495604_0002826 | 3300047317 | Bacteria | 13937 |
| 613 | Ga0495604_0003684 | 3300047317 | Bacteria | 12216 |
| 614 | Ga0495604_0026106 | 3300047317 | Bacteria | 4650 |
| 615 | Ga0495604_0061083 | 3300047317 | Bacteria | 2883 |
| 616 | Ga0495604_0073132 | 3300047317 | Bacteria | 2588 |
| 617 | Ga0495604_0083187 | 3300047317 | Bacteria | 2392 |
| 618 | Ga0495674_0010747 | 3300047319 | Bacteria | 8658 |
| 619 | Ga0495674_0033338 | 3300047319 | Bacteria | 4666 |
| 620 | Ga0495674_0054936 | 3300047319 | Bacteria | 3494 |
| 621 | Ga0495672_0004454 | 3300047320 | Bacteria | 11454 |
| 622 | Ga0495676_0027520 | 3300047321 | Bacteria | 4872 |
| 623 | Ga0495676_0029398 | 3300047321 | Bacteria | 4679 |
| 624 | Ga0495676_0088314 | 3300047321 | Bacteria | 2325 |
| 625 | Ga0495676_0233356 | 3300047321 | Bacteria | 1263 |
| 626 | Ga0495680_0000945 | 3300047322 | Bacteria | 32299 |
| 627 | Ga0495680_0003754 | 3300047322 | Bacteria | 14788 |
| 628 | Ga0495680_0015977 | 3300047322 | Bacteria | 6459 |
| 629 | Ga0495680_0021235 | 3300047322 | Bacteria | 5438 |
| 630 | Ga0495680_0032786 | 3300047322 | Bacteria | 4212 |
| 631 | Ga0495680_0033036 | 3300047322 | Bacteria | 4193 |
| 632 | Ga0495680_0066575 | 3300047322 | Bacteria | 2756 |
| 633 | Ga0495675_0000499 | 3300047444 | Bacteria | 25470 |
| 634 | Ga0495675_0036092 | 3300047444 | Bacteria | 3155 |
| 635 | Ga0495675_0049337 | 3300047444 | Bacteria | 2676 |
| 636 | Ga0495675_0121489 | 3300047444 | Bacteria | 1626 |
| 637 | Ga0495684_0012002 | 3300047471 | Bacteria | 6681 |
| 638 | Ga0495684_0026204 | 3300047471 | Bacteria | 4479 |
| 639 | Ga0495684_0032291 | 3300047471 | Bacteria | 4018 |
| 640 | Ga0495684_0135878 | 3300047471 | Bacteria | 1845 |
| 641 | Ga0495684_0158051 | 3300047471 | Bacteria | 1692 |
| 642 | Ga0495686_0011517 | 3300047472 | Bacteria | 6230 |
| 643 | Ga0495593_0015172 | 3300047673 | Bacteria | 4372 |
| 644 | Ga0495593_0019542 | 3300047673 | Bacteria | 3798 |
| 645 | Ga0495593_0066165 | 3300047673 | Bacteria | 1883 |
| 646 | Ga0495602_0000665 | 3300048088 | Bacteria | 32273 |
| 647 | Ga0495602_0001500 | 3300048088 | Bacteria | 23247 |
| 648 | Ga0495602_0084491 | 3300048088 | Bacteria | 2655 |
| 649 | Ga0495602_0088740 | 3300048088 | Bacteria | 2573 |
| 650 | Ga0495602_0266378 | 3300048088 | Bacteria | 1268 |
| 651 | Ga0495614_0037856 | 3300048089 | Bacteria | 2070 |
| 652 | Ga0496101_0099527 | 3300048904 | Bacteria | 2173 |
| 653 | Ga0496101_0173821 | 3300048904 | Bacteria | 1656 |
| 654 | Ga0496102_0338477 | 3300048905 | Bacteria | 1417 |
| 655 | Ga0496103_0021733 | 3300048906 | Bacteria | 3861 |
| 656 | Ga0496104_0002603 | 3300048907 | Bacteria | 15549 |
| 657 | Ga0496104_0015791 | 3300048907 | Bacteria | 6849 |
| 658 | Ga0496104_0084730 | 3300048907 | Bacteria | 3024 |
| 659 | Ga0496105_0015581 | 3300048908 | Bacteria | 6062 |
| 660 | Ga0496105_0032722 | 3300048908 | Bacteria | 4268 |
| 661 | Ga0496105_0116334 | 3300048908 | Bacteria | 2206 |
| 662 | Ga0496106_0165819 | 3300048909 | Bacteria | 1749 |
| 663 | Ga0496108_0003847 | 3300048911 | Bacteria | 12046 |
| 664 | Ga0496108_0005347 | 3300048911 | Bacteria | 10381 |
| 665 | Ga0496108_0129577 | 3300048911 | Bacteria | 2168 |
| 666 | Ga0496108_0202100 | 3300048911 | Bacteria | 1724 |
| 667 | Ga0496109_0019488 | 3300048912 | Bacteria | 5986 |
| 668 | Ga0496109_0053525 | 3300048912 | Bacteria | 3681 |
| 669 | Ga0496110_0008423 | 3300048913 | Bacteria | 8297 |
| 670 | Ga0496110_0030734 | 3300048913 | Bacteria | 4631 |
| 671 | Ga0496111_0003445 | 3300048914 | Bacteria | 9784 |
| 672 | Ga0496112_0000614 | 3300048915 | Bacteria | 24602 |
| 673 | Ga0496112_0077090 | 3300048915 | Bacteria | 3296 |
| 674 | Ga0496112_0373541 | 3300048915 | Bacteria | 1367 |
| 675 | Ga0496113_0016263 | 3300048916 | Bacteria | 5135 |
| 676 | Ga0496113_0221947 | 3300048916 | Bacteria | 1506 |
| 677 | Ga0496114_0010063 | 3300048917 | Bacteria | 7520 |
| 678 | Ga0496114_0155286 | 3300048917 | Bacteria | 1987 |
| 679 | Ga0496115_0114397 | 3300048918 | Bacteria | 2217 |
| 680 | Ga0496126_0077381 | 3300048929 | Bacteria | 2949 |
| 681 | Ga0496126_0085900 | 3300048929 | Bacteria | 2773 |
| 682 | Ga0501040_0090992 | 3300049576 | Bacteria | 2121 |
| 683 | nmdc:mga05p37_14396_c1 | 3300050507 | Bacteria | 9497 |
| 684 | nmdc:mga05p37_654885_c1 | 3300050507 | Bacteria | 1175 |
| 685 | nmdc:mga08y16_362405_c1 | 3300050511 | Bacteria | 1488 |
| 686 | nmdc:mga0n895_135214_c1 | 3300050512 | Bacteria | 2492 |
| 687 | nmdc:mga0n895_177728_c1 | 3300050512 | Bacteria | 2160 |
| 688 | nmdc:mga0rr50_63990_c1 | 3300050513 | Bacteria | 2780 |
| 689 | nmdc:mga0rr50_68983_c1 | 3300050513 | Bacteria | 2689 |
| 690 | nmdc:mga0a205_251378_c1 | 3300050515 | Bacteria | 1647 |
| 691 | Ga0495601_0015740 | 3300053077 | Bacteria | 4575 |
| 692 | Ga0495601_0090400 | 3300053077 | Bacteria | 1969 |
| 693 | Ga0495612_0004463 | 3300053078 | Bacteria | 5807 |
| 694 | Ga0495595_0000195 | 3300053084 | Bacteria | 24720 |
| 695 | Ga0495595_0007726 | 3300053084 | Bacteria | 4405 |
| 696 | Ga0495595_0020438 | 3300053084 | Bacteria | 2882 |
| 697 | Ga0495595_0045598 | 3300053084 | Bacteria | 2017 |
| 698 | Ga0495619_0024309 | 3300053085 | Bacteria | 3885 |
| 699 | Ga0495619_0026025 | 3300053085 | Bacteria | 3762 |
| 700 | Ga0495619_0085308 | 3300053085 | Bacteria | 2132 |
| 701 | Ga0495619_0114575 | 3300053085 | Bacteria | 1845 |
| 702 | Ga0495619_0184119 | 3300053085 | Bacteria | 1445 |
| 703 | Ga0500651_0000161 | 3300053093 | Bacteria | 43186 |
| 704 | Ga0500641_0071322 | 3300053096 | Bacteria | 1462 |
| 705 | Ga0500556_0000007 | 3300053104 | Bacteria | 331400 |
| 706 | Ga0500559_0004968 | 3300053136 | Bacteria | 6182 |
| 707 | Ga0500559_0056402 | 3300053136 | Bacteria | 1743 |
| 708 | Ga0500568_0000021 | 3300053139 | Bacteria | 185406 |
| 709 | Ga0500573_0109538 | 3300053140 | Bacteria | 1546 |
| 710 | Ga0500577_0066615 | 3300053142 | Bacteria | 1401 |
| 711 | Ga0500620_000119 | 3300053155 | Bacteria | 15657 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046472 | Ga0495580_0491011 | Ga0495580_0491011_31_774 | 201 |
| 2 | 3300039438 | Ga0436360_0730294 | Ga0436360_0730294_12_779 | 209 |
| 3 | 3300031730 | Ga0307516_10162015 | Ga0307516_101620153 | 223 |
| 4 | 3300041512 | Ga0451853_2794855 | Ga0451853_2794855_690_1511 | 223 |
| 5 | 3300044694 | Ga0466963_0514740 | Ga0466963_0514740_12_824 | 224 |
| 6 | 3300045976 | Ga0466967_0070331 | Ga0466967_0070331_2204_3031 | 224 |
| 7 | 3300048915 | Ga0496112_0373541 | Ga0496112_0373541_13_828 | 225 |
| 8 | iso_pu_bacteria | 2902799365 | 2902801942 | 234 |
| 9 | 3300013105 | Ga0157369_10037673 | Ga0157369_100376734 | 235 |
| 10 | 3300014325 | Ga0163163_10441676 | Ga0163163_104416762 | 235 |
| 11 | 3300021388 | Ga0213875_10001237 | Ga0213875_100012372 | 235 |
| 12 | 3300025937 | Ga0207669_10057412 | Ga0207669_100574122 | 236 |
| 13 | iso_pu_bacteria | 2939582691 | 2939584137 | 236 |
| 14 | 3300032005 | Ga0307411_10350715 | Ga0307411_103507152 | 237 |
| 15 | 3300047320 | Ga0495672_0004454 | Ga0495672_0004454_5723_6541 | 237 |
| 16 | 3300048917 | Ga0496114_0155286 | Ga0496114_0155286_813_1703 | 237 |
| 17 | iso_pu_bacteria | 2873314349 | 2873321671 | 237 |
| 18 | 3300035086 | Ga0373934_0023058 | Ga0373934_0023058_1517_2389 | 239 |
| 19 | 3300035111 | Ga0373923_0014709 | Ga0373923_0014709_617_1489 | 239 |
| 20 | 3300035118 | Ga0373954_0030493 | Ga0373954_0030493_1596_2468 | 239 |
| 21 | 3300037853 | Ga0436364_0123513 | Ga0436364_0123513_241_1113 | 239 |
| 22 | 3300046679 | Ga0495623_0109564 | Ga0495623_0109564_84_956 | 239 |
| 23 | iso_pu_bacteria | 8056060235 | 8056061732 | 239 |
| 24 | 3300005435 | Ga0070714_100070347 | Ga0070714_1000703472 | 240 |
| 25 | 3300005436 | Ga0070713_100146278 | Ga0070713_1001462783 | 240 |
| 26 | 3300005467 | Ga0070706_100078402 | Ga0070706_1000784023 | 240 |
| 27 | 3300005468 | Ga0070707_100005202 | Ga0070707_1000052024 | 240 |
| 28 | 3300005471 | Ga0070698_100280982 | Ga0070698_1002809822 | 240 |
| 29 | 3300025910 | Ga0207684_10051337 | Ga0207684_100513373 | 240 |
| 30 | 3300035119 | Ga0373956_0001566 | Ga0373956_0001566_5774_6697 | 240 |
| 31 | 3300005337 | Ga0070682_100091405 | Ga0070682_1000914052 | 241 |
| 32 | 3300005437 | Ga0070710_10026567 | Ga0070710_100265673 | 241 |
| 33 | 3300005471 | Ga0070698_100000723 | Ga0070698_10000072313 | 241 |
| 34 | 3300006163 | Ga0070715_10025036 | Ga0070715_100250362 | 241 |
| 35 | 3300006173 | Ga0070716_100046503 | Ga0070716_1000465032 | 241 |
| 36 | 3300009176 | Ga0105242_10411908 | Ga0105242_104119082 | 241 |
| 37 | 3300025905 | Ga0207685_10012548 | Ga0207685_100125483 | 241 |
| 38 | 3300025906 | Ga0207699_10019626 | Ga0207699_100196264 | 241 |
| 39 | 3300025928 | Ga0207700_10082623 | Ga0207700_100826232 | 241 |
| 40 | 3300025929 | Ga0207664_10123767 | Ga0207664_101237672 | 241 |
| 41 | 3300025939 | Ga0207665_10075627 | Ga0207665_100756272 | 241 |
| 42 | 3300035113 | Ga0373936_0038331 | Ga0373936_0038331_299_1177 | 241 |
| 43 | 3300035116 | Ga0373945_0037758 | Ga0373945_0037758_195_1073 | 241 |
| 44 | 3300035117 | Ga0373953_0014187 | Ga0373953_0014187_1568_2446 | 241 |
| 45 | 3300035172 | Ga0373955_0009353 | Ga0373955_0009353_460_1338 | 241 |
| 46 | 3300035410 | Ga0373924_0018922 | Ga0373924_0018922_258_1136 | 241 |
| 47 | 3300035692 | Ga0373935_0019782 | Ga0373935_0019782_1659_2537 | 241 |
| 48 | 3300035724 | Ga0373933_0036089 | Ga0373933_0036089_1847_2725 | 241 |
| 49 | 3300036401 | Ga0373937_0230427 | Ga0373937_0230427_489_1367 | 241 |
| 50 | 3300037068 | Ga0373925_0103440 | Ga0373925_0103440_1034_1912 | 241 |
| 51 | 3300039450 | Ga0436363_0686281 | Ga0436363_0686281_94_972 | 241 |
| 52 | 3300044684 | Ga0466966_0012618 | Ga0466966_0012618_3400_4266 | 241 |
| 53 | 3300044693 | Ga0466961_0053362 | Ga0466961_0053362_157_1023 | 241 |
| 54 | 3300045049 | Ga0466959_0109711 | Ga0466959_0109711_78_944 | 241 |
| 55 | 3300046454 | Ga0495592_0026450 | Ga0495592_0026450_3020_3898 | 241 |
| 56 | 3300046463 | Ga0495653_0025994 | Ga0495653_0025994_2426_3304 | 241 |
| 57 | 3300046477 | Ga0495664_0003380 | Ga0495664_0003380_2765_3643 | 241 |
| 58 | 3300046511 | Ga0495608_0011647 | Ga0495608_0011647_3528_4406 | 241 |
| 59 | 3300046514 | Ga0495618_0020398 | Ga0495618_0020398_1693_2571 | 241 |
| 60 | 3300046516 | Ga0495628_0077236 | Ga0495628_0077236_299_1177 | 241 |
| 61 | 3300046529 | Ga0495652_0006632 | Ga0495652_0006632_6156_7034 | 241 |
| 62 | 3300046533 | Ga0495640_0036510 | Ga0495640_0036510_1056_1934 | 241 |
| 63 | 3300046535 | Ga0495586_0028163 | Ga0495586_0028163_768_1646 | 241 |
| 64 | 3300046536 | Ga0495587_0008932 | Ga0495587_0008932_670_1548 | 241 |
| 65 | 3300046543 | Ga0495645_0072391 | Ga0495645_0072391_344_1222 | 241 |
| 66 | 3300046642 | Ga0495634_0011770 | Ga0495634_0011770_3535_4413 | 241 |
| 67 | 3300046678 | Ga0495599_0023220 | Ga0495599_0023220_501_1379 | 241 |
| 68 | 3300046680 | Ga0495646_0032318 | Ga0495646_0032318_1810_2688 | 241 |
| 69 | 3300046690 | Ga0495624_0126074 | Ga0495624_0126074_392_1270 | 241 |
| 70 | 3300046809 | Ga0495600_0017757 | Ga0495600_0017757_2271_3149 | 241 |
| 71 | 3300047317 | Ga0495604_0073132 | Ga0495604_0073132_774_1652 | 241 |
| 72 | 3300047321 | Ga0495676_0233356 | Ga0495676_0233356_208_1086 | 241 |
| 73 | 3300047322 | Ga0495680_0021235 | Ga0495680_0021235_564_1442 | 241 |
| 74 | 3300047471 | Ga0495684_0012002 | Ga0495684_0012002_1093_1971 | 241 |
| 75 | 3300053078 | Ga0495612_0004463 | Ga0495612_0004463_42_920 | 241 |
| 76 | 3300053084 | Ga0495595_0007726 | Ga0495595_0007726_1682_2560 | 241 |
| 77 | iso_pu_bacteria | 2643221961 | 2645720388 | 241 |
| 78 | iso_pu_bacteria | 2643221962 | 2645723329 | 241 |
| 79 | iso_pu_bacteria | 2675903060 | 2676494796 | 241 |
| 80 | iso_pu_bacteria | 2856741275 | 2856743442 | 241 |
| 81 | iso_pu_bacteria | 2884693830 | 2884695592 | 241 |
| 82 | iso_pu_bacteria | 2891395885 | 2891404505 | 241 |
| 83 | iso_pu_bacteria | 2891554331 | 2891561831 | 241 |
| 84 | iso_pu_bacteria | 2891562705 | 2891565750 | 241 |
| 85 | iso_pu_bacteria | 2895427314 | 2895438669 | 241 |
| 86 | iso_pu_bacteria | 2895442618 | 2895445701 | 241 |
| 87 | iso_pu_bacteria | 8055066027 | 8055072677 | 241 |
| 88 | iso_pu_bacteria | 8055172936 | 8055178008 | 241 |
| 89 | 3300005434 | Ga0070709_10011999 | Ga0070709_100119993 | 242 |
| 90 | 3300005439 | Ga0070711_100086715 | Ga0070711_1000867152 | 242 |
| 91 | 3300005456 | Ga0070678_100284186 | Ga0070678_1002841862 | 242 |
| 92 | 3300005614 | Ga0068856_100061196 | Ga0068856_1000611963 | 242 |
| 93 | 3300006028 | Ga0070717_10106768 | Ga0070717_101067682 | 242 |
| 94 | 3300006163 | Ga0070715_10005611 | Ga0070715_100056114 | 242 |
| 95 | 3300006173 | Ga0070716_100214954 | Ga0070716_1002149542 | 242 |
| 96 | 3300006175 | Ga0070712_100042878 | Ga0070712_1000428782 | 242 |
| 97 | 3300025906 | Ga0207699_10006820 | Ga0207699_100068204 | 242 |
| 98 | 3300025915 | Ga0207693_10003679 | Ga0207693_100036792 | 242 |
| 99 | 3300025916 | Ga0207663_10249605 | Ga0207663_102496052 | 242 |
| 100 | 3300025928 | Ga0207700_10008932 | Ga0207700_100089322 | 242 |
| 101 | 3300025929 | Ga0207664_10015657 | Ga0207664_100156574 | 242 |
| 102 | 3300025939 | Ga0207665_10001112 | Ga0207665_100011122 | 242 |
| 103 | 3300026075 | Ga0207708_10339513 | Ga0207708_103395131 | 242 |
| 104 | 3300028379 | Ga0268266_10801224 | Ga0268266_108012241 | 242 |
| 105 | 3300048904 | Ga0496101_0173821 | Ga0496101_0173821_461_1333 | 242 |
| 106 | 3300048907 | Ga0496104_0002603 | Ga0496104_0002603_5232_6104 | 242 |
| 107 | 3300048911 | Ga0496108_0003847 | Ga0496108_0003847_2183_3055 | 242 |
| 108 | 3300048915 | Ga0496112_0000614 | Ga0496112_0000614_12087_12959 | 242 |
| 109 | 3300048916 | Ga0496113_0016263 | Ga0496113_0016263_2686_3558 | 242 |
| 110 | iso_pu_bacteria | 2837268691 | 2837272330 | 242 |
| 111 | 3300005329 | Ga0070683_100024421 | Ga0070683_1000244214 | 243 |
| 112 | 3300005329 | Ga0070683_100242718 | Ga0070683_1002427181 | 243 |
| 113 | 3300005339 | Ga0070660_100088562 | Ga0070660_1000885622 | 243 |
| 114 | 3300005345 | Ga0070692_10077983 | Ga0070692_100779832 | 243 |
| 115 | 3300005434 | Ga0070709_10038718 | Ga0070709_100387184 | 243 |
| 116 | 3300005434 | Ga0070709_10350455 | Ga0070709_103504551 | 243 |
| 117 | 3300005435 | Ga0070714_100008688 | Ga0070714_1000086888 | 243 |
| 118 | 3300005435 | Ga0070714_100074060 | Ga0070714_1000740602 | 243 |
| 119 | 3300005435 | Ga0070714_100162994 | Ga0070714_1001629942 | 243 |
| 120 | 3300005435 | Ga0070714_100177425 | Ga0070714_1001774252 | 243 |
| 121 | 3300005435 | Ga0070714_100325441 | Ga0070714_1003254412 | 243 |
| 122 | 3300005435 | Ga0070714_100506711 | Ga0070714_1005067112 | 243 |
| 123 | 3300005435 | Ga0070714_100643380 | Ga0070714_1006433801 | 243 |
| 124 | 3300005436 | Ga0070713_100143456 | Ga0070713_1001434562 | 243 |
| 125 | 3300005436 | Ga0070713_100502143 | Ga0070713_1005021431 | 243 |
| 126 | 3300005458 | Ga0070681_10107771 | Ga0070681_101077712 | 243 |
| 127 | 3300005471 | Ga0070698_100000957 | Ga0070698_1000009579 | 243 |
| 128 | 3300005535 | Ga0070684_100220276 | Ga0070684_1002202762 | 243 |
| 129 | 3300005536 | Ga0070697_100131407 | Ga0070697_1001314071 | 243 |
| 130 | 3300005614 | Ga0068856_100043631 | Ga0068856_1000436314 | 243 |
| 131 | 3300005843 | Ga0068860_100110471 | Ga0068860_1001104712 | 243 |
| 132 | 3300006028 | Ga0070717_10222771 | Ga0070717_102227712 | 243 |
| 133 | 3300006028 | Ga0070717_10544602 | Ga0070717_105446022 | 243 |
| 134 | 3300006173 | Ga0070716_100132338 | Ga0070716_1001323382 | 243 |
| 135 | 3300006237 | Ga0097621_100007903 | Ga0097621_1000079033 | 243 |
| 136 | 3300006847 | Ga0075431_100404941 | Ga0075431_1004049412 | 243 |
| 137 | 3300006880 | Ga0075429_100043208 | Ga0075429_1000432082 | 243 |
| 138 | 3300007076 | Ga0075435_100207018 | Ga0075435_1002070182 | 243 |
| 139 | 3300009093 | Ga0105240_10195121 | Ga0105240_101951212 | 243 |
| 140 | 3300009101 | Ga0105247_10009095 | Ga0105247_100090952 | 243 |
| 141 | 3300009147 | Ga0114129_10156011 | Ga0114129_101560114 | 243 |
| 142 | 3300009174 | Ga0105241_10115484 | Ga0105241_101154842 | 243 |
| 143 | 3300009545 | Ga0105237_10492355 | Ga0105237_104923552 | 243 |
| 144 | 3300011119 | Ga0105246_10039028 | Ga0105246_100390282 | 243 |
| 145 | 3300013104 | Ga0157370_10098808 | Ga0157370_100988083 | 243 |
| 146 | 3300013104 | Ga0157370_10270515 | Ga0157370_102705152 | 243 |
| 147 | 3300013105 | Ga0157369_10170008 | Ga0157369_101700082 | 243 |
| 148 | 3300013296 | Ga0157374_10017896 | Ga0157374_100178964 | 243 |
| 149 | 3300013306 | Ga0163162_10158023 | Ga0163162_101580233 | 243 |
| 150 | 3300013308 | Ga0157375_10029877 | Ga0157375_100298774 | 243 |
| 151 | 3300014325 | Ga0163163_10105634 | Ga0163163_101056343 | 243 |
| 152 | 3300014968 | Ga0157379_10004934 | Ga0157379_100049346 | 243 |
| 153 | 3300014969 | Ga0157376_10002413 | Ga0157376_100024137 | 243 |
| 154 | 3300020082 | Ga0206353_10985336 | Ga0206353_109853362 | 243 |
| 155 | 3300021388 | Ga0213875_10000956 | Ga0213875_1000095620 | 243 |
| 156 | 3300022467 | Ga0224712_10019898 | Ga0224712_100198983 | 243 |
| 157 | 3300025900 | Ga0207710_10065844 | Ga0207710_100658442 | 243 |
| 158 | 3300025906 | Ga0207699_10011658 | Ga0207699_100116584 | 243 |
| 159 | 3300025910 | Ga0207684_10023313 | Ga0207684_100233134 | 243 |
| 160 | 3300025912 | Ga0207707_10045221 | Ga0207707_100452214 | 243 |
| 161 | 3300025912 | Ga0207707_10109248 | Ga0207707_101092482 | 243 |
| 162 | 3300025915 | Ga0207693_10052608 | Ga0207693_100526084 | 243 |
| 163 | 3300025917 | Ga0207660_10031722 | Ga0207660_100317222 | 243 |
| 164 | 3300025919 | Ga0207657_10031634 | Ga0207657_100316344 | 243 |
| 165 | 3300025921 | Ga0207652_10009647 | Ga0207652_100096477 | 243 |
| 166 | 3300025921 | Ga0207652_10148156 | Ga0207652_101481562 | 243 |
| 167 | 3300025927 | Ga0207687_10027601 | Ga0207687_100276013 | 243 |
| 168 | 3300025928 | Ga0207700_10027203 | Ga0207700_100272033 | 243 |
| 169 | 3300025928 | Ga0207700_10228877 | Ga0207700_102288772 | 243 |
| 170 | 3300025929 | Ga0207664_10002438 | Ga0207664_1000243812 | 243 |
| 171 | 3300025929 | Ga0207664_10019650 | Ga0207664_100196504 | 243 |
| 172 | 3300025929 | Ga0207664_10065794 | Ga0207664_100657943 | 243 |
| 173 | 3300025929 | Ga0207664_10163236 | Ga0207664_101632362 | 243 |
| 174 | 3300025941 | Ga0207711_10048902 | Ga0207711_100489022 | 243 |
| 175 | 3300025944 | Ga0207661_10037177 | Ga0207661_100371774 | 243 |
| 176 | 3300025944 | Ga0207661_10181656 | Ga0207661_101816562 | 243 |
| 177 | 3300025945 | Ga0207679_10173374 | Ga0207679_101733742 | 243 |
| 178 | 3300026067 | Ga0207678_10050513 | Ga0207678_100505132 | 243 |
| 179 | 3300026078 | Ga0207702_10046299 | Ga0207702_100462993 | 243 |
| 180 | 3300026088 | Ga0207641_10050492 | Ga0207641_100504922 | 243 |
| 181 | 3300026095 | Ga0207676_10011596 | Ga0207676_100115969 | 243 |
| 182 | 3300028556 | Ga0265337_1000159 | Ga0265337_100015915 | 243 |
| 183 | 3300028558 | Ga0265326_10000487 | Ga0265326_100004877 | 243 |
| 184 | 3300028563 | Ga0265319_1006829 | Ga0265319_10068294 | 243 |
| 185 | 3300028573 | Ga0265334_10000745 | Ga0265334_100007459 | 243 |
| 186 | 3300028577 | Ga0265318_10020736 | Ga0265318_100207362 | 243 |
| 187 | 3300028653 | Ga0265323_10007256 | Ga0265323_100072566 | 243 |
| 188 | 3300028654 | Ga0265322_10003714 | Ga0265322_100037143 | 243 |
| 189 | 3300028666 | Ga0265336_10005196 | Ga0265336_100051962 | 243 |
| 190 | 3300028800 | Ga0265338_10000246 | Ga0265338_1000024655 | 243 |
| 191 | 3300028800 | Ga0265338_10006190 | Ga0265338_100061904 | 243 |
| 192 | 3300028800 | Ga0265338_10007955 | Ga0265338_1000795512 | 243 |
| 193 | 3300031238 | Ga0265332_10001531 | Ga0265332_100015312 | 243 |
| 194 | 3300031240 | Ga0265320_10002564 | Ga0265320_100025649 | 243 |
| 195 | 3300031247 | Ga0265340_10002368 | Ga0265340_100023682 | 243 |
| 196 | 3300031344 | Ga0265316_10041857 | Ga0265316_100418572 | 243 |
| 197 | 3300031595 | Ga0265313_10016183 | Ga0265313_100161834 | 243 |
| 198 | 3300031711 | Ga0265314_10008867 | Ga0265314_100088679 | 243 |
| 199 | 3300031712 | Ga0265342_10030403 | Ga0265342_100304033 | 243 |
| 200 | 3300035111 | Ga0373923_0049710 | Ga0373923_0049710_13_876 | 243 |
| 201 | 3300035725 | Ga0373947_0047457 | Ga0373947_0047457_803_1666 | 243 |
| 202 | 3300036401 | Ga0373937_0269045 | Ga0373937_0269045_393_1277 | 243 |
| 203 | 3300037418 | Ga0395900_0456786 | Ga0395900_0456786_160_1044 | 243 |
| 204 | 3300037466 | Ga0395898_0256882 | Ga0395898_0256882_203_1087 | 243 |
| 205 | 3300037853 | Ga0436364_0584067 | Ga0436364_0584067_69181_70092 | 243 |
| 206 | 3300039450 | Ga0436363_1174479 | Ga0436363_1174479_147_1019 | 243 |
| 207 | 3300044656 | Ga0466969_0136010 | Ga0466969_0136010_254_1123 | 243 |
| 208 | 3300044694 | Ga0466963_0026301 | Ga0466963_0026301_1710_2594 | 243 |
| 209 | 3300046454 | Ga0495592_0022578 | Ga0495592_0022578_2310_3173 | 243 |
| 210 | 3300046455 | Ga0495603_0177565 | Ga0495603_0177565_315_1178 | 243 |
| 211 | 3300046462 | Ga0495651_0001369 | Ga0495651_0001369_8242_9105 | 243 |
| 212 | 3300046476 | Ga0495662_0067218 | Ga0495662_0067218_145_1008 | 243 |
| 213 | 3300046477 | Ga0495664_0091433 | Ga0495664_0091433_954_1817 | 243 |
| 214 | 3300046499 | Ga0495594_0215063 | Ga0495594_0215063_186_1049 | 243 |
| 215 | 3300046511 | Ga0495608_0032494 | Ga0495608_0032494_1516_2379 | 243 |
| 216 | 3300046517 | Ga0495630_0078629 | Ga0495630_0078629_1396_2259 | 243 |
| 217 | 3300046529 | Ga0495652_0025949 | Ga0495652_0025949_3119_3982 | 243 |
| 218 | 3300046533 | Ga0495640_0066427 | Ga0495640_0066427_83_946 | 243 |
| 219 | 3300046536 | Ga0495587_0008083 | Ga0495587_0008083_747_1610 | 243 |
| 220 | 3300046663 | Ga0495635_0054760 | Ga0495635_0054760_1802_2665 | 243 |
| 221 | 3300046675 | Ga0495657_0019907 | Ga0495657_0019907_2142_3005 | 243 |
| 222 | 3300046678 | Ga0495599_0002458 | Ga0495599_0002458_1702_2565 | 243 |
| 223 | 3300046683 | Ga0495658_0042525 | Ga0495658_0042525_1530_2393 | 243 |
| 224 | 3300046689 | Ga0495613_0198978 | Ga0495613_0198978_538_1401 | 243 |
| 225 | 3300046809 | Ga0495600_0113704 | Ga0495600_0113704_849_1712 | 243 |
| 226 | 3300047315 | Ga0495581_0104077 | Ga0495581_0104077_25_888 | 243 |
| 227 | 3300047317 | Ga0495604_0083187 | Ga0495604_0083187_1447_2310 | 243 |
| 228 | 3300047319 | Ga0495674_0054936 | Ga0495674_0054936_2341_3204 | 243 |
| 229 | 3300047322 | Ga0495680_0066575 | Ga0495680_0066575_1811_2674 | 243 |
| 230 | 3300047444 | Ga0495675_0121489 | Ga0495675_0121489_751_1614 | 243 |
| 231 | 3300047471 | Ga0495684_0032291 | Ga0495684_0032291_1647_2510 | 243 |
| 232 | 3300048905 | Ga0496102_0338477 | Ga0496102_0338477_381_1244 | 243 |
| 233 | 3300048907 | Ga0496104_0015791 | Ga0496104_0015791_2733_3596 | 243 |
| 234 | 3300048908 | Ga0496105_0015581 | Ga0496105_0015581_2468_3331 | 243 |
| 235 | 3300048911 | Ga0496108_0005347 | Ga0496108_0005347_6672_7535 | 243 |
| 236 | 3300048912 | Ga0496109_0019488 | Ga0496109_0019488_3718_4581 | 243 |
| 237 | 3300048913 | Ga0496110_0030734 | Ga0496110_0030734_2220_3083 | 243 |
| 238 | 3300048914 | Ga0496111_0003445 | Ga0496111_0003445_7814_8677 | 243 |
| 239 | 3300048916 | Ga0496113_0221947 | Ga0496113_0221947_480_1343 | 243 |
| 240 | 3300048929 | Ga0496126_0077381 | Ga0496126_0077381_121_1005 | 243 |
| 241 | 3300048929 | Ga0496126_0085900 | Ga0496126_0085900_901_1782 | 243 |
| 242 | 3300049576 | Ga0501040_0090992 | Ga0501040_0090992_677_1531 | 243 |
| 243 | 3300050507 | nmdc:mga05p37_654885_c1 | nmdc:mga05p37_654885_c1_32_898 | 243 |
| 244 | 3300050513 | nmdc:mga0rr50_68983_c1 | nmdc:mga0rr50_68983_c1_567_1430 | 243 |
| 245 | 3300053077 | Ga0495601_0090400 | Ga0495601_0090400_1087_1950 | 243 |
| 246 | 3300053085 | Ga0495619_0085308 | Ga0495619_0085308_1235_2098 | 243 |
| 247 | 3300053096 | Ga0500641_0071322 | Ga0500641_0071322_597_1448 | 243 |
| 248 | 3300005327 | Ga0070658_10099642 | Ga0070658_100996423 | 244 |
| 249 | 3300005328 | Ga0070676_10083182 | Ga0070676_100831822 | 244 |
| 250 | 3300005331 | Ga0070670_100292811 | Ga0070670_1002928112 | 244 |
| 251 | 3300005334 | Ga0068869_100027085 | Ga0068869_1000270854 | 244 |
| 252 | 3300005335 | Ga0070666_10031474 | Ga0070666_100314742 | 244 |
| 253 | 3300005336 | Ga0070680_100090788 | Ga0070680_1000907882 | 244 |
| 254 | 3300005340 | Ga0070689_100025233 | Ga0070689_1000252334 | 244 |
| 255 | 3300005345 | Ga0070692_10055486 | Ga0070692_100554863 | 244 |
| 256 | 3300005353 | Ga0070669_100259968 | Ga0070669_1002599682 | 244 |
| 257 | 3300005354 | Ga0070675_100017217 | Ga0070675_1000172174 | 244 |
| 258 | 3300005364 | Ga0070673_100068458 | Ga0070673_1000684582 | 244 |
| 259 | 3300005365 | Ga0070688_100085208 | Ga0070688_1000852082 | 244 |
| 260 | 3300005366 | Ga0070659_100012169 | Ga0070659_1000121693 | 244 |
| 261 | 3300005367 | Ga0070667_100027789 | Ga0070667_1000277892 | 244 |
| 262 | 3300005434 | Ga0070709_10002704 | Ga0070709_100027042 | 244 |
| 263 | 3300005434 | Ga0070709_10006521 | Ga0070709_100065214 | 244 |
| 264 | 3300005435 | Ga0070714_100002366 | Ga0070714_1000023664 | 244 |
| 265 | 3300005435 | Ga0070714_100211609 | Ga0070714_1002116092 | 244 |
| 266 | 3300005435 | Ga0070714_100545505 | Ga0070714_1005455051 | 244 |
| 267 | 3300005436 | Ga0070713_100089884 | Ga0070713_1000898842 | 244 |
| 268 | 3300005436 | Ga0070713_100155586 | Ga0070713_1001555863 | 244 |
| 269 | 3300005436 | Ga0070713_100332685 | Ga0070713_1003326852 | 244 |
| 270 | 3300005437 | Ga0070710_10004727 | Ga0070710_100047273 | 244 |
| 271 | 3300005437 | Ga0070710_10010496 | Ga0070710_100104964 | 244 |
| 272 | 3300005437 | Ga0070710_10051207 | Ga0070710_100512072 | 244 |
| 273 | 3300005439 | Ga0070711_100024014 | Ga0070711_1000240143 | 244 |
| 274 | 3300005439 | Ga0070711_100024412 | Ga0070711_1000244123 | 244 |
| 275 | 3300005439 | Ga0070711_100033050 | Ga0070711_1000330502 | 244 |
| 276 | 3300005439 | Ga0070711_100226688 | Ga0070711_1002266882 | 244 |
| 277 | 3300005440 | Ga0070705_100106334 | Ga0070705_1001063342 | 244 |
| 278 | 3300005441 | Ga0070700_100028218 | Ga0070700_1000282183 | 244 |
| 279 | 3300005444 | Ga0070694_100212168 | Ga0070694_1002121682 | 244 |
| 280 | 3300005445 | Ga0070708_100002852 | Ga0070708_1000028522 | 244 |
| 281 | 3300005445 | Ga0070708_100006587 | Ga0070708_1000065874 | 244 |
| 282 | 3300005445 | Ga0070708_100392092 | Ga0070708_1003920921 | 244 |
| 283 | 3300005455 | Ga0070663_100008724 | Ga0070663_1000087245 | 244 |
| 284 | 3300005458 | Ga0070681_10043624 | Ga0070681_100436242 | 244 |
| 285 | 3300005466 | Ga0070685_10021753 | Ga0070685_100217534 | 244 |
| 286 | 3300005467 | Ga0070706_100010462 | Ga0070706_1000104624 | 244 |
| 287 | 3300005467 | Ga0070706_100017170 | Ga0070706_1000171704 | 244 |
| 288 | 3300005467 | Ga0070706_100094755 | Ga0070706_1000947551 | 244 |
| 289 | 3300005467 | Ga0070706_100360191 | Ga0070706_1003601912 | 244 |
| 290 | 3300005468 | Ga0070707_100001170 | Ga0070707_10000117011 | 244 |
| 291 | 3300005468 | Ga0070707_100036729 | Ga0070707_1000367293 | 244 |
| 292 | 3300005468 | Ga0070707_100037150 | Ga0070707_1000371504 | 244 |
| 293 | 3300005468 | Ga0070707_100090829 | Ga0070707_1000908293 | 244 |
| 294 | 3300005468 | Ga0070707_100377937 | Ga0070707_1003779372 | 244 |
| 295 | 3300005471 | Ga0070698_100000350 | Ga0070698_10000035036 | 244 |
| 296 | 3300005471 | Ga0070698_100008863 | Ga0070698_1000088631 | 244 |
| 297 | 3300005471 | Ga0070698_100044247 | Ga0070698_1000442473 | 244 |
| 298 | 3300005471 | Ga0070698_100115763 | Ga0070698_1001157633 | 244 |
| 299 | 3300005471 | Ga0070698_100158856 | Ga0070698_1001588562 | 244 |
| 300 | 3300005518 | Ga0070699_100152922 | Ga0070699_1001529222 | 244 |
| 301 | 3300005530 | Ga0070679_100024563 | Ga0070679_1000245634 | 244 |
| 302 | 3300005535 | Ga0070684_100183217 | Ga0070684_1001832172 | 244 |
| 303 | 3300005536 | Ga0070697_100005931 | Ga0070697_1000059312 | 244 |
| 304 | 3300005536 | Ga0070697_100046324 | Ga0070697_1000463241 | 244 |
| 305 | 3300005539 | Ga0068853_100082924 | Ga0068853_1000829242 | 244 |
| 306 | 3300005543 | Ga0070672_100014724 | Ga0070672_1000147244 | 244 |
| 307 | 3300005544 | Ga0070686_100017086 | Ga0070686_1000170864 | 244 |
| 308 | 3300005545 | Ga0070695_100038148 | Ga0070695_1000381483 | 244 |
| 309 | 3300005545 | Ga0070695_100049545 | Ga0070695_1000495453 | 244 |
| 310 | 3300005546 | Ga0070696_100113989 | Ga0070696_1001139892 | 244 |
| 311 | 3300005548 | Ga0070665_100148679 | Ga0070665_1001486792 | 244 |
| 312 | 3300005563 | Ga0068855_100350083 | Ga0068855_1003500832 | 244 |
| 313 | 3300005564 | Ga0070664_100046581 | Ga0070664_1000465812 | 244 |
| 314 | 3300005617 | Ga0068859_100054396 | Ga0068859_1000543963 | 244 |
| 315 | 3300005618 | Ga0068864_100209015 | Ga0068864_1002090152 | 244 |
| 316 | 3300005718 | Ga0068866_10007968 | Ga0068866_100079683 | 244 |
| 317 | 3300005719 | Ga0068861_100307086 | Ga0068861_1003070862 | 244 |
| 318 | 3300005841 | Ga0068863_100111980 | Ga0068863_1001119803 | 244 |
| 319 | 3300005841 | Ga0068863_100448863 | Ga0068863_1004488632 | 244 |
| 320 | 3300005983 | Ga0081540_1000250 | Ga0081540_100025041 | 244 |
| 321 | 3300005983 | Ga0081540_1000386 | Ga0081540_100038635 | 244 |
| 322 | 3300006028 | Ga0070717_10000595 | Ga0070717_1000059524 | 244 |
| 323 | 3300006028 | Ga0070717_10009690 | Ga0070717_100096906 | 244 |
| 324 | 3300006028 | Ga0070717_10057455 | Ga0070717_100574553 | 244 |
| 325 | 3300006028 | Ga0070717_10060467 | Ga0070717_100604672 | 244 |
| 326 | 3300006028 | Ga0070717_10276882 | Ga0070717_102768822 | 244 |
| 327 | 3300006028 | Ga0070717_10475002 | Ga0070717_104750022 | 244 |
| 328 | 3300006163 | Ga0070715_10030715 | Ga0070715_100307152 | 244 |
| 329 | 3300006173 | Ga0070716_100000685 | Ga0070716_10000068512 | 244 |
| 330 | 3300006173 | Ga0070716_100001892 | Ga0070716_1000018928 | 244 |
| 331 | 3300006173 | Ga0070716_100083470 | Ga0070716_1000834702 | 244 |
| 332 | 3300006175 | Ga0070712_100001777 | Ga0070712_10000177710 | 244 |
| 333 | 3300006175 | Ga0070712_100029417 | Ga0070712_1000294172 | 244 |
| 334 | 3300006175 | Ga0070712_100029817 | Ga0070712_1000298174 | 244 |
| 335 | 3300006175 | Ga0070712_100054448 | Ga0070712_1000544483 | 244 |
| 336 | 3300006237 | Ga0097621_100082567 | Ga0097621_1000825672 | 244 |
| 337 | 3300006237 | Ga0097621_100258256 | Ga0097621_1002582562 | 244 |
| 338 | 3300006852 | Ga0075433_10101566 | Ga0075433_101015662 | 244 |
| 339 | 3300006871 | Ga0075434_100165210 | Ga0075434_1001652102 | 244 |
| 340 | 3300006914 | Ga0075436_100072291 | Ga0075436_1000722912 | 244 |
| 341 | 3300006914 | Ga0075436_100141277 | Ga0075436_1001412772 | 244 |
| 342 | 3300006931 | Ga0097620_100054396 | Ga0097620_1000543963 | 244 |
| 343 | 3300007076 | Ga0075435_100066923 | Ga0075435_1000669232 | 244 |
| 344 | 3300007076 | Ga0075435_100144057 | Ga0075435_1001440572 | 244 |
| 345 | 3300007788 | Ga0099795_10045308 | Ga0099795_100453082 | 244 |
| 346 | 3300009094 | Ga0111539_10058081 | Ga0111539_100580812 | 244 |
| 347 | 3300009147 | Ga0114129_10240302 | Ga0114129_102403022 | 244 |
| 348 | 3300009148 | Ga0105243_10039299 | Ga0105243_100392992 | 244 |
| 349 | 3300009174 | Ga0105241_10075160 | Ga0105241_100751602 | 244 |
| 350 | 3300009174 | Ga0105241_10221210 | Ga0105241_102212102 | 244 |
| 351 | 3300009176 | Ga0105242_10030525 | Ga0105242_100305253 | 244 |
| 352 | 3300009177 | Ga0105248_10023243 | Ga0105248_100232434 | 244 |
| 353 | 3300009545 | Ga0105237_10199501 | Ga0105237_101995012 | 244 |
| 354 | 3300009545 | Ga0105237_10371724 | Ga0105237_103717242 | 244 |
| 355 | 3300009553 | Ga0105249_10217050 | Ga0105249_102170502 | 244 |
| 356 | 3300011119 | Ga0105246_10042791 | Ga0105246_100427913 | 244 |
| 357 | 3300012495 | Ga0157323_1001231 | Ga0157323_10012312 | 244 |
| 358 | 3300012507 | Ga0157342_1000213 | Ga0157342_10002133 | 244 |
| 359 | 3300012515 | Ga0157338_1000575 | Ga0157338_10005752 | 244 |
| 360 | 3300013296 | Ga0157374_10431359 | Ga0157374_104313592 | 244 |
| 361 | 3300013297 | Ga0157378_10029606 | Ga0157378_100296062 | 244 |
| 362 | 3300013306 | Ga0163162_10158913 | Ga0163162_101589132 | 244 |
| 363 | 3300014969 | Ga0157376_10118718 | Ga0157376_101187182 | 244 |
| 364 | 3300017792 | Ga0163161_10029215 | Ga0163161_100292153 | 244 |
| 365 | 3300020081 | Ga0206354_11210166 | Ga0206354_112101662 | 244 |
| 366 | 3300021388 | Ga0213875_10004658 | Ga0213875_100046585 | 244 |
| 367 | 3300021388 | Ga0213875_10060207 | Ga0213875_100602072 | 244 |
| 368 | 3300022467 | Ga0224712_10008572 | Ga0224712_100085722 | 244 |
| 369 | 3300024225 | Ga0224572_1004952 | Ga0224572_10049522 | 244 |
| 370 | 3300025885 | Ga0207653_10002100 | Ga0207653_100021002 | 244 |
| 371 | 3300025898 | Ga0207692_10006206 | Ga0207692_100062063 | 244 |
| 372 | 3300025898 | Ga0207692_10008220 | Ga0207692_100082203 | 244 |
| 373 | 3300025898 | Ga0207692_10021468 | Ga0207692_100214682 | 244 |
| 374 | 3300025898 | Ga0207692_10076769 | Ga0207692_100767692 | 244 |
| 375 | 3300025899 | Ga0207642_10057235 | Ga0207642_100572352 | 244 |
| 376 | 3300025901 | Ga0207688_10056819 | Ga0207688_100568192 | 244 |
| 377 | 3300025904 | Ga0207647_10055704 | Ga0207647_100557042 | 244 |
| 378 | 3300025905 | Ga0207685_10001956 | Ga0207685_100019562 | 244 |
| 379 | 3300025906 | Ga0207699_10000107 | Ga0207699_1000010752 | 244 |
| 380 | 3300025906 | Ga0207699_10003816 | Ga0207699_100038162 | 244 |
| 381 | 3300025906 | Ga0207699_10035780 | Ga0207699_100357802 | 244 |
| 382 | 3300025907 | Ga0207645_10046014 | Ga0207645_100460142 | 244 |
| 383 | 3300025908 | Ga0207643_10006315 | Ga0207643_100063152 | 244 |
| 384 | 3300025910 | Ga0207684_10009531 | Ga0207684_100095314 | 244 |
| 385 | 3300025910 | Ga0207684_10089043 | Ga0207684_100890432 | 244 |
| 386 | 3300025911 | Ga0207654_10016701 | Ga0207654_100167013 | 244 |
| 387 | 3300025914 | Ga0207671_10026763 | Ga0207671_100267632 | 244 |
| 388 | 3300025915 | Ga0207693_10000536 | Ga0207693_1000053626 | 244 |
| 389 | 3300025915 | Ga0207693_10062238 | Ga0207693_100622383 | 244 |
| 390 | 3300025915 | Ga0207693_10074287 | Ga0207693_100742872 | 244 |
| 391 | 3300025915 | Ga0207693_10182535 | Ga0207693_101825352 | 244 |
| 392 | 3300025915 | Ga0207693_10244888 | Ga0207693_102448882 | 244 |
| 393 | 3300025916 | Ga0207663_10002641 | Ga0207663_100026412 | 244 |
| 394 | 3300025916 | Ga0207663_10031759 | Ga0207663_100317593 | 244 |
| 395 | 3300025916 | Ga0207663_10040846 | Ga0207663_100408462 | 244 |
| 396 | 3300025916 | Ga0207663_10043707 | Ga0207663_100437072 | 244 |
| 397 | 3300025916 | Ga0207663_10082180 | Ga0207663_100821802 | 244 |
| 398 | 3300025917 | Ga0207660_10029377 | Ga0207660_100293774 | 244 |
| 399 | 3300025919 | Ga0207657_10011368 | Ga0207657_100113683 | 244 |
| 400 | 3300025921 | Ga0207652_10097622 | Ga0207652_100976222 | 244 |
| 401 | 3300025922 | Ga0207646_10000071 | Ga0207646_1000007141 | 244 |
| 402 | 3300025922 | Ga0207646_10028949 | Ga0207646_100289494 | 244 |
| 403 | 3300025922 | Ga0207646_10061721 | Ga0207646_100617213 | 244 |
| 404 | 3300025922 | Ga0207646_10062919 | Ga0207646_100629194 | 244 |
| 405 | 3300025928 | Ga0207700_10001550 | Ga0207700_100015502 | 244 |
| 406 | 3300025928 | Ga0207700_10005025 | Ga0207700_100050253 | 244 |
| 407 | 3300025928 | Ga0207700_10014749 | Ga0207700_100147494 | 244 |
| 408 | 3300025928 | Ga0207700_10037702 | Ga0207700_100377022 | 244 |
| 409 | 3300025928 | Ga0207700_10288239 | Ga0207700_102882392 | 244 |
| 410 | 3300025928 | Ga0207700_10365186 | Ga0207700_103651862 | 244 |
| 411 | 3300025929 | Ga0207664_10000271 | Ga0207664_1000027128 | 244 |
| 412 | 3300025929 | Ga0207664_10001093 | Ga0207664_1000109315 | 244 |
| 413 | 3300025929 | Ga0207664_10039991 | Ga0207664_100399912 | 244 |
| 414 | 3300025929 | Ga0207664_10299627 | Ga0207664_102996272 | 244 |
| 415 | 3300025929 | Ga0207664_10337047 | Ga0207664_103370472 | 244 |
| 416 | 3300025929 | Ga0207664_10360866 | Ga0207664_103608662 | 244 |
| 417 | 3300025931 | Ga0207644_10082655 | Ga0207644_100826552 | 244 |
| 418 | 3300025931 | Ga0207644_10300170 | Ga0207644_103001702 | 244 |
| 419 | 3300025933 | Ga0207706_10017461 | Ga0207706_100174617 | 244 |
| 420 | 3300025936 | Ga0207670_10256510 | Ga0207670_102565102 | 244 |
| 421 | 3300025939 | Ga0207665_10001335 | Ga0207665_1000133515 | 244 |
| 422 | 3300025939 | Ga0207665_10024497 | Ga0207665_100244973 | 244 |
| 423 | 3300025939 | Ga0207665_10149661 | Ga0207665_101496612 | 244 |
| 424 | 3300025939 | Ga0207665_10192011 | Ga0207665_101920112 | 244 |
| 425 | 3300025939 | Ga0207665_10216128 | Ga0207665_102161282 | 244 |
| 426 | 3300025940 | Ga0207691_10039540 | Ga0207691_100395402 | 244 |
| 427 | 3300025942 | Ga0207689_10022170 | Ga0207689_100221703 | 244 |
| 428 | 3300025944 | Ga0207661_10086843 | Ga0207661_100868432 | 244 |
| 429 | 3300025944 | Ga0207661_10135661 | Ga0207661_101356612 | 244 |
| 430 | 3300025949 | Ga0207667_10087836 | Ga0207667_100878362 | 244 |
| 431 | 3300025972 | Ga0207668_10176044 | Ga0207668_101760442 | 244 |
| 432 | 3300026023 | Ga0207677_10150012 | Ga0207677_101500122 | 244 |
| 433 | 3300026041 | Ga0207639_10067133 | Ga0207639_100671333 | 244 |
| 434 | 3300026067 | Ga0207678_10003646 | Ga0207678_100036463 | 244 |
| 435 | 3300026075 | Ga0207708_10014032 | Ga0207708_100140324 | 244 |
| 436 | 3300026078 | Ga0207702_10047438 | Ga0207702_100474384 | 244 |
| 437 | 3300026089 | Ga0207648_10045889 | Ga0207648_100458892 | 244 |
| 438 | 3300026116 | Ga0207674_10019631 | Ga0207674_100196313 | 244 |
| 439 | 3300026118 | Ga0207675_100036167 | Ga0207675_1000361673 | 244 |
| 440 | 3300026121 | Ga0207683_10009297 | Ga0207683_100092973 | 244 |
| 441 | 3300027907 | Ga0207428_10064810 | Ga0207428_100648102 | 244 |
| 442 | 3300028379 | Ga0268266_10297934 | Ga0268266_102979342 | 244 |
| 443 | 3300028800 | Ga0265338_10001163 | Ga0265338_1000116340 | 244 |
| 444 | 3300035083 | Ga0373926_0001049 | Ga0373926_0001049_6591_7451 | 244 |
| 445 | 3300035083 | Ga0373926_0007106 | Ga0373926_0007106_1319_2194 | 244 |
| 446 | 3300035086 | Ga0373934_0000290 | Ga0373934_0000290_14104_15003 | 244 |
| 447 | 3300035086 | Ga0373934_0006360 | Ga0373934_0006360_3336_4223 | 244 |
| 448 | 3300035086 | Ga0373934_0010966 | Ga0373934_0010966_2085_2960 | 244 |
| 449 | 3300035086 | Ga0373934_0013804 | Ga0373934_0013804_113_1000 | 244 |
| 450 | 3300035088 | Ga0373940_0014450 | Ga0373940_0014450_107_994 | 244 |
| 451 | 3300035089 | Ga0373944_0001695 | Ga0373944_0001695_2117_2992 | 244 |
| 452 | 3300035089 | Ga0373944_0080296 | Ga0373944_0080296_28_915 | 244 |
| 453 | 3300035091 | Ga0373951_0019994 | Ga0373951_0019994_20_907 | 244 |
| 454 | 3300035111 | Ga0373923_0006704 | Ga0373923_0006704_1858_2733 | 244 |
| 455 | 3300035111 | Ga0373923_0011154 | Ga0373923_0011154_1491_2378 | 244 |
| 456 | 3300035111 | Ga0373923_0053487 | Ga0373923_0053487_376_1239 | 244 |
| 457 | 3300035113 | Ga0373936_0019346 | Ga0373936_0019346_1469_2344 | 244 |
| 458 | 3300035113 | Ga0373936_0049912 | Ga0373936_0049912_631_1518 | 244 |
| 459 | 3300035113 | Ga0373936_0079042 | Ga0373936_0079042_412_1299 | 244 |
| 460 | 3300035114 | Ga0373939_0038958 | Ga0373939_0038958_120_1007 | 244 |
| 461 | 3300035116 | Ga0373945_0006188 | Ga0373945_0006188_1656_2531 | 244 |
| 462 | 3300035116 | Ga0373945_0034052 | Ga0373945_0034052_179_1066 | 244 |
| 463 | 3300035117 | Ga0373953_0000281 | Ga0373953_0000281_3779_4678 | 244 |
| 464 | 3300035117 | Ga0373953_0001460 | Ga0373953_0001460_2149_3036 | 244 |
| 465 | 3300035117 | Ga0373953_0016162 | Ga0373953_0016162_734_1609 | 244 |
| 466 | 3300035118 | Ga0373954_0000410 | Ga0373954_0000410_1451_2350 | 244 |
| 467 | 3300035118 | Ga0373954_0012939 | Ga0373954_0012939_2056_2943 | 244 |
| 468 | 3300035118 | Ga0373954_0036378 | Ga0373954_0036378_643_1518 | 244 |
| 469 | 3300035118 | Ga0373954_0037013 | Ga0373954_0037013_1063_1950 | 244 |
| 470 | 3300035119 | Ga0373956_0001346 | Ga0373956_0001346_4862_5761 | 244 |
| 471 | 3300035119 | Ga0373956_0009092 | Ga0373956_0009092_2616_3491 | 244 |
| 472 | 3300035119 | Ga0373956_0013201 | Ga0373956_0013201_266_1153 | 244 |
| 473 | 3300035119 | Ga0373956_0079576 | Ga0373956_0079576_35_922 | 244 |
| 474 | 3300035120 | Ga0373957_0002779 | Ga0373957_0002779_3337_4236 | 244 |
| 475 | 3300035120 | Ga0373957_0007398 | Ga0373957_0007398_597_1484 | 244 |
| 476 | 3300035170 | Ga0373943_0000958 | Ga0373943_0000958_9761_10636 | 244 |
| 477 | 3300035170 | Ga0373943_0015727 | Ga0373943_0015727_2348_3235 | 244 |
| 478 | 3300035171 | Ga0373946_0002228 | Ga0373946_0002228_5908_6795 | 244 |
| 479 | 3300035171 | Ga0373946_0004794 | Ga0373946_0004794_1813_2688 | 244 |
| 480 | 3300035172 | Ga0373955_0000041 | Ga0373955_0000041_36180_37079 | 244 |
| 481 | 3300035172 | Ga0373955_0008076 | Ga0373955_0008076_1404_2291 | 244 |
| 482 | 3300035172 | Ga0373955_0048774 | Ga0373955_0048774_1262_2137 | 244 |
| 483 | 3300035172 | Ga0373955_0218982 | Ga0373955_0218982_206_1093 | 244 |
| 484 | 3300035410 | Ga0373924_0002565 | Ga0373924_0002565_4241_5140 | 244 |
| 485 | 3300035410 | Ga0373924_0010064 | Ga0373924_0010064_1456_2343 | 244 |
| 486 | 3300035410 | Ga0373924_0090093 | Ga0373924_0090093_381_1268 | 244 |
| 487 | 3300035691 | Ga0373931_0014660 | Ga0373931_0014660_934_1821 | 244 |
| 488 | 3300035691 | Ga0373931_0082238 | Ga0373931_0082238_159_1034 | 244 |
| 489 | 3300035692 | Ga0373935_0009024 | Ga0373935_0009024_1319_2179 | 244 |
| 490 | 3300035692 | Ga0373935_0036404 | Ga0373935_0036404_264_1139 | 244 |
| 491 | 3300035692 | Ga0373935_0111228 | Ga0373935_0111228_207_1094 | 244 |
| 492 | 3300035692 | Ga0373935_0140611 | Ga0373935_0140611_716_1603 | 244 |
| 493 | 3300035695 | Ga0373927_0018103 | Ga0373927_0018103_2158_3033 | 244 |
| 494 | 3300035695 | Ga0373927_0082561 | Ga0373927_0082561_334_1221 | 244 |
| 495 | 3300035724 | Ga0373933_0000246 | Ga0373933_0000246_3579_4478 | 244 |
| 496 | 3300035724 | Ga0373933_0000589 | Ga0373933_0000589_2553_3440 | 244 |
| 497 | 3300035724 | Ga0373933_0014754 | Ga0373933_0014754_2726_3601 | 244 |
| 498 | 3300035725 | Ga0373947_0000015 | Ga0373947_0000015_21365_22225 | 244 |
| 499 | 3300035725 | Ga0373947_0015270 | Ga0373947_0015270_264_1139 | 244 |
| 500 | 3300035725 | Ga0373947_0100955 | Ga0373947_0100955_97_984 | 244 |
| 501 | 3300035725 | Ga0373947_0159606 | Ga0373947_0159606_365_1252 | 244 |
| 502 | 3300036401 | Ga0373937_0000172 | Ga0373937_0000172_14141_15040 | 244 |
| 503 | 3300036401 | Ga0373937_0031728 | Ga0373937_0031728_2615_3502 | 244 |
| 504 | 3300036401 | Ga0373937_0697680 | Ga0373937_0697680_31_918 | 244 |
| 505 | 3300037068 | Ga0373925_0018624 | Ga0373925_0018624_2478_3353 | 244 |
| 506 | 3300037068 | Ga0373925_0054778 | Ga0373925_0054778_1505_2392 | 244 |
| 507 | 3300037068 | Ga0373925_0074548 | Ga0373925_0074548_360_1229 | 244 |
| 508 | 3300037068 | Ga0373925_0076000 | Ga0373925_0076000_1503_2378 | 244 |
| 509 | 3300037068 | Ga0373925_0106514 | Ga0373925_0106514_1100_1987 | 244 |
| 510 | 3300037068 | Ga0373925_0108976 | Ga0373925_0108976_1141_2028 | 244 |
| 511 | 3300037853 | Ga0436364_0180190 | Ga0436364_0180190_245_1129 | 244 |
| 512 | 3300037853 | Ga0436364_0397052 | Ga0436364_0397052_58_933 | 244 |
| 513 | 3300037853 | Ga0436364_0644067 | Ga0436364_0644067_4589_5464 | 244 |
| 514 | 3300037853 | Ga0436364_1380199 | Ga0436364_1380199_1381_2271 | 244 |
| 515 | 3300037853 | Ga0436364_1502227 | Ga0436364_1502227_1247_2122 | 244 |
| 516 | 3300039450 | Ga0436363_1612024 | Ga0436363_1612024_558_1424 | 244 |
| 517 | 3300045976 | Ga0466967_0059991 | Ga0466967_0059991_440_1309 | 244 |
| 518 | 3300046454 | Ga0495592_0000417 | Ga0495592_0000417_14141_15040 | 244 |
| 519 | 3300046454 | Ga0495592_0034414 | Ga0495592_0034414_777_1664 | 244 |
| 520 | 3300046454 | Ga0495592_0074035 | Ga0495592_0074035_1382_2269 | 244 |
| 521 | 3300046454 | Ga0495592_0077847 | Ga0495592_0077847_1061_1936 | 244 |
| 522 | 3300046455 | Ga0495603_0005458 | Ga0495603_0005458_6481_7356 | 244 |
| 523 | 3300046459 | Ga0495629_0031840 | Ga0495629_0031840_995_1870 | 244 |
| 524 | 3300046459 | Ga0495629_0036601 | Ga0495629_0036601_1290_2177 | 244 |
| 525 | 3300046459 | Ga0495629_0213410 | Ga0495629_0213410_389_1276 | 244 |
| 526 | 3300046461 | Ga0495641_0022457 | Ga0495641_0022457_928_1803 | 244 |
| 527 | 3300046461 | Ga0495641_0039201 | Ga0495641_0039201_681_1568 | 244 |
| 528 | 3300046462 | Ga0495651_0000118 | Ga0495651_0000118_43375_44274 | 244 |
| 529 | 3300046462 | Ga0495651_0011483 | Ga0495651_0011483_4711_5586 | 244 |
| 530 | 3300046462 | Ga0495651_0039548 | Ga0495651_0039548_875_1750 | 244 |
| 531 | 3300046462 | Ga0495651_0116926 | Ga0495651_0116926_29_916 | 244 |
| 532 | 3300046462 | Ga0495651_0349492 | Ga0495651_0349492_28_903 | 244 |
| 533 | 3300046463 | Ga0495653_0004695 | Ga0495653_0004695_5555_6454 | 244 |
| 534 | 3300046463 | Ga0495653_0024624 | Ga0495653_0024624_2239_3114 | 244 |
| 535 | 3300046463 | Ga0495653_0117168 | Ga0495653_0117168_361_1236 | 244 |
| 536 | 3300046463 | Ga0495653_0131455 | Ga0495653_0131455_22_897 | 244 |
| 537 | 3300046472 | Ga0495580_0084392 | Ga0495580_0084392_578_1465 | 244 |
| 538 | 3300046473 | Ga0495582_0016884 | Ga0495582_0016884_1968_2855 | 244 |
| 539 | 3300046475 | Ga0495639_0002595 | Ga0495639_0002595_211_1098 | 244 |
| 540 | 3300046475 | Ga0495639_0014969 | Ga0495639_0014969_1680_2555 | 244 |
| 541 | 3300046475 | Ga0495639_0068572 | Ga0495639_0068572_178_1065 | 244 |
| 542 | 3300046476 | Ga0495662_0001119 | Ga0495662_0001119_5688_6575 | 244 |
| 543 | 3300046476 | Ga0495662_0011609 | Ga0495662_0011609_1987_2862 | 244 |
| 544 | 3300046476 | Ga0495662_0021421 | Ga0495662_0021421_1318_2205 | 244 |
| 545 | 3300046477 | Ga0495664_0004752 | Ga0495664_0004752_4520_5407 | 244 |
| 546 | 3300046477 | Ga0495664_0013461 | Ga0495664_0013461_1565_2440 | 244 |
| 547 | 3300046477 | Ga0495664_0104692 | Ga0495664_0104692_431_1306 | 244 |
| 548 | 3300046499 | Ga0495594_0080164 | Ga0495594_0080164_489_1376 | 244 |
| 549 | 3300046511 | Ga0495608_0000156 | Ga0495608_0000156_33832_34731 | 244 |
| 550 | 3300046511 | Ga0495608_0023347 | Ga0495608_0023347_1630_2517 | 244 |
| 551 | 3300046511 | Ga0495608_0075294 | Ga0495608_0075294_268_1143 | 244 |
| 552 | 3300046514 | Ga0495618_0024807 | Ga0495618_0024807_811_1698 | 244 |
| 553 | 3300046514 | Ga0495618_0046067 | Ga0495618_0046067_333_1208 | 244 |
| 554 | 3300046516 | Ga0495628_0000655 | Ga0495628_0000655_15458_16357 | 244 |
| 555 | 3300046516 | Ga0495628_0042494 | Ga0495628_0042494_1432_2319 | 244 |
| 556 | 3300046516 | Ga0495628_0052004 | Ga0495628_0052004_1736_2599 | 244 |
| 557 | 3300046516 | Ga0495628_0079637 | Ga0495628_0079637_387_1262 | 244 |
| 558 | 3300046517 | Ga0495630_0046639 | Ga0495630_0046639_833_1708 | 244 |
| 559 | 3300046517 | Ga0495630_0089251 | Ga0495630_0089251_1305_2180 | 244 |
| 560 | 3300046526 | Ga0495666_0025606 | Ga0495666_0025606_1558_2445 | 244 |
| 561 | 3300046526 | Ga0495666_0031604 | Ga0495666_0031604_402_1289 | 244 |
| 562 | 3300046529 | Ga0495652_0000436 | Ga0495652_0000436_14141_15040 | 244 |
| 563 | 3300046529 | Ga0495652_0036265 | Ga0495652_0036265_1909_2784 | 244 |
| 564 | 3300046529 | Ga0495652_0060564 | Ga0495652_0060564_777_1664 | 244 |
| 565 | 3300046529 | Ga0495652_0071084 | Ga0495652_0071084_1281_2156 | 244 |
| 566 | 3300046529 | Ga0495652_0195392 | Ga0495652_0195392_354_1229 | 244 |
| 567 | 3300046529 | Ga0495652_0204783 | Ga0495652_0204783_402_1289 | 244 |
| 568 | 3300046531 | Ga0495665_0005365 | Ga0495665_0005365_5688_6575 | 244 |
| 569 | 3300046531 | Ga0495665_0005528 | Ga0495665_0005528_4193_5080 | 244 |
| 570 | 3300046531 | Ga0495665_0045817 | Ga0495665_0045817_438_1313 | 244 |
| 571 | 3300046533 | Ga0495640_0006891 | Ga0495640_0006891_2358_3245 | 244 |
| 572 | 3300046533 | Ga0495640_0032871 | Ga0495640_0032871_1885_2760 | 244 |
| 573 | 3300046533 | Ga0495640_0049003 | Ga0495640_0049003_897_1772 | 244 |
| 574 | 3300046535 | Ga0495586_0010763 | Ga0495586_0010763_894_1781 | 244 |
| 575 | 3300046535 | Ga0495586_0076951 | Ga0495586_0076951_711_1574 | 244 |
| 576 | 3300046536 | Ga0495587_0000045 | Ga0495587_0000045_93323_94222 | 244 |
| 577 | 3300046536 | Ga0495587_0021977 | Ga0495587_0021977_3021_3896 | 244 |
| 578 | 3300046536 | Ga0495587_0029180 | Ga0495587_0029180_2003_2890 | 244 |
| 579 | 3300046543 | Ga0495645_0082093 | Ga0495645_0082093_1201_2076 | 244 |
| 580 | 3300046543 | Ga0495645_0154282 | Ga0495645_0154282_614_1501 | 244 |
| 581 | 3300046543 | Ga0495645_0198259 | Ga0495645_0198259_271_1158 | 244 |
| 582 | 3300046543 | Ga0495645_0206632 | Ga0495645_0206632_289_1152 | 244 |
| 583 | 3300046559 | Ga0495667_0000051 | Ga0495667_0000051_94238_95137 | 244 |
| 584 | 3300046559 | Ga0495667_0026112 | Ga0495667_0026112_1019_1894 | 244 |
| 585 | 3300046559 | Ga0495667_0030093 | Ga0495667_0030093_573_1460 | 244 |
| 586 | 3300046559 | Ga0495667_0036695 | Ga0495667_0036695_543_1418 | 244 |
| 587 | 3300046559 | Ga0495667_0044919 | Ga0495667_0044919_52_927 | 244 |
| 588 | 3300046559 | Ga0495667_0209516 | Ga0495667_0209516_92_952 | 244 |
| 589 | 3300046642 | Ga0495634_0024496 | Ga0495634_0024496_1334_2209 | 244 |
| 590 | 3300046642 | Ga0495634_0029565 | Ga0495634_0029565_1196_2083 | 244 |
| 591 | 3300046663 | Ga0495635_0020163 | Ga0495635_0020163_2242_3117 | 244 |
| 592 | 3300046663 | Ga0495635_0146840 | Ga0495635_0146840_320_1195 | 244 |
| 593 | 3300046663 | Ga0495635_0364778 | Ga0495635_0364778_29_916 | 244 |
| 594 | 3300046675 | Ga0495657_0000044 | Ga0495657_0000044_93344_94243 | 244 |
| 595 | 3300046675 | Ga0495657_0015482 | Ga0495657_0015482_2655_3542 | 244 |
| 596 | 3300046675 | Ga0495657_0123039 | Ga0495657_0123039_666_1541 | 244 |
| 597 | 3300046678 | Ga0495599_0000127 | Ga0495599_0000127_33709_34608 | 244 |
| 598 | 3300046678 | Ga0495599_0048662 | Ga0495599_0048662_141_1028 | 244 |
| 599 | 3300046678 | Ga0495599_0146518 | Ga0495599_0146518_371_1258 | 244 |
| 600 | 3300046679 | Ga0495623_0004402 | Ga0495623_0004402_2260_3159 | 244 |
| 601 | 3300046679 | Ga0495623_0011331 | Ga0495623_0011331_2196_3083 | 244 |
| 602 | 3300046679 | Ga0495623_0027825 | Ga0495623_0027825_326_1213 | 244 |
| 603 | 3300046680 | Ga0495646_0012163 | Ga0495646_0012163_2237_3124 | 244 |
| 604 | 3300046680 | Ga0495646_0022004 | Ga0495646_0022004_918_1805 | 244 |
| 605 | 3300046681 | Ga0495647_0009779 | Ga0495647_0009779_2233_3108 | 244 |
| 606 | 3300046683 | Ga0495658_0023317 | Ga0495658_0023317_333_1220 | 244 |
| 607 | 3300046689 | Ga0495613_0015792 | Ga0495613_0015792_2349_3236 | 244 |
| 608 | 3300046689 | Ga0495613_0027087 | Ga0495613_0027087_2517_3404 | 244 |
| 609 | 3300046690 | Ga0495624_0011079 | Ga0495624_0011079_3009_3884 | 244 |
| 610 | 3300046690 | Ga0495624_0012215 | Ga0495624_0012215_918_1805 | 244 |
| 611 | 3300046690 | Ga0495624_0017955 | Ga0495624_0017955_2164_3051 | 244 |
| 612 | 3300046809 | Ga0495600_0003470 | Ga0495600_0003470_1428_2315 | 244 |
| 613 | 3300046809 | Ga0495600_0004056 | Ga0495600_0004056_1715_2614 | 244 |
| 614 | 3300046809 | Ga0495600_0021267 | Ga0495600_0021267_851_1738 | 244 |
| 615 | 3300046809 | Ga0495600_0053116 | Ga0495600_0053116_333_1208 | 244 |
| 616 | 3300047315 | Ga0495581_0007508 | Ga0495581_0007508_3694_4581 | 244 |
| 617 | 3300047315 | Ga0495581_0037248 | Ga0495581_0037248_1277_2152 | 244 |
| 618 | 3300047317 | Ga0495604_0000046 | Ga0495604_0000046_94256_95155 | 244 |
| 619 | 3300047317 | Ga0495604_0003684 | Ga0495604_0003684_8137_9024 | 244 |
| 620 | 3300047317 | Ga0495604_0026106 | Ga0495604_0026106_2216_3103 | 244 |
| 621 | 3300047317 | Ga0495604_0061083 | Ga0495604_0061083_476_1351 | 244 |
| 622 | 3300047319 | Ga0495674_0033338 | Ga0495674_0033338_2207_3082 | 244 |
| 623 | 3300047321 | Ga0495676_0027520 | Ga0495676_0027520_875_1762 | 244 |
| 624 | 3300047321 | Ga0495676_0029398 | Ga0495676_0029398_1573_2448 | 244 |
| 625 | 3300047321 | Ga0495676_0088314 | Ga0495676_0088314_388_1275 | 244 |
| 626 | 3300047322 | Ga0495680_0000945 | Ga0495680_0000945_17260_18159 | 244 |
| 627 | 3300047322 | Ga0495680_0015977 | Ga0495680_0015977_1462_2337 | 244 |
| 628 | 3300047322 | Ga0495680_0032786 | Ga0495680_0032786_1370_2245 | 244 |
| 629 | 3300047322 | Ga0495680_0033036 | Ga0495680_0033036_2020_2907 | 244 |
| 630 | 3300047444 | Ga0495675_0000499 | Ga0495675_0000499_10458_11357 | 244 |
| 631 | 3300047444 | Ga0495675_0049337 | Ga0495675_0049337_881_1768 | 244 |
| 632 | 3300047471 | Ga0495684_0026204 | Ga0495684_0026204_2041_2916 | 244 |
| 633 | 3300047471 | Ga0495684_0135878 | Ga0495684_0135878_592_1467 | 244 |
| 634 | 3300047471 | Ga0495684_0158051 | Ga0495684_0158051_777_1664 | 244 |
| 635 | 3300047673 | Ga0495593_0015172 | Ga0495593_0015172_1967_2854 | 244 |
| 636 | 3300047673 | Ga0495593_0019542 | Ga0495593_0019542_1809_2684 | 244 |
| 637 | 3300047673 | Ga0495593_0066165 | Ga0495593_0066165_168_1055 | 244 |
| 638 | 3300048088 | Ga0495602_0000665 | Ga0495602_0000665_14141_15040 | 244 |
| 639 | 3300048088 | Ga0495602_0084491 | Ga0495602_0084491_267_1154 | 244 |
| 640 | 3300048088 | Ga0495602_0088740 | Ga0495602_0088740_926_1801 | 244 |
| 641 | 3300048088 | Ga0495602_0266378 | Ga0495602_0266378_38_913 | 244 |
| 642 | 3300048089 | Ga0495614_0037856 | Ga0495614_0037856_447_1334 | 244 |
| 643 | 3300048904 | Ga0496101_0099527 | Ga0496101_0099527_489_1376 | 244 |
| 644 | 3300048906 | Ga0496103_0021733 | Ga0496103_0021733_2408_3295 | 244 |
| 645 | 3300048907 | Ga0496104_0084730 | Ga0496104_0084730_1624_2511 | 244 |
| 646 | 3300048908 | Ga0496105_0032722 | Ga0496105_0032722_1850_2737 | 244 |
| 647 | 3300048908 | Ga0496105_0116334 | Ga0496105_0116334_180_1055 | 244 |
| 648 | 3300048909 | Ga0496106_0165819 | Ga0496106_0165819_270_1145 | 244 |
| 649 | 3300048911 | Ga0496108_0129577 | Ga0496108_0129577_1046_1921 | 244 |
| 650 | 3300048911 | Ga0496108_0202100 | Ga0496108_0202100_332_1219 | 244 |
| 651 | 3300048912 | Ga0496109_0053525 | Ga0496109_0053525_1541_2428 | 244 |
| 652 | 3300048913 | Ga0496110_0008423 | Ga0496110_0008423_4151_5038 | 244 |
| 653 | 3300048915 | Ga0496112_0077090 | Ga0496112_0077090_1864_2751 | 244 |
| 654 | 3300048917 | Ga0496114_0010063 | Ga0496114_0010063_5990_6877 | 244 |
| 655 | 3300048918 | Ga0496115_0114397 | Ga0496115_0114397_291_1178 | 244 |
| 656 | 3300050507 | nmdc:mga05p37_14396_c1 | nmdc:mga05p37_14396_c1_916_1815 | 244 |
| 657 | 3300050511 | nmdc:mga08y16_362405_c1 | nmdc:mga08y16_362405_c1_402_1301 | 244 |
| 658 | 3300050512 | nmdc:mga0n895_135214_c1 | nmdc:mga0n895_135214_c1_299_1186 | 244 |
| 659 | 3300050512 | nmdc:mga0n895_177728_c1 | nmdc:mga0n895_177728_c1_741_1640 | 244 |
| 660 | 3300050513 | nmdc:mga0rr50_63990_c1 | nmdc:mga0rr50_63990_c1_664_1551 | 244 |
| 661 | 3300050515 | nmdc:mga0a205_251378_c1 | nmdc:mga0a205_251378_c1_291_1178 | 244 |
| 662 | 3300053077 | Ga0495601_0015740 | Ga0495601_0015740_448_1335 | 244 |
| 663 | 3300053084 | Ga0495595_0000195 | Ga0495595_0000195_6599_7498 | 244 |
| 664 | 3300053084 | Ga0495595_0020438 | Ga0495595_0020438_125_1012 | 244 |
| 665 | 3300053084 | Ga0495595_0045598 | Ga0495595_0045598_205_1080 | 244 |
| 666 | 3300053085 | Ga0495619_0024309 | Ga0495619_0024309_2259_3158 | 244 |
| 667 | 3300053085 | Ga0495619_0114575 | Ga0495619_0114575_88_963 | 244 |
| 668 | 3300053085 | Ga0495619_0184119 | Ga0495619_0184119_444_1304 | 244 |
| 669 | 3300053104 | Ga0500556_0000007 | Ga0500556_0000007_252610_253494 | 244 |
| 670 | 3300005467 | Ga0070706_100088320 | Ga0070706_1000883203 | 245 |
| 671 | 3300005468 | Ga0070707_100029663 | Ga0070707_1000296633 | 245 |
| 672 | 3300006028 | Ga0070717_10011331 | Ga0070717_100113316 | 245 |
| 673 | 3300025910 | Ga0207684_10001220 | Ga0207684_1000122025 | 245 |
| 674 | 3300025922 | Ga0207646_10004644 | Ga0207646_100046446 | 245 |
| 675 | 3300037068 | Ga0373925_0002980 | Ga0373925_0002980_9928_10845 | 245 |
| 676 | 3300053140 | Ga0500573_0109538 | Ga0500573_0109538_416_1312 | 245 |
| 677 | 3300035118 | Ga0373954_0041952 | Ga0373954_0041952_172_1080 | 246 |
| 678 | 3300035172 | Ga0373955_0015270 | Ga0373955_0015270_1912_2820 | 246 |
| 679 | 3300036401 | Ga0373937_0062750 | Ga0373937_0062750_367_1275 | 246 |
| 680 | 3300037068 | Ga0373925_0022968 | Ga0373925_0022968_749_1657 | 246 |
| 681 | 3300046454 | Ga0495592_0006283 | Ga0495592_0006283_4800_5708 | 246 |
| 682 | 3300046462 | Ga0495651_0003084 | Ga0495651_0003084_11444_12352 | 246 |
| 683 | 3300046463 | Ga0495653_0016444 | Ga0495653_0016444_3085_3993 | 246 |
| 684 | 3300046516 | Ga0495628_0112294 | Ga0495628_0112294_482_1390 | 246 |
| 685 | 3300046529 | Ga0495652_0039756 | Ga0495652_0039756_2696_3604 | 246 |
| 686 | 3300046536 | Ga0495587_0016389 | Ga0495587_0016389_1803_2711 | 246 |
| 687 | 3300046543 | Ga0495645_0027909 | Ga0495645_0027909_137_1045 | 246 |
| 688 | 3300046559 | Ga0495667_0000582 | Ga0495667_0000582_8510_9418 | 246 |
| 689 | 3300046663 | Ga0495635_0008687 | Ga0495635_0008687_2540_3448 | 246 |
| 690 | 3300046675 | Ga0495657_0002604 | Ga0495657_0002604_14104_15012 | 246 |
| 691 | 3300046679 | Ga0495623_0006558 | Ga0495623_0006558_645_1553 | 246 |
| 692 | 3300046809 | Ga0495600_0010281 | Ga0495600_0010281_1972_2880 | 246 |
| 693 | 3300047317 | Ga0495604_0002826 | Ga0495604_0002826_11410_12318 | 246 |
| 694 | 3300047319 | Ga0495674_0010747 | Ga0495674_0010747_4966_5874 | 246 |
| 695 | 3300047322 | Ga0495680_0003754 | Ga0495680_0003754_13735_14643 | 246 |
| 696 | 3300047444 | Ga0495675_0036092 | Ga0495675_0036092_1464_2372 | 246 |
| 697 | 3300047472 | Ga0495686_0011517 | Ga0495686_0011517_3983_4867 | 246 |
| 698 | 3300048088 | Ga0495602_0001500 | Ga0495602_0001500_10449_11357 | 246 |
| 699 | 3300053085 | Ga0495619_0026025 | Ga0495619_0026025_760_1668 | 246 |
| 700 | 3300053139 | Ga0500568_0000021 | Ga0500568_0000021_106600_107484 | 246 |
| 701 | 3300053136 | Ga0500559_0004968 | Ga0500559_0004968_873_1721 | 248 |
| 702 | 3300053136 | Ga0500559_0056402 | Ga0500559_0056402_872_1720 | 248 |
| 703 | 3300037068 | Ga0373925_0000008 | Ga0373925_0000008_219777_220739 | 249 |
| 704 | 3300005355 | Ga0070671_100440103 | Ga0070671_1004401031 | 252 |
| 705 | iso_pu_bacteria | 2939657138 | 2939657443 | 253 |
| 706 | 3300009174 | Ga0105241_10000322 | Ga0105241_1000032230 | 256 |
| 707 | 3300025254 | Ga0209148_1000401 | Ga0209148_100040110 | 256 |
| 708 | 3300025911 | Ga0207654_10000003 | Ga0207654_10000003547 | 256 |
| 709 | 3300026116 | Ga0207674_10182913 | Ga0207674_101829132 | 256 |
| 710 | 3300053093 | Ga0500651_0000161 | Ga0500651_0000161_28289_29161 | 256 |
| 711 | 3300053155 | Ga0500620_000119 | Ga0500620_000119_6870_7742 | 256 |
| 712 | 3300053142 | Ga0500577_0066615 | Ga0500577_0066615_93_995 | 258 |
| 713 | 3300031649 | Ga0307514_10053243 | Ga0307514_100532432 | 261 |
| 714 | 3300005327 | Ga0070658_10009771 | Ga0070658_100097716 | 263 |
| 715 | 3300005339 | Ga0070660_100126026 | Ga0070660_1001260262 | 263 |
| 716 | 3300005366 | Ga0070659_100004629 | Ga0070659_1000046296 | 263 |
| 717 | 3300005367 | Ga0070667_100031436 | Ga0070667_1000314365 | 263 |
| 718 | 3300005466 | Ga0070685_10004937 | Ga0070685_100049375 | 263 |
| 719 | 3300005530 | Ga0070679_100510331 | Ga0070679_1005103312 | 263 |
| 720 | 3300005539 | Ga0068853_100011285 | Ga0068853_10001128510 | 263 |
| 721 | 3300005563 | Ga0068855_100282567 | Ga0068855_1002825673 | 263 |
| 722 | 3300005617 | Ga0068859_100086257 | Ga0068859_1000862572 | 263 |
| 723 | 3300006931 | Ga0097620_100086260 | Ga0097620_1000862602 | 263 |
| 724 | 3300014968 | Ga0157379_10011513 | Ga0157379_100115133 | 263 |
| 725 | 3300025909 | Ga0207705_10005871 | Ga0207705_100058715 | 263 |
| 726 | 3300025919 | Ga0207657_10006580 | Ga0207657_100065807 | 263 |
| 727 | 3300025932 | Ga0207690_10001961 | Ga0207690_100019616 | 263 |
| 728 | 3300025949 | Ga0207667_10015792 | Ga0207667_100157923 | 263 |
| 729 | 3300026041 | Ga0207639_10494789 | Ga0207639_104947892 | 263 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7r6k-assembly1.cif.gz_q | state e2 nucleolar 60s ribosomal intermediate - model for noc2/noc3 region | 0.7913 | 115 | 166 |
| 3cjq-assembly2.cif.gz_D | ribosomal protein l11 methyltransferase (prma) in complex with dimethylated ribosomal protein l11 in space group p212121 | 0.7784 | 115 | 262 |
| 2zbp-assembly1.cif.gz_A | crystal structure of ribosomal protein l11 methyltransferase from thermus thermophilus in complex with s-adenosyl-l-methionine | 0.7774 | 115 | 262 |
| 3dh0-assembly1.cif.gz_A | crystal structure of a sam dependent methyltransferase from aquifex aeolicus | 0.7361 | 115 | 263 |
| 6zxy-assembly1.cif.gz_B | structure of archaeoglobus fulgidus trm11 m2g10 trna methyltransferase enzyme | 0.7327 | 115 | 262 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9Y5R4_126_337_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8342 | 86 | 262 | 3.40.50.150 |
| af_P9WHV3_83_284_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8249 | 84 | 262 | 3.40.50.150 |
| af_Q9FMI5_170_376_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8239 | 84 | 262 | 3.40.50.150 |
| af_Q2FWE1_84_278_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8163 | 84 | 261 | 3.40.50.150 |
| af_Q2FXZ4_114_311_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8086 | 117 | 263 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A354EAN8-F1-model_v4 | deleted | 0.9392 | 164 | 262 |
|
| AF-A0A660Y4S7-F1-model_v4 | Peptide chain release factor N(5)-glutamine methyltransferase | 0.9291 | 160 | 261 |
GO:0003676
GO:0008168 GO:0032259 |
| AF-A0A537ZZM8-F1-model_v4 | Uncharacterized protein | 0.9253 | 164 | 261 |
GO:0036009
|
| AF-A0A7Y2EZU6-F1-model_v4 | Peptide chain release factor N(5)-glutamine methyltransferase | 0.9242 | 167 | 263 |
GO:0003676
GO:0008168 GO:0032259 |
| AF-A0A7X9E3Y0-F1-model_v4 | Peptide chain release factor N(5)-glutamine methyltransferase | 0.9205 | 164 | 263 |
GO:0003676
GO:0008168 GO:0032259 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar