F477882

General Info

Members Datasets Scaffolds Average Seq Length
729 263 729 160

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0000944|Ga0496100_0000944_2204_2779
Length 191
Sequence MRLERDWTKCAHADRNESMRLKRTYSSREIASLTGLTARQLQLWDASGLMAAAIPTHRTDAGGYTERRYTPIELFELLVLADLRRRGFSVPQLHQIIATLRGQFGARLFEATGGGGHVQLLTDGHDIYARTDRGEFFNLLREPAQPLLVVGDEGLLKELSSTLRPRRPRSHKGALPAPRKRSAGRSRDQKL

Samples

Sample ID Description Type Environment
1 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
175 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
176 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
196 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
197 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
198 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
199 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 5.35
Rhizosphere 94.38
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_11794399 3300004800 Bacteria 1965
2 Ga0058862_10215903 3300004803 Unclassified 1914
3 Ga0065704_10309473 3300005289 Unclassified 871
4 Ga0065712_10104326 3300005290 Bacteria 1964
5 Ga0065715_10008955 3300005293 Bacteria 4270
6 Ga0065715_10011211 3300005293 Bacteria 2063
7 Ga0070676_10732885 3300005328 Unclassified 724
8 Ga0070683_100547814 3300005329 Unclassified 1106
9 Ga0070690_100689438 3300005330 Bacteria 783
10 Ga0070670_100091860 3300005331 Bacteria 2610
11 Ga0070670_100385630 3300005331 Bacteria 1235
12 Ga0068869_100105587 3300005334 Bacteria 2137
13 Ga0068869_100663065 3300005334 Unclassified 887
14 Ga0070666_10020939 3300005335 Bacteria 4234
15 Ga0070666_10200812 3300005335 Unclassified 1403
16 Ga0070680_100035994 3300005336 Bacteria 3998
17 Ga0070680_101038433 3300005336 Bacteria 708
18 Ga0070680_101420094 3300005336 Bacteria 601
19 Ga0070682_100431594 3300005337 Bacteria 1004
20 Ga0068868_100016138 3300005338 Bacteria 5540
21 Ga0068868_100029482 3300005338 Bacteria 4202
22 Ga0068868_100786000 3300005338 Unclassified 858
23 Ga0070660_100005024 3300005339 Bacteria 9144
24 Ga0070689_100152789 3300005340 Bacteria 1862
25 Ga0070689_100443957 3300005340 Bacteria 1103
26 Ga0070687_100061394 3300005343 Bacteria 1987
27 Ga0070687_100182483 3300005343 Unclassified 1258
28 Ga0070687_100462813 3300005343 Bacteria 846
29 Ga0070661_100570016 3300005344 Bacteria 913
30 Ga0070668_100145233 3300005347 Bacteria 1914
31 Ga0070668_100268044 3300005347 Bacteria 1422
32 Ga0070669_100008803 3300005353 Bacteria 7199
33 Ga0070669_100069820 3300005353 Bacteria 2595
34 Ga0070669_100361940 3300005353 Bacteria 1180
35 Ga0070675_100153447 3300005354 Unclassified 1976
36 Ga0070671_100022694 3300005355 Bacteria 5127
37 Ga0070671_100393607 3300005355 Bacteria 1185
38 Ga0070671_100631495 3300005355 Unclassified 927
39 Ga0070671_100932829 3300005355 Unclassified 759
40 Ga0070671_100942501 3300005355 Unclassified 755
41 Ga0070674_100108568 3300005356 Unclassified 2034
42 Ga0070674_100150230 3300005356 Bacteria 1757
43 Ga0070674_100271766 3300005356 Bacteria 1340
44 Ga0070674_100620616 3300005356 Bacteria 916
45 Ga0070673_100314915 3300005364 Bacteria 1381
46 Ga0070673_100374824 3300005364 Unclassified 1268
47 Ga0070673_100565925 3300005364 Bacteria 1034
48 Ga0070673_101404190 3300005364 Unclassified 657
49 Ga0070688_100085989 3300005365 Bacteria 2045
50 Ga0070688_100105316 3300005365 Unclassified 1867
51 Ga0070688_100248469 3300005365 Bacteria 1265
52 Ga0070659_100059747 3300005366 Bacteria 3010
53 Ga0070659_100102679 3300005366 Bacteria 2302
54 Ga0070667_100038020 3300005367 Bacteria 4036
55 Ga0070667_100360609 3300005367 Bacteria 1317
56 Ga0070709_10493408 3300005434 Bacteria 929
57 Ga0070714_100744055 3300005435 Bacteria 947
58 Ga0070713_100079681 3300005436 Bacteria 2790
59 Ga0070701_10305087 3300005438 Unclassified 980
60 Ga0070701_10403681 3300005438 Bacteria 866
61 Ga0070701_10620954 3300005438 Bacteria 718
62 Ga0070705_100510647 3300005440 Unclassified 914
63 Ga0070700_100109117 3300005441 Bacteria 1837
64 Ga0070700_100194041 3300005441 Unclassified 1422
65 Ga0070700_100906851 3300005441 Bacteria 718
66 Ga0070694_100018134 3300005444 Bacteria 4463
67 Ga0070694_100106599 3300005444 Bacteria 1990
68 Ga0070694_100888550 3300005444 Bacteria 735
69 Ga0070708_100036911 3300005445 Bacteria 4262
70 Ga0070708_100642728 3300005445 Bacteria 1000
71 Ga0070678_100161269 3300005456 Bacteria 1817
72 Ga0070678_100173014 3300005456 Bacteria 1761
73 Ga0070678_100357755 3300005456 Bacteria 1257
74 Ga0070662_100456949 3300005457 Bacteria 1061
75 Ga0070681_10012336 3300005458 Bacteria 8474
76 Ga0070681_10834860 3300005458 Bacteria 839
77 Ga0068867_100250438 3300005459 Bacteria 1440
78 Ga0068867_100625023 3300005459 Bacteria 942
79 Ga0070706_100280137 3300005467 Bacteria 1556
80 Ga0070706_100826941 3300005467 Bacteria 857
81 Ga0070706_100987075 3300005467 Bacteria 777
82 Ga0070706_101245726 3300005467 Bacteria 683
83 Ga0070707_100102237 3300005468 Unclassified 2777
84 Ga0070707_100106459 3300005468 Bacteria 2720
85 Ga0070707_100128094 3300005468 Bacteria 2467
86 Ga0070707_100413052 3300005468 Bacteria 1310
87 Ga0070707_100561210 3300005468 Bacteria 1104
88 Ga0070707_101706518 3300005468 Bacteria 597
89 Ga0070698_100056676 3300005471 Bacteria 3970
90 Ga0070699_100014967 3300005518 Bacteria 6666
91 Ga0070699_100074390 3300005518 Bacteria 2956
92 Ga0070699_100081960 3300005518 Bacteria 2812
93 Ga0070679_100295562 3300005530 Unclassified 1571
94 Ga0070679_101618933 3300005530 Bacteria 595
95 Ga0070684_100502300 3300005535 Unclassified 1123
96 Ga0070697_100040806 3300005536 Bacteria 3756
97 Ga0070697_100674575 3300005536 Unclassified 911
98 Ga0070697_100764836 3300005536 Bacteria 854
99 Ga0068853_100805322 3300005539 Unclassified 900
100 Ga0070672_100002128 3300005543 Bacteria 12501
101 Ga0070672_100147334 3300005543 Unclassified 1946
102 Ga0070672_100637720 3300005543 Bacteria 930
103 Ga0070672_101094461 3300005543 Bacteria 708
104 Ga0070686_100020103 3300005544 Bacteria 3948
105 Ga0070686_100070078 3300005544 Bacteria 2292
106 Ga0070686_100093777 3300005544 Bacteria 2014
107 Ga0070686_100187636 3300005544 Bacteria 1473
108 Ga0070686_100602724 3300005544 Unclassified 866
109 Ga0070695_100006549 3300005545 Bacteria 6882
110 Ga0070695_100110168 3300005545 Bacteria 1867
111 Ga0070696_100085226 3300005546 Bacteria 2242
112 Ga0070696_100156796 3300005546 Unclassified 1675
113 Ga0070696_100158511 3300005546 Bacteria 1666
114 Ga0070696_100168474 3300005546 Bacteria 1618
115 Ga0070696_100657387 3300005546 Unclassified 850
116 Ga0070696_101215242 3300005546 Bacteria 637
117 Ga0070693_100217419 3300005547 Bacteria 1250
118 Ga0070693_100218155 3300005547 Bacteria 1248
119 Ga0070665_100014048 3300005548 Bacteria 8050
120 Ga0070665_100022599 3300005548 Bacteria 6332
121 Ga0070665_100163570 3300005548 Bacteria 2227
122 Ga0070704_100029626 3300005549 Unclassified 3657
123 Ga0070704_100861213 3300005549 Unclassified 813
124 Ga0068855_100285795 3300005563 Bacteria 1830
125 Ga0068855_100292620 3300005563 Bacteria 1805
126 Ga0070664_100111635 3300005564 Unclassified 2386
127 Ga0070664_100200107 3300005564 Bacteria 1782
128 Ga0070664_100286926 3300005564 Unclassified 1485
129 Ga0068857_100227389 3300005577 Bacteria 1705
130 Ga0068854_100045603 3300005578 Bacteria 3118
131 Ga0068854_100159208 3300005578 Bacteria 1747
132 Ga0068854_100205010 3300005578 Unclassified 1552
133 Ga0068854_100355577 3300005578 Unclassified 1200
134 Ga0068856_100041738 3300005614 Bacteria 4510
135 Ga0070702_100307945 3300005615 Unclassified 1099
136 Ga0070702_100693488 3300005615 Unclassified 775
137 Ga0068852_100393989 3300005616 Unclassified 1361
138 Ga0068859_100004413 3300005617 Bacteria 14352
139 Ga0068859_100037441 3300005617 Bacteria 4868
140 Ga0068859_100110799 3300005617 Bacteria 2807
141 Ga0068859_100139856 3300005617 Unclassified 2494
142 Ga0068859_100361110 3300005617 Bacteria 1547
143 Ga0068859_100828231 3300005617 Bacteria 1012
144 Ga0068864_100012604 3300005618 Bacteria 6991
145 Ga0068864_100289994 3300005618 Bacteria 1530
146 Ga0068866_10025138 3300005718 Bacteria 2796
147 Ga0068866_11255111 3300005718 Unclassified 537
148 Ga0068861_100012934 3300005719 Bacteria 5827
149 Ga0068861_100072744 3300005719 Bacteria 2668
150 Ga0068861_100142405 3300005719 Bacteria 1958
151 Ga0068861_100703915 3300005719 Unclassified 939
152 Ga0068861_101717754 3300005719 Bacteria 621
153 Ga0068870_10293112 3300005840 Bacteria 1024
154 Ga0068863_100192030 3300005841 Unclassified 1963
155 Ga0068863_101894779 3300005841 Unclassified 606
156 Ga0068858_100012051 3300005842 Bacteria 8150
157 Ga0068858_100041172 3300005842 Bacteria 4284
158 Ga0068858_100071308 3300005842 Bacteria 3222
159 Ga0068858_100409361 3300005842 Unclassified 1304
160 Ga0068860_100069823 3300005843 Unclassified 3340
161 Ga0068860_100120363 3300005843 Bacteria 2514
162 Ga0068860_100288617 3300005843 Bacteria 1605
163 Ga0068860_100494770 3300005843 Bacteria 1220
164 Ga0068860_100559689 3300005843 Bacteria 1146
165 Ga0068862_100028651 3300005844 Unclassified 4691
166 Ga0068862_100109126 3300005844 Bacteria 2427
167 Ga0068862_100194662 3300005844 Unclassified 1826
168 Ga0068862_101162696 3300005844 Bacteria 769
169 Ga0070715_10013608 3300006163 Bacteria 2993
170 Ga0070716_100543294 3300006173 Bacteria 865
171 Ga0097621_100004117 3300006237 Bacteria 10085
172 Ga0097621_100021404 3300006237 Bacteria 5002
173 Ga0097621_100034551 3300006237 Bacteria 4034
174 Ga0097621_100053650 3300006237 Bacteria 3286
175 Ga0097621_100057424 3300006237 Bacteria 3183
176 Ga0097621_100112068 3300006237 Bacteria 2306
177 Ga0097621_100132474 3300006237 Bacteria 2123
178 Ga0097621_100186678 3300006237 Unclassified 1794
179 Ga0097621_100222990 3300006237 Bacteria 1643
180 Ga0097621_100418628 3300006237 Bacteria 1202
181 Ga0097621_100521204 3300006237 Bacteria 1079
182 Ga0097621_100654898 3300006237 Bacteria 964
183 Ga0068871_100000670 3300006358 Bacteria 23450
184 Ga0068871_100051184 3300006358 Bacteria 3343
185 Ga0068871_100055205 3300006358 Bacteria 3225
186 Ga0068871_100057193 3300006358 Bacteria 3173
187 Ga0068871_100100775 3300006358 Bacteria 2420
188 Ga0068871_100141055 3300006358 Bacteria 2049
189 Ga0068871_100155946 3300006358 Unclassified 1950
190 Ga0068871_100214812 3300006358 Unclassified 1664
191 Ga0068871_100540775 3300006358 Bacteria 1054
192 Ga0068871_101454766 3300006358 Bacteria 647
193 Ga0075428_100000007 3300006844 Bacteria 273226
194 Ga0075428_100106189 3300006844 Bacteria 3061
195 Ga0075428_100831261 3300006844 Bacteria 981
196 Ga0075428_100935433 3300006844 Bacteria 919
197 Ga0075430_100825898 3300006846 Bacteria 764
198 Ga0075431_100013395 3300006847 Bacteria 8285
199 Ga0075431_100048384 3300006847 Unclassified 4386
200 Ga0075431_100089929 3300006847 Bacteria 3169
201 Ga0075433_10025649 3300006852 Unclassified 4984
202 Ga0075433_10098369 3300006852 Bacteria 2590
203 Ga0075433_10180809 3300006852 Bacteria 1877
204 Ga0075433_10220526 3300006852 Bacteria 1685
205 Ga0075433_10323315 3300006852 Bacteria 1365
206 Ga0075433_10429002 3300006852 Unclassified 1166
207 Ga0075433_10435665 3300006852 Bacteria 1156
208 Ga0075433_10869367 3300006852 Bacteria 787
209 Ga0075434_100000134 3300006871 Bacteria 44745
210 Ga0075434_100014854 3300006871 Bacteria 7449
211 Ga0075434_100041050 3300006871 Bacteria 4582
212 Ga0075434_100135105 3300006871 Bacteria 2485
213 Ga0075434_100164745 3300006871 Unclassified 2237
214 Ga0075434_100541510 3300006871 Bacteria 1184
215 Ga0075434_101146006 3300006871 Unclassified 790
216 Ga0075434_101532064 3300006871 Unclassified 676
217 Ga0075434_101628579 3300006871 Bacteria 654
218 Ga0075429_100149587 3300006880 Bacteria 2044
219 Ga0075429_100598858 3300006880 Bacteria 966
220 Ga0075429_100618383 3300006880 Unclassified 949
221 Ga0075429_100627333 3300006880 Bacteria 942
222 Ga0068865_100007288 3300006881 Bacteria 6797
223 Ga0068865_100210965 3300006881 Bacteria 1513
224 Ga0068865_100337974 3300006881 Bacteria 1216
225 Ga0068865_101290534 3300006881 Bacteria 649
226 Ga0075436_100000233 3300006914 Bacteria 34841
227 Ga0075436_100006348 3300006914 Bacteria 8100
228 Ga0075436_100021857 3300006914 Bacteria 4392
229 Ga0075436_100028943 3300006914 Bacteria 3811
230 Ga0075436_100029792 3300006914 Bacteria 3753
231 Ga0075436_100117907 3300006914 Bacteria 1856
232 Ga0075436_100697747 3300006914 Unclassified 752
233 Ga0097620_100004413 3300006931 Bacteria 14352
234 Ga0097620_100037442 3300006931 Bacteria 4868
235 Ga0097620_100110791 3300006931 Bacteria 2807
236 Ga0097620_100139860 3300006931 Unclassified 2494
237 Ga0097620_100361086 3300006931 Bacteria 1547
238 Ga0097620_100828117 3300006931 Bacteria 1012
239 Ga0097620_101660241 3300006931 Bacteria 706
240 Ga0075435_100000220 3300007076 Bacteria 35137
241 Ga0075435_100002765 3300007076 Bacteria 11718
242 Ga0075435_100016194 3300007076 Bacteria 5619
243 Ga0075435_100021209 3300007076 Bacteria 4993
244 Ga0075435_100026406 3300007076 Unclassified 4530
245 Ga0075435_100298903 3300007076 Bacteria 1377
246 Ga0075435_100347327 3300007076 Bacteria 1271
247 Ga0075435_100528562 3300007076 Bacteria 1021
248 Ga0075435_101118762 3300007076 Bacteria 689
249 Ga0075435_101341200 3300007076 Unclassified 627
250 Ga0075435_102030348 3300007076 Unclassified 505
251 Ga0099794_10263078 3300007265 Bacteria 890
252 Ga0105240_10062935 3300009093 Bacteria 4618
253 Ga0105240_10085699 3300009093 Bacteria 3859
254 Ga0105240_10216820 3300009093 Unclassified 2232
255 Ga0111539_10000009 3300009094 Bacteria 375223
256 Ga0111539_10093939 3300009094 Bacteria 3523
257 Ga0111539_10184065 3300009094 Bacteria 2440
258 Ga0111539_10596571 3300009094 Bacteria 1286
259 Ga0111539_10747835 3300009094 Unclassified 1138
260 Ga0111539_11104190 3300009094 Unclassified 922
261 Ga0105245_10006254 3300009098 Bacteria 10476
262 Ga0105245_10010096 3300009098 Bacteria 8225
263 Ga0105245_10122846 3300009098 Unclassified 2427
264 Ga0105245_10230764 3300009098 Bacteria 1790
265 Ga0105245_11210980 3300009098 Unclassified 803
266 Ga0105245_11417869 3300009098 Bacteria 745
267 Ga0105247_10011056 3300009101 Bacteria 5446
268 Ga0105247_11351083 3300009101 Unclassified 574
269 Ga0114129_10004706 3300009147 Bacteria 19261
270 Ga0114129_10007723 3300009147 Bacteria 15300
271 Ga0114129_10009392 3300009147 Bacteria 13941
272 Ga0114129_10015041 3300009147 Bacteria 11017
273 Ga0114129_10015597 3300009147 Bacteria 10804
274 Ga0114129_10034764 3300009147 Bacteria 7119
275 Ga0114129_10043922 3300009147 Bacteria 6287
276 Ga0114129_10048650 3300009147 Bacteria 5958
277 Ga0114129_10059158 3300009147 Bacteria 5358
278 Ga0114129_10195958 3300009147 Bacteria 2739
279 Ga0114129_10407884 3300009147 Bacteria 1790
280 Ga0114129_10541827 3300009147 Bacteria 1514
281 Ga0114129_10668027 3300009147 Bacteria 1339
282 Ga0114129_11386554 3300009147 Bacteria 868
283 Ga0105243_10008653 3300009148 Bacteria 7807
284 Ga0105243_10191534 3300009148 Bacteria 1786
285 Ga0105243_10372456 3300009148 Bacteria 1318
286 Ga0105243_10487293 3300009148 Bacteria 1165
287 Ga0105243_10747343 3300009148 Unclassified 958
288 Ga0105243_11329237 3300009148 Bacteria 737
289 Ga0105243_11398444 3300009148 Bacteria 720
290 Ga0105243_12322397 3300009148 Bacteria 574
291 Ga0105241_10040605 3300009174 Bacteria 3513
292 Ga0105241_10661645 3300009174 Unclassified 950
293 Ga0105242_10014004 3300009176 Bacteria 6206
294 Ga0105242_10057921 3300009176 Bacteria 3174
295 Ga0105242_10143979 3300009176 Bacteria 2071
296 Ga0105242_10236770 3300009176 Bacteria 1639
297 Ga0105242_10972295 3300009176 Unclassified 855
298 Ga0105242_11233705 3300009176 Unclassified 768
299 Ga0105242_11271527 3300009176 Bacteria 758
300 Ga0105248_10001520 3300009177 Bacteria 25812
301 Ga0105248_10079497 3300009177 Bacteria 3686
302 Ga0105248_10084319 3300009177 Bacteria 3574
303 Ga0105248_10088785 3300009177 Bacteria 3479
304 Ga0105248_10163207 3300009177 Unclassified 2512
305 Ga0105248_10477785 3300009177 Bacteria 1405
306 Ga0105248_10733657 3300009177 Unclassified 1115
307 Ga0105248_10966032 3300009177 Bacteria 962
308 Ga0105248_11542307 3300009177 Bacteria 752
309 Ga0105237_10272351 3300009545 Bacteria 1696
310 Ga0105237_10833675 3300009545 Bacteria 929
311 Ga0105238_10038628 3300009551 Bacteria 4847
312 Ga0105249_10150964 3300009553 Unclassified 2237
313 Ga0105249_10199644 3300009553 Bacteria 1957
314 Ga0105249_10449673 3300009553 Bacteria 1327
315 Ga0105249_10685088 3300009553 Bacteria 1084
316 Ga0105239_11104557 3300010375 Bacteria 913
317 Ga0105239_11302357 3300010375 Unclassified 838
318 Ga0105239_11347253 3300010375 Bacteria 823
319 Ga0105246_11272292 3300011119 Bacteria 680
320 Ga0157369_11215275 3300013105 Bacteria 769
321 Ga0157374_10103311 3300013296 Bacteria 2734
322 Ga0157374_12029313 3300013296 Unclassified 601
323 Ga0157378_10167637 3300013297 Unclassified 2058
324 Ga0157378_10301949 3300013297 Bacteria 1550
325 Ga0157378_10392125 3300013297 Unclassified 1366
326 Ga0157378_10704411 3300013297 Unclassified 1029
327 Ga0163162_10105974 3300013306 Bacteria 2906
328 Ga0163162_10227342 3300013306 Unclassified 1996
329 Ga0163162_10600550 3300013306 Bacteria 1227
330 Ga0157372_10634619 3300013307 Bacteria 1244
331 Ga0157375_10099977 3300013308 Bacteria 2980
332 Ga0157375_10108935 3300013308 Bacteria 2865
333 Ga0157375_11287801 3300013308 Bacteria 859
334 Ga0163163_10002362 3300014325 Bacteria 15969
335 Ga0163163_10076945 3300014325 Bacteria 3332
336 Ga0163163_10271672 3300014325 Unclassified 1746
337 Ga0163163_11331606 3300014325 Unclassified 780
338 Ga0157380_10085607 3300014326 Unclassified 2587
339 Ga0157380_10088492 3300014326 Bacteria 2548
340 Ga0157380_10174194 3300014326 Bacteria 1883
341 Ga0157380_10454279 3300014326 Bacteria 1231
342 Ga0157380_10458400 3300014326 Bacteria 1226
343 Ga0157380_11039878 3300014326 Unclassified 855
344 Ga0157380_12498293 3300014326 Unclassified 582
345 Ga0157377_11027803 3300014745 Bacteria 626
346 Ga0157377_11178686 3300014745 Unclassified 592
347 Ga0157379_10008466 3300014968 Bacteria 8947
348 Ga0157379_10100607 3300014968 Bacteria 2595
349 Ga0157379_10351832 3300014968 Bacteria 1349
350 Ga0157379_10770349 3300014968 Bacteria 907
351 Ga0157379_11587829 3300014968 Unclassified 638
352 Ga0157376_10003000 3300014969 Bacteria 11581
353 Ga0157376_10005627 3300014969 Bacteria 8769
354 Ga0157376_10033464 3300014969 Bacteria 4139
355 Ga0157376_10112853 3300014969 Bacteria 2395
356 Ga0157376_10253384 3300014969 Bacteria 1645
357 Ga0157376_10527194 3300014969 Bacteria 1165
358 Ga0157376_12036715 3300014969 Unclassified 612
359 Ga0163161_10276673 3300017792 Unclassified 1315
360 Ga0163161_10691982 3300017792 Bacteria 848
361 Ga0206350_10238524 3300020080 Bacteria 539
362 Ga0207697_10183827 3300025315 Bacteria 917
363 Ga0207682_10062740 3300025893 Bacteria 1559
364 Ga0207642_10016420 3300025899 Bacteria 2788
365 Ga0207642_11062646 3300025899 Unclassified 523
366 Ga0207710_10242787 3300025900 Bacteria 899
367 Ga0207688_10028547 3300025901 Unclassified 3069
368 Ga0207680_10012053 3300025903 Bacteria 4393
369 Ga0207680_10016138 3300025903 Bacteria 3914
370 Ga0207680_10052673 3300025903 Bacteria 2440
371 Ga0207680_10126668 3300025903 Unclassified 1677
372 Ga0207685_10665649 3300025905 Unclassified 564
373 Ga0207699_10261803 3300025906 Bacteria 1196
374 Ga0207645_10058984 3300025907 Bacteria 2451
375 Ga0207645_10181749 3300025907 Unclassified 1380
376 Ga0207645_10340146 3300025907 Unclassified 1003
377 Ga0207645_10513293 3300025907 Unclassified 812
378 Ga0207645_10904731 3300025907 Unclassified 599
379 Ga0207684_10245858 3300025910 Bacteria 1544
380 Ga0207684_10770727 3300025910 Bacteria 814
381 Ga0207684_10889375 3300025910 Bacteria 749
382 Ga0207684_11035191 3300025910 Bacteria 685
383 Ga0207654_10083693 3300025911 Bacteria 1927
384 Ga0207654_10315895 3300025911 Bacteria 1066
385 Ga0207707_10096365 3300025912 Bacteria 2585
386 Ga0207707_10365421 3300025912 Bacteria 1242
387 Ga0207707_10561086 3300025912 Bacteria 969
388 Ga0207695_10057917 3300025913 Bacteria 4024
389 Ga0207695_10140240 3300025913 Bacteria 2366
390 Ga0207695_10149476 3300025913 Bacteria 2276
391 Ga0207695_10193738 3300025913 Bacteria 1949
392 Ga0207671_10213152 3300025914 Bacteria 1511
393 Ga0207671_10816727 3300025914 Bacteria 739
394 Ga0207671_10929289 3300025914 Unclassified 687
395 Ga0207660_11012960 3300025917 Bacteria 677
396 Ga0207662_10063755 3300025918 Bacteria 2216
397 Ga0207662_10420177 3300025918 Unclassified 910
398 Ga0207657_10013707 3300025919 Bacteria 7938
399 Ga0207649_10512829 3300025920 Bacteria 913
400 Ga0207652_10067785 3300025921 Bacteria 3095
401 Ga0207652_11130648 3300025921 Bacteria 684
402 Ga0207646_10139140 3300025922 Bacteria 2186
403 Ga0207646_10382851 3300025922 Bacteria 1271
404 Ga0207646_10405508 3300025922 Bacteria 1231
405 Ga0207646_10451982 3300025922 Bacteria 1159
406 Ga0207681_10105502 3300025923 Unclassified 2040
407 Ga0207681_10899938 3300025923 Bacteria 741
408 Ga0207681_10945128 3300025923 Unclassified 723
409 Ga0207694_10967337 3300025924 Unclassified 720
410 Ga0207650_10086397 3300025925 Bacteria 2388
411 Ga0207650_10311367 3300025925 Bacteria 1288
412 Ga0207650_10333950 3300025925 Bacteria 1243
413 Ga0207687_10005610 3300025927 Bacteria 8294
414 Ga0207687_10016516 3300025927 Bacteria 4848
415 Ga0207687_10111812 3300025927 Bacteria 2028
416 Ga0207687_10973222 3300025927 Unclassified 727
417 Ga0207687_11135110 3300025927 Unclassified 671
418 Ga0207700_10221376 3300025928 Unclassified 1604
419 Ga0207664_10040462 3300025929 Bacteria 3625
420 Ga0207644_10079652 3300025931 Bacteria 2417
421 Ga0207644_10106453 3300025931 Bacteria 2114
422 Ga0207644_10685610 3300025931 Unclassified 854
423 Ga0207690_10065447 3300025932 Bacteria 2486
424 Ga0207690_10606998 3300025932 Unclassified 894
425 Ga0207706_10026485 3300025933 Bacteria 5190
426 Ga0207706_10378085 3300025933 Bacteria 1229
427 Ga0207706_10396369 3300025933 Bacteria 1197
428 Ga0207706_10457836 3300025933 Unclassified 1103
429 Ga0207706_10841678 3300025933 Bacteria 777
430 Ga0207686_10003728 3300025934 Bacteria 8173
431 Ga0207686_10011750 3300025934 Bacteria 4802
432 Ga0207686_10053537 3300025934 Bacteria 2523
433 Ga0207686_10103642 3300025934 Bacteria 1904
434 Ga0207686_10126340 3300025934 Bacteria 1748
435 Ga0207686_10332392 3300025934 Bacteria 1139
436 Ga0207709_10202294 3300025935 Bacteria 1419
437 Ga0207709_10367943 3300025935 Bacteria 1090
438 Ga0207709_11641727 3300025935 Unclassified 534
439 Ga0207670_10180642 3300025936 Bacteria 1589
440 Ga0207670_10254610 3300025936 Unclassified 1358
441 Ga0207670_10276812 3300025936 Bacteria 1306
442 Ga0207670_10327067 3300025936 Bacteria 1208
443 Ga0207669_10171538 3300025937 Bacteria 1544
444 Ga0207669_10293830 3300025937 Bacteria 1232
445 Ga0207704_10047507 3300025938 Bacteria 2566
446 Ga0207704_10400270 3300025938 Bacteria 1083
447 Ga0207691_10045665 3300025940 Bacteria 4026
448 Ga0207691_10103221 3300025940 Bacteria 2542
449 Ga0207691_10138534 3300025940 Bacteria 2145
450 Ga0207711_10009258 3300025941 Bacteria 8223
451 Ga0207711_10010569 3300025941 Bacteria 7672
452 Ga0207711_10360775 3300025941 Unclassified 1346
453 Ga0207711_10511947 3300025941 Bacteria 1119
454 Ga0207711_10738736 3300025941 Bacteria 918
455 Ga0207711_11304305 3300025941 Bacteria 668
456 Ga0207711_11307495 3300025941 Bacteria 667
457 Ga0207689_10430139 3300025942 Bacteria 1102
458 Ga0207661_10011981 3300025944 Bacteria 6299
459 Ga0207661_10657478 3300025944 Unclassified 963
460 Ga0207679_10246854 3300025945 Bacteria 1515
461 Ga0207679_10251685 3300025945 Unclassified 1502
462 Ga0207679_10251814 3300025945 Bacteria 1502
463 Ga0207679_10311421 3300025945 Unclassified 1360
464 Ga0207667_10870105 3300025949 Unclassified 894
465 Ga0207651_10100180 3300025960 Bacteria 2148
466 Ga0207651_10134178 3300025960 Bacteria 1901
467 Ga0207651_10244351 3300025960 Bacteria 1465
468 Ga0207651_10872576 3300025960 Unclassified 800
469 Ga0207712_10043645 3300025961 Bacteria 3094
470 Ga0207712_10044811 3300025961 Bacteria 3060
471 Ga0207712_10430682 3300025961 Bacteria 1115
472 Ga0207668_10019746 3300025972 Bacteria 4267
473 Ga0207668_10053905 3300025972 Bacteria 2789
474 Ga0207640_10004967 3300025981 Bacteria 7232
475 Ga0207640_11167871 3300025981 Unclassified 683
476 Ga0207658_10065949 3300025986 Bacteria 2721
477 Ga0207658_10283542 3300025986 Unclassified 1421
478 Ga0207658_10340326 3300025986 Bacteria 1304
479 Ga0207658_10571963 3300025986 Bacteria 1013
480 Ga0207677_10060548 3300026023 Bacteria 2617
481 Ga0207677_10306272 3300026023 Bacteria 1314
482 Ga0207677_10360054 3300026023 Bacteria 1222
483 Ga0207677_10744258 3300026023 Bacteria 873
484 Ga0207677_11195218 3300026023 Unclassified 696
485 Ga0207703_10071163 3300026035 Bacteria 2872
486 Ga0207703_10442094 3300026035 Unclassified 1213
487 Ga0207703_10531658 3300026035 Bacteria 1107
488 Ga0207703_11051856 3300026035 Unclassified 781
489 Ga0207639_11379445 3300026041 Bacteria 661
490 Ga0207708_10032003 3300026075 Bacteria 3993
491 Ga0207708_10337514 3300026075 Bacteria 1233
492 Ga0207708_10538345 3300026075 Unclassified 983
493 Ga0207708_10691169 3300026075 Unclassified 871
494 Ga0207708_10714530 3300026075 Bacteria 857
495 Ga0207641_10000409 3300026088 Bacteria 50240
496 Ga0207641_10223522 3300026088 Bacteria 1747
497 Ga0207641_10998164 3300026088 Bacteria 834
498 Ga0207648_10016299 3300026089 Bacteria 6794
499 Ga0207648_10231522 3300026089 Bacteria 1643
500 Ga0207648_10677017 3300026089 Bacteria 955
501 Ga0207648_11068992 3300026089 Bacteria 756
502 Ga0207676_10022651 3300026095 Bacteria 4621
503 Ga0207676_11120418 3300026095 Unclassified 778
504 Ga0207674_10087223 3300026116 Bacteria 3115
505 Ga0207674_10274214 3300026116 Bacteria 1634
506 Ga0207675_100044993 3300026118 Bacteria 4124
507 Ga0207675_100102955 3300026118 Bacteria 2690
508 Ga0207675_100541528 3300026118 Bacteria 1162
509 Ga0207675_100658214 3300026118 Bacteria 1054
510 Ga0207675_100661992 3300026118 Bacteria 1051
511 Ga0207675_100874014 3300026118 Bacteria 914
512 Ga0207675_100960003 3300026118 Bacteria 872
513 Ga0207675_101493076 3300026118 Bacteria 697
514 Ga0207683_10028853 3300026121 Bacteria 4801
515 Ga0207683_10090290 3300026121 Bacteria 2728
516 Ga0207683_10371555 3300026121 Unclassified 1314
517 Ga0207683_10931314 3300026121 Bacteria 807
518 Ga0207698_10361555 3300026142 Unclassified 1375
519 Ga0207698_11287098 3300026142 Bacteria 746
520 Ga0207428_10000022 3300027907 Bacteria 273333
521 Ga0207428_10043263 3300027907 Unclassified 3638
522 Ga0268266_10032844 3300028379 Bacteria 4410
523 Ga0268266_10033346 3300028379 Bacteria 4377
524 Ga0268266_10048341 3300028379 Bacteria 3646
525 Ga0268266_11495191 3300028379 Unclassified 651
526 Ga0268265_10045567 3300028380 Unclassified 3273
527 Ga0268265_10458438 3300028380 Unclassified 1192
528 Ga0268265_10780022 3300028380 Unclassified 930
529 Ga0268265_10961418 3300028380 Bacteria 842
530 Ga0268265_11011319 3300028380 Unclassified 821
531 Ga0268264_10175281 3300028381 Bacteria 1943
532 Ga0268264_10217406 3300028381 Bacteria 1758
533 Ga0268264_10689980 3300028381 Unclassified 1013
534 Ga0268264_10753744 3300028381 Bacteria 970
535 Ga0268264_10903078 3300028381 Unclassified 887
536 Ga0268264_11254498 3300028381 Bacteria 751
537 Ga0265314_10108617 3300031711 Bacteria 1767
538 Ga0373930_0011012 3300034816 Bacteria 1626
539 Ga0373948_0000440 3300034817 Bacteria 5140
540 Ga0373950_0000944 3300034818 Unclassified 3678
541 Ga0373958_0001739 3300034819 Bacteria 2958
542 Ga0373958_0059256 3300034819 Bacteria 826
543 Ga0373959_0002963 3300034820 Bacteria 2696
544 Ga0373938_0000829 3300034957 Bacteria 4994
545 Ga0373938_0093415 3300034957 Unclassified 747
546 Ga0373929_0001288 3300035085 Bacteria 4844
547 Ga0373934_0053214 3300035086 Bacteria 1606
548 Ga0373934_0371962 3300035086 Unclassified 596
549 Ga0373940_0001530 3300035088 Bacteria 4218
550 Ga0373940_0165575 3300035088 Unclassified 712
551 Ga0373949_0001914 3300035090 Bacteria 5623
552 Ga0373951_0007763 3300035091 Unclassified 2434
553 Ga0373952_0008447 3300035092 Bacteria 1955
554 Ga0373932_0001883 3300035112 Bacteria 5607
555 Ga0373939_0004389 3300035114 Bacteria 3332
556 Ga0373941_0000682 3300035115 Bacteria 6907
557 Ga0373945_0025158 3300035116 Unclassified 2067
558 Ga0373945_0154212 3300035116 Bacteria 933
559 Ga0373957_0130457 3300035120 Unclassified 1023
560 Ga0373960_0001092 3300035121 Bacteria 5874
561 Ga0373943_0402001 3300035170 Bacteria 791
562 Ga0373946_0039785 3300035171 Unclassified 1921
563 Ga0373955_0155423 3300035172 Bacteria 1347
564 Ga0373955_0164196 3300035172 Bacteria 1312
565 Ga0373942_0002521 3300035207 Bacteria 4434
566 Ga0373961_0002143 3300035241 Bacteria 5237
567 Ga0373962_0001173 3300035242 Bacteria 6127
568 Ga0373962_0049677 3300035242 Bacteria 1206
569 Ga0373962_0088519 3300035242 Unclassified 950
570 Ga0373931_0004099 3300035691 Bacteria 6611
571 Ga0373931_0304200 3300035691 Bacteria 986
572 Ga0373931_0468274 3300035691 Unclassified 808
573 Ga0373935_1275824 3300035692 Unclassified 548
574 Ga0373927_0252943 3300035695 Bacteria 1158
575 Ga0373933_0212880 3300035724 Bacteria 1239
576 Ga0373933_0585883 3300035724 Bacteria 732
577 Ga0373937_0078586 3300036401 Bacteria 3049
578 Ga0373937_0079910 3300036401 Bacteria 3023
579 Ga0373937_0624090 3300036401 Bacteria 1023
580 Ga0373925_0462159 3300037068 Unclassified 1040
581 Ga0373925_1533968 3300037068 Unclassified 545
582 Ga0436365_0560402 3300039437 Bacteria 2893
583 Ga0466963_0013024 3300044694 Bacteria 5098
584 Ga0451576_0024123 3300045051 Bacteria 6571
585 Ga0451576_0296635 3300045051 Bacteria 1690
586 Ga0451576_1030893 3300045051 Unclassified 862
587 Ga0466958_0815828 3300045836 Bacteria 608
588 Ga0495603_0385882 3300046455 Unclassified 803
589 Ga0495651_0442437 3300046462 Bacteria 841
590 Ga0495653_0638420 3300046463 Unclassified 651
591 Ga0495582_0207423 3300046473 Unclassified 1120
592 Ga0495664_0456919 3300046477 Unclassified 765
593 Ga0495585_0407659 3300046492 Bacteria 654
594 Ga0495628_0123131 3300046516 Bacteria 1988
595 Ga0495628_0261459 3300046516 Unclassified 1290
596 Ga0495642_0047484 3300046528 Unclassified 1759
597 Ga0495652_0280352 3300046529 Bacteria 1221
598 Ga0495640_0066661 3300046533 Bacteria 2428
599 Ga0495640_0165846 3300046533 Bacteria 1413
600 Ga0495598_0112521 3300046537 Bacteria 914
601 Ga0495667_0448398 3300046559 Bacteria 811
602 Ga0495656_0354468 3300046615 Unclassified 761
603 Ga0495635_0361741 3300046663 Unclassified 967
604 Ga0495659_0044209 3300046664 Bacteria 1601
605 Ga0495647_0010795 3300046681 Bacteria 3119
606 Ga0495658_0068189 3300046683 Bacteria 2059
607 Ga0495658_0265983 3300046683 Viruses 1080
608 Ga0495658_0278542 3300046683 Unclassified 1055
609 Ga0495658_0580589 3300046683 Unclassified 718
610 Ga0495669_0078873 3300046684 Unclassified 1509
611 Ga0495669_0262984 3300046684 Unclassified 829
612 Ga0495600_0149796 3300046809 Bacteria 1511
613 Ga0495604_0143892 3300047317 Bacteria 1701
614 Ga0495674_0672013 3300047319 Bacteria 815
615 Ga0495674_0974245 3300047319 Unclassified 651
616 Ga0496100_0000944 3300048903 Bacteria 13902
617 Ga0496100_0436842 3300048903 Unclassified 1002
618 Ga0496100_0676023 3300048903 Bacteria 805
619 Ga0496100_0724089 3300048903 Unclassified 777
620 Ga0496101_0001899 3300048904 Bacteria 12622
621 Ga0496101_0144681 3300048904 Bacteria 1815
622 Ga0496101_0646701 3300048904 Unclassified 835
623 Ga0496102_0506596 3300048905 Bacteria 1129
624 Ga0496102_1302553 3300048905 Unclassified 646
625 Ga0496103_0270038 3300048906 Bacteria 1094
626 Ga0496103_0857183 3300048906 Bacteria 571
627 Ga0496104_0132771 3300048907 Bacteria 2392
628 Ga0496104_0279070 3300048907 Bacteria 1584
629 Ga0496104_0298908 3300048907 Unclassified 1522
630 Ga0496104_1100407 3300048907 Bacteria 698
631 Ga0496104_1126867 3300048907 Unclassified 688
632 Ga0496105_0021862 3300048908 Bacteria 5178
633 Ga0496105_0255395 3300048908 Bacteria 1419
634 Ga0496105_0369823 3300048908 Bacteria 1142
635 Ga0496106_0079923 3300048909 Bacteria 2511
636 Ga0496106_0120690 3300048909 Bacteria 2049
637 Ga0496107_0195217 3300048910 Bacteria 1504
638 Ga0496107_0214035 3300048910 Bacteria 1433
639 Ga0496108_0012961 3300048911 Bacteria 6792
640 Ga0496108_0559543 3300048911 Bacteria 997
641 Ga0496108_0618193 3300048911 Bacteria 943
642 Ga0496109_0241984 3300048912 Bacteria 1698
643 Ga0496109_0619944 3300048912 Bacteria 1018
644 Ga0496110_0100033 3300048913 Bacteria 2599
645 Ga0496110_0183516 3300048913 Unclassified 1900
646 Ga0496111_0656292 3300048914 Bacteria 765
647 Ga0496112_0049109 3300048915 Bacteria 4135
648 Ga0496112_0263438 3300048915 Bacteria 1673
649 Ga0496112_1201335 3300048915 Unclassified 675
650 Ga0496113_0027293 3300048916 Bacteria 4092
651 Ga0496114_0020828 3300048917 Bacteria 5324
652 Ga0496114_0138992 3300048917 Bacteria 2102
653 Ga0496114_0690913 3300048917 Unclassified 895
654 Ga0496115_0038754 3300048918 Bacteria 3783
655 Ga0501036_0903194 3300049572 Bacteria 725
656 Ga0501039_0181342 3300049575 Unclassified 1656
657 Ga0501072_0998305 3300049588 Bacteria 652
658 Ga0501076_0263985 3300049592 Bacteria 1410
659 nmdc:mga05p37_11396_c1 3300050507 Bacteria 10581
660 nmdc:mga05p37_14016_c1 3300050507 Bacteria 9615
661 nmdc:mga05p37_172089_c1 3300050507 Bacteria 2641
662 nmdc:mga05p37_17354_c1 3300050507 Bacteria 8684
663 nmdc:mga05p37_226164_c1 3300050507 Bacteria 2256
664 nmdc:mga05p37_24324_c1 3300050507 Bacteria 7360
665 nmdc:mga05p37_277160_c1 3300050507 Bacteria 2002
666 nmdc:mga05p37_296117_c1 3300050507 Unclassified 1924
667 nmdc:mga05p37_511413_c1 3300050507 Bacteria 1376
668 nmdc:mga05p37_70327_c1 3300050507 Bacteria 4304
669 nmdc:mga05p37_780222_c1 3300050507 Bacteria 1049
670 nmdc:mga09592_21615_c2 3300050508 Bacteria 3254
671 nmdc:mga09592_493833_c1 3300050508 Bacteria 1054
672 nmdc:mga09592_933250_c1 3300050508 Unclassified 728
673 nmdc:mga06r32_118024_c1 3300050510 Bacteria 2615
674 nmdc:mga06r32_238483_c1 3300050510 Bacteria 1806
675 nmdc:mga06r32_63954_c1 3300050510 Unclassified 3547
676 nmdc:mga08y16_1274313_c1 3300050511 Bacteria 703
677 nmdc:mga08y16_18129_c1 3300050511 Bacteria 7416
678 nmdc:mga08y16_1978066_c1 3300050511 Bacteria 532
679 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
680 nmdc:mga08y16_340131_c1 3300050511 Bacteria 1543
681 nmdc:mga08y16_37358_c1 3300050511 Bacteria 5101
682 nmdc:mga08y16_716563_c1 3300050511 Bacteria 999
683 nmdc:mga0n895_10_c1 3300050512 Bacteria 115544
684 nmdc:mga0n895_174577_c1 3300050512 Bacteria 2180
685 nmdc:mga0n895_254453_c1 3300050512 Bacteria 1782
686 nmdc:mga0n895_372908_c1 3300050512 Bacteria 1444
687 nmdc:mga0n895_38575_c1 3300050512 Unclassified 4630
688 nmdc:mga0n895_39426_c1 3300050512 Bacteria 4583
689 nmdc:mga0n895_439219_c1 3300050512 Bacteria 1318
690 nmdc:mga0n895_476758_c1 3300050512 Unclassified 1259
691 nmdc:mga0n895_499117_c1 3300050512 Bacteria 1226
692 nmdc:mga0n895_549338_c1 3300050512 Bacteria 1161
693 nmdc:mga0rr50_103167_c1 3300050513 Bacteria 2244
694 nmdc:mga0rr50_124049_c1 3300050513 Unclassified 2060
695 nmdc:mga0rr50_137975_c1 3300050513 Bacteria 1959
696 nmdc:mga0rr50_1670720_c1 3300050513 Unclassified 537
697 nmdc:mga0rr50_1933_c1 3300050513 Bacteria 11522
698 nmdc:mga0rr50_20_c1 3300050513 Bacteria 140799
699 nmdc:mga0rr50_240957_c1 3300050513 Bacteria 1499
700 nmdc:mga0rr50_299275_c1 3300050513 Bacteria 1345
701 nmdc:mga0rr50_60767_c1 3300050513 Bacteria 2844
702 nmdc:mga08x19_121175_c1 3300050514 Bacteria 1754
703 nmdc:mga08x19_1236768_c1 3300050514 Unclassified 529
704 nmdc:mga08x19_155532_c1 3300050514 Bacteria 1550
705 nmdc:mga08x19_24787_c1 3300050514 Bacteria 3732
706 nmdc:mga08x19_319_c1 3300050514 Bacteria 34836
707 nmdc:mga08x19_38503_c1 3300050514 Unclassified 3038
708 nmdc:mga08x19_388156_c1 3300050514 Bacteria 978
709 nmdc:mga08x19_695905_c1 3300050514 Bacteria 721
710 nmdc:mga08x19_7727_c1 3300050514 Bacteria 6387
711 nmdc:mga0a205_16668_c1 3300050515 Bacteria 6881
712 nmdc:mga0a205_191661_c1 3300050515 Unclassified 1936
713 nmdc:mga0a205_652307_c1 3300050515 Unclassified 904
714 nmdc:mga0a205_825211_c1 3300050515 Unclassified 775
715 nmdc:mga0a205_87111_c1 3300050515 Bacteria 3017
716 Ga0495601_0138533 3300053077 Bacteria 1587
717 Ga0495601_0148880 3300053077 Bacteria 1528
718 Ga0495601_0279647 3300053077 Bacteria 1088
719 Ga0495601_0455427 3300053077 Unclassified 827
720 Ga0495612_0319906 3300053078 Bacteria 698
721 Ga0495595_0056068 3300053084 Unclassified 1836
722 Ga0495595_0076666 3300053084 Unclassified 1587
723 Ga0495595_0150828 3300053084 Bacteria 1144
724 Ga0495619_0010785 3300053085 Bacteria 5750
725 Ga0495619_0103811 3300053085 Unclassified 1937
726 Ga0500658_0300173 3300053134 Unclassified 738
727 Ga0501084_0185310 3300054114 Bacteria 1757
728 Ga0530510_0227236 3300061734 Unclassified 1388
729 Ga0530510_1219117 3300061734 Bacteria 577

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035092 Ga0373952_0008447 Ga0373952_0008447_14_448 129
2 3300007076 Ga0075435_102030348 Ga0075435_1020303481 134
3 3300025937 Ga0207669_10293830 Ga0207669_102938303 136
4 3300050511 nmdc:mga08y16_1978066_c1 nmdc:mga08y16_1978066_c1_11_478 136
5 3300006871 Ga0075434_101146006 Ga0075434_1011460061 138
6 3300005365 Ga0070688_100248469 Ga0070688_1002484692 139
7 3300005438 Ga0070701_10620954 Ga0070701_106209542 139
8 3300005546 Ga0070696_101215242 Ga0070696_1012152422 139
9 3300005578 Ga0068854_100159208 Ga0068854_1001592084 139
10 3300005578 Ga0068854_100355577 Ga0068854_1003555772 139
11 3300005617 Ga0068859_100110799 Ga0068859_1001107993 139
12 3300006844 Ga0075428_100935433 Ga0075428_1009354332 139
13 3300006846 Ga0075430_100825898 Ga0075430_1008258981 139
14 3300006852 Ga0075433_10429002 Ga0075433_104290022 139
15 3300006880 Ga0075429_100627333 Ga0075429_1006273332 139
16 3300006914 Ga0075436_100029792 Ga0075436_1000297922 139
17 3300006931 Ga0097620_100110791 Ga0097620_1001107914 139
18 3300025936 Ga0207670_10276812 Ga0207670_102768123 139
19 3300050514 nmdc:mga08x19_24787_c1 nmdc:mga08x19_24787_c1_18_524 139
20 3300014968 Ga0157379_10770349 Ga0157379_107703492 140
21 3300009147 Ga0114129_10015041 Ga0114129_1001504113 142
22 3300009545 Ga0105237_10833675 Ga0105237_108336752 142
23 3300050513 nmdc:mga0rr50_124049_c1 nmdc:mga0rr50_124049_c1_1571_2038 142
24 3300050514 nmdc:mga08x19_7727_c1 nmdc:mga08x19_7727_c1_2964_3431 142
25 3300050515 nmdc:mga0a205_16668_c1 nmdc:mga0a205_16668_c1_3757_4224 142
26 3300005535 Ga0070684_100502300 Ga0070684_1005023003 149
27 3300005536 Ga0070697_100674575 Ga0070697_1006745752 149
28 3300005546 Ga0070696_100657387 Ga0070696_1006573872 149
29 3300005563 Ga0068855_100285795 Ga0068855_1002857954 149
30 3300005578 Ga0068854_100205010 Ga0068854_1002050102 149
31 3300005614 Ga0068856_100041738 Ga0068856_1000417385 149
32 3300006871 Ga0075434_100541510 Ga0075434_1005415103 149
33 3300007076 Ga0075435_100021209 Ga0075435_1000212095 149
34 3300009093 Ga0105240_10216820 Ga0105240_102168204 149
35 3300009098 Ga0105245_10122846 Ga0105245_101228463 149
36 3300009176 Ga0105242_10972295 Ga0105242_109722952 149
37 3300009177 Ga0105248_10966032 Ga0105248_109660322 149
38 3300025905 Ga0207685_10665649 Ga0207685_106656491 149
39 3300025914 Ga0207671_10929289 Ga0207671_109292892 149
40 3300025934 Ga0207686_10332392 Ga0207686_103323923 149
41 3300025941 Ga0207711_10511947 Ga0207711_105119471 149
42 3300025941 Ga0207711_11304305 Ga0207711_113043051 149
43 3300025944 Ga0207661_10011981 Ga0207661_100119815 149
44 3300025949 Ga0207667_10870105 Ga0207667_108701052 149
45 3300025981 Ga0207640_11167871 Ga0207640_111678711 149
46 3300049572 Ga0501036_0903194 Ga0501036_0903194_176_640 149
47 3300049575 Ga0501039_0181342 Ga0501039_0181342_278_742 149
48 3300049588 Ga0501072_0998305 Ga0501072_0998305_92_556 149
49 3300049592 Ga0501076_0263985 Ga0501076_0263985_37_513 149
50 3300050512 nmdc:mga0n895_499117_c1 nmdc:mga0n895_499117_c1_182_652 149
51 3300050513 nmdc:mga0rr50_103167_c1 nmdc:mga0rr50_103167_c1_286_756 149
52 3300050514 nmdc:mga08x19_695905_c1 nmdc:mga08x19_695905_c1_234_701 149
53 3300054114 Ga0501084_0185310 Ga0501084_0185310_263_739 149
54 3300061734 Ga0530510_0227236 Ga0530510_0227236_44_508 149
55 3300005289 Ga0065704_10309473 Ga0065704_103094731 150
56 3300005293 Ga0065715_10008955 Ga0065715_100089554 150
57 3300005328 Ga0070676_10732885 Ga0070676_107328851 150
58 3300005330 Ga0070690_100689438 Ga0070690_1006894382 150
59 3300005331 Ga0070670_100385630 Ga0070670_1003856302 150
60 3300005334 Ga0068869_100663065 Ga0068869_1006630652 150
61 3300005335 Ga0070666_10020939 Ga0070666_100209397 150
62 3300005335 Ga0070666_10200812 Ga0070666_102008122 150
63 3300005336 Ga0070680_101038433 Ga0070680_1010384331 150
64 3300005338 Ga0068868_100016138 Ga0068868_1000161386 150
65 3300005338 Ga0068868_100029482 Ga0068868_1000294824 150
66 3300005338 Ga0068868_100786000 Ga0068868_1007860001 150
67 3300005340 Ga0070689_100152789 Ga0070689_1001527891 150
68 3300005347 Ga0070668_100145233 Ga0070668_1001452333 150
69 3300005353 Ga0070669_100008803 Ga0070669_1000088039 150
70 3300005353 Ga0070669_100069820 Ga0070669_1000698203 150
71 3300005354 Ga0070675_100153447 Ga0070675_1001534473 150
72 3300005355 Ga0070671_100022694 Ga0070671_1000226942 150
73 3300005355 Ga0070671_100393607 Ga0070671_1003936071 150
74 3300005355 Ga0070671_100942501 Ga0070671_1009425011 150
75 3300005356 Ga0070674_100108568 Ga0070674_1001085684 150
76 3300005356 Ga0070674_100150230 Ga0070674_1001502302 150
77 3300005356 Ga0070674_100271766 Ga0070674_1002717662 150
78 3300005364 Ga0070673_100314915 Ga0070673_1003149151 150
79 3300005364 Ga0070673_100374824 Ga0070673_1003748243 150
80 3300005364 Ga0070673_100565925 Ga0070673_1005659253 150
81 3300005365 Ga0070688_100105316 Ga0070688_1001053163 150
82 3300005367 Ga0070667_100038020 Ga0070667_1000380203 150
83 3300005367 Ga0070667_100360609 Ga0070667_1003606092 150
84 3300005438 Ga0070701_10305087 Ga0070701_103050871 150
85 3300005438 Ga0070701_10403681 Ga0070701_104036811 150
86 3300005440 Ga0070705_100510647 Ga0070705_1005106471 150
87 3300005441 Ga0070700_100194041 Ga0070700_1001940414 150
88 3300005444 Ga0070694_100018134 Ga0070694_1000181345 150
89 3300005444 Ga0070694_100106599 Ga0070694_1001065993 150
90 3300005445 Ga0070708_100036911 Ga0070708_1000369113 150
91 3300005445 Ga0070708_100642728 Ga0070708_1006427282 150
92 3300005456 Ga0070678_100173014 Ga0070678_1001730142 150
93 3300005456 Ga0070678_100357755 Ga0070678_1003577553 150
94 3300005457 Ga0070662_100456949 Ga0070662_1004569492 150
95 3300005458 Ga0070681_10834860 Ga0070681_108348602 150
96 3300005459 Ga0068867_100250438 Ga0068867_1002504382 150
97 3300005459 Ga0068867_100625023 Ga0068867_1006250232 150
98 3300005467 Ga0070706_100826941 Ga0070706_1008269412 150
99 3300005467 Ga0070706_100987075 Ga0070706_1009870751 150
100 3300005468 Ga0070707_100102237 Ga0070707_1001022375 150
101 3300005468 Ga0070707_100106459 Ga0070707_1001064594 150
102 3300005468 Ga0070707_100413052 Ga0070707_1004130523 150
103 3300005468 Ga0070707_101706518 Ga0070707_1017065181 150
104 3300005471 Ga0070698_100056676 Ga0070698_1000566764 150
105 3300005518 Ga0070699_100014967 Ga0070699_1000149671 150
106 3300005518 Ga0070699_100074390 Ga0070699_1000743903 150
107 3300005518 Ga0070699_100081960 Ga0070699_1000819604 150
108 3300005536 Ga0070697_100764836 Ga0070697_1007648362 150
109 3300005543 Ga0070672_100002128 Ga0070672_10000212811 150
110 3300005543 Ga0070672_100147334 Ga0070672_1001473343 150
111 3300005544 Ga0070686_100070078 Ga0070686_1000700784 150
112 3300005544 Ga0070686_100093777 Ga0070686_1000937771 150
113 3300005544 Ga0070686_100187636 Ga0070686_1001876363 150
114 3300005545 Ga0070695_100006549 Ga0070695_1000065496 150
115 3300005546 Ga0070696_100085226 Ga0070696_1000852264 150
116 3300005546 Ga0070696_100156796 Ga0070696_1001567963 150
117 3300005546 Ga0070696_100168474 Ga0070696_1001684742 150
118 3300005547 Ga0070693_100217419 Ga0070693_1002174191 150
119 3300005548 Ga0070665_100014048 Ga0070665_1000140487 150
120 3300005548 Ga0070665_100022599 Ga0070665_1000225994 150
121 3300005549 Ga0070704_100029626 Ga0070704_1000296263 150
122 3300005549 Ga0070704_100861213 Ga0070704_1008612131 150
123 3300005563 Ga0068855_100292620 Ga0068855_1002926202 150
124 3300005564 Ga0070664_100200107 Ga0070664_1002001073 150
125 3300005615 Ga0070702_100307945 Ga0070702_1003079451 150
126 3300005616 Ga0068852_100393989 Ga0068852_1003939892 150
127 3300005617 Ga0068859_100004413 Ga0068859_1000044133 150
128 3300005617 Ga0068859_100139856 Ga0068859_1001398564 150
129 3300005617 Ga0068859_100828231 Ga0068859_1008282312 150
130 3300005718 Ga0068866_10025138 Ga0068866_100251383 150
131 3300005718 Ga0068866_11255111 Ga0068866_112551111 150
132 3300005719 Ga0068861_100012934 Ga0068861_1000129343 150
133 3300005719 Ga0068861_100072744 Ga0068861_1000727444 150
134 3300005719 Ga0068861_100142405 Ga0068861_1001424052 150
135 3300005719 Ga0068861_100703915 Ga0068861_1007039152 150
136 3300005840 Ga0068870_10293112 Ga0068870_102931123 150
137 3300005841 Ga0068863_101894779 Ga0068863_1018947791 150
138 3300005842 Ga0068858_100012051 Ga0068858_1000120518 150
139 3300005842 Ga0068858_100071308 Ga0068858_1000713084 150
140 3300005842 Ga0068858_100409361 Ga0068858_1004093613 150
141 3300005843 Ga0068860_100069823 Ga0068860_1000698235 150
142 3300005843 Ga0068860_100120363 Ga0068860_1001203633 150
143 3300005844 Ga0068862_100028651 Ga0068862_1000286516 150
144 3300005844 Ga0068862_100194662 Ga0068862_1001946623 150
145 3300005844 Ga0068862_101162696 Ga0068862_1011626962 150
146 3300006173 Ga0070716_100543294 Ga0070716_1005432942 150
147 3300006237 Ga0097621_100021404 Ga0097621_1000214044 150
148 3300006237 Ga0097621_100057424 Ga0097621_1000574244 150
149 3300006237 Ga0097621_100132474 Ga0097621_1001324743 150
150 3300006237 Ga0097621_100186678 Ga0097621_1001866783 150
151 3300006237 Ga0097621_100222990 Ga0097621_1002229903 150
152 3300006237 Ga0097621_100418628 Ga0097621_1004186283 150
153 3300006237 Ga0097621_100654898 Ga0097621_1006548981 150
154 3300006358 Ga0068871_100055205 Ga0068871_1000552053 150
155 3300006358 Ga0068871_100057193 Ga0068871_1000571933 150
156 3300006358 Ga0068871_100141055 Ga0068871_1001410554 150
157 3300006358 Ga0068871_100155946 Ga0068871_1001559464 150
158 3300006358 Ga0068871_100214812 Ga0068871_1002148123 150
159 3300006358 Ga0068871_100540775 Ga0068871_1005407752 150
160 3300006358 Ga0068871_101454766 Ga0068871_1014547661 150
161 3300006844 Ga0075428_100000007 Ga0075428_10000000786 150
162 3300006844 Ga0075428_100106189 Ga0075428_1001061895 150
163 3300006844 Ga0075428_100831261 Ga0075428_1008312611 150
164 3300006847 Ga0075431_100013395 Ga0075431_1000133957 150
165 3300006847 Ga0075431_100048384 Ga0075431_1000483841 150
166 3300006852 Ga0075433_10098369 Ga0075433_100983694 150
167 3300006852 Ga0075433_10180809 Ga0075433_101808093 150
168 3300006852 Ga0075433_10220526 Ga0075433_102205262 150
169 3300006852 Ga0075433_10869367 Ga0075433_108693672 150
170 3300006871 Ga0075434_100041050 Ga0075434_1000410504 150
171 3300006871 Ga0075434_100164745 Ga0075434_1001647453 150
172 3300006871 Ga0075434_101532064 Ga0075434_1015320641 150
173 3300006871 Ga0075434_101628579 Ga0075434_1016285791 150
174 3300006880 Ga0075429_100149587 Ga0075429_1001495872 150
175 3300006880 Ga0075429_100598858 Ga0075429_1005988582 150
176 3300006880 Ga0075429_100618383 Ga0075429_1006183832 150
177 3300006881 Ga0068865_100210965 Ga0068865_1002109652 150
178 3300006881 Ga0068865_100337974 Ga0068865_1003379742 150
179 3300006881 Ga0068865_101290534 Ga0068865_1012905342 150
180 3300006914 Ga0075436_100021857 Ga0075436_1000218572 150
181 3300006914 Ga0075436_100028943 Ga0075436_1000289434 150
182 3300006914 Ga0075436_100697747 Ga0075436_1006977471 150
183 3300006931 Ga0097620_100004413 Ga0097620_1000044133 150
184 3300006931 Ga0097620_100139860 Ga0097620_1001398604 150
185 3300006931 Ga0097620_100828117 Ga0097620_1008281172 150
186 3300007076 Ga0075435_100528562 Ga0075435_1005285622 150
187 3300007076 Ga0075435_101118762 Ga0075435_1011187622 150
188 3300009093 Ga0105240_10062935 Ga0105240_100629353 150
189 3300009094 Ga0111539_10000009 Ga0111539_1000000919 150
190 3300009094 Ga0111539_10093939 Ga0111539_100939393 150
191 3300009094 Ga0111539_10596571 Ga0111539_105965713 150
192 3300009094 Ga0111539_10747835 Ga0111539_107478353 150
193 3300009094 Ga0111539_11104190 Ga0111539_111041903 150
194 3300009098 Ga0105245_10006254 Ga0105245_1000625410 150
195 3300009098 Ga0105245_10010096 Ga0105245_100100965 150
196 3300009098 Ga0105245_11210980 Ga0105245_112109802 150
197 3300009098 Ga0105245_11417869 Ga0105245_114178691 150
198 3300009101 Ga0105247_11351083 Ga0105247_113510831 150
199 3300009147 Ga0114129_10004706 Ga0114129_1000470614 150
200 3300009147 Ga0114129_10007723 Ga0114129_100077235 150
201 3300009147 Ga0114129_10009392 Ga0114129_100093926 150
202 3300009147 Ga0114129_10015597 Ga0114129_100155975 150
203 3300009147 Ga0114129_10048650 Ga0114129_100486504 150
204 3300009147 Ga0114129_10059158 Ga0114129_100591585 150
205 3300009147 Ga0114129_10195958 Ga0114129_101959582 150
206 3300009147 Ga0114129_10541827 Ga0114129_105418272 150
207 3300009148 Ga0105243_10008653 Ga0105243_100086535 150
208 3300009148 Ga0105243_10191534 Ga0105243_101915344 150
209 3300009148 Ga0105243_10372456 Ga0105243_103724563 150
210 3300009148 Ga0105243_10487293 Ga0105243_104872932 150
211 3300009148 Ga0105243_10747343 Ga0105243_107473432 150
212 3300009148 Ga0105243_11398444 Ga0105243_113984441 150
213 3300009174 Ga0105241_10661645 Ga0105241_106616452 150
214 3300009176 Ga0105242_10057921 Ga0105242_100579213 150
215 3300009176 Ga0105242_10143979 Ga0105242_101439793 150
216 3300009176 Ga0105242_10236770 Ga0105242_102367703 150
217 3300009176 Ga0105242_11233705 Ga0105242_112337051 150
218 3300009176 Ga0105242_11271527 Ga0105242_112715272 150
219 3300009177 Ga0105248_10079497 Ga0105248_100794975 150
220 3300009177 Ga0105248_10084319 Ga0105248_100843192 150
221 3300009177 Ga0105248_10088785 Ga0105248_100887855 150
222 3300009177 Ga0105248_10163207 Ga0105248_101632073 150
223 3300009545 Ga0105237_10272351 Ga0105237_102723514 150
224 3300009551 Ga0105238_10038628 Ga0105238_100386281 150
225 3300009553 Ga0105249_10150964 Ga0105249_101509644 150
226 3300009553 Ga0105249_10199644 Ga0105249_101996443 150
227 3300009553 Ga0105249_10449673 Ga0105249_104496732 150
228 3300010375 Ga0105239_11302357 Ga0105239_113023572 150
229 3300013296 Ga0157374_10103311 Ga0157374_101033115 150
230 3300013296 Ga0157374_12029313 Ga0157374_120293132 150
231 3300013297 Ga0157378_10167637 Ga0157378_101676373 150
232 3300013297 Ga0157378_10392125 Ga0157378_103921252 150
233 3300013306 Ga0163162_10105974 Ga0163162_101059744 150
234 3300013306 Ga0163162_10227342 Ga0163162_102273424 150
235 3300013306 Ga0163162_10600550 Ga0163162_106005502 150
236 3300013308 Ga0157375_10099977 Ga0157375_100999772 150
237 3300013308 Ga0157375_10108935 Ga0157375_101089355 150
238 3300014325 Ga0163163_11331606 Ga0163163_113316062 150
239 3300014326 Ga0157380_10088492 Ga0157380_100884924 150
240 3300014326 Ga0157380_10454279 Ga0157380_104542793 150
241 3300014326 Ga0157380_10458400 Ga0157380_104584002 150
242 3300014326 Ga0157380_11039878 Ga0157380_110398782 150
243 3300014326 Ga0157380_12498293 Ga0157380_124982931 150
244 3300014745 Ga0157377_11027803 Ga0157377_110278032 150
245 3300014968 Ga0157379_10008466 Ga0157379_100084662 150
246 3300014969 Ga0157376_10003000 Ga0157376_100030007 150
247 3300014969 Ga0157376_10005627 Ga0157376_100056275 150
248 3300014969 Ga0157376_10253384 Ga0157376_102533842 150
249 3300017792 Ga0163161_10276673 Ga0163161_102766733 150
250 3300017792 Ga0163161_10691982 Ga0163161_106919822 150
251 3300025899 Ga0207642_10016420 Ga0207642_100164203 150
252 3300025899 Ga0207642_11062646 Ga0207642_110626461 150
253 3300025901 Ga0207688_10028547 Ga0207688_100285472 150
254 3300025903 Ga0207680_10012053 Ga0207680_100120535 150
255 3300025903 Ga0207680_10052673 Ga0207680_100526731 150
256 3300025903 Ga0207680_10126668 Ga0207680_101266681 150
257 3300025907 Ga0207645_10181749 Ga0207645_101817493 150
258 3300025907 Ga0207645_10513293 Ga0207645_105132932 150
259 3300025907 Ga0207645_10904731 Ga0207645_109047312 150
260 3300025910 Ga0207684_10770727 Ga0207684_107707271 150
261 3300025910 Ga0207684_10889375 Ga0207684_108893751 150
262 3300025911 Ga0207654_10315895 Ga0207654_103158952 150
263 3300025912 Ga0207707_10365421 Ga0207707_103654212 150
264 3300025912 Ga0207707_10561086 Ga0207707_105610862 150
265 3300025913 Ga0207695_10193738 Ga0207695_101937383 150
266 3300025914 Ga0207671_10213152 Ga0207671_102131523 150
267 3300025918 Ga0207662_10063755 Ga0207662_100637554 150
268 3300025922 Ga0207646_10139140 Ga0207646_101391404 150
269 3300025922 Ga0207646_10405508 Ga0207646_104055083 150
270 3300025923 Ga0207681_10105502 Ga0207681_101055022 150
271 3300025923 Ga0207681_10899938 Ga0207681_108999382 150
272 3300025924 Ga0207694_10967337 Ga0207694_109673371 150
273 3300025925 Ga0207650_10311367 Ga0207650_103113673 150
274 3300025927 Ga0207687_10005610 Ga0207687_100056104 150
275 3300025927 Ga0207687_10016516 Ga0207687_100165164 150
276 3300025927 Ga0207687_11135110 Ga0207687_111351102 150
277 3300025931 Ga0207644_10106453 Ga0207644_101064533 150
278 3300025931 Ga0207644_10685610 Ga0207644_106856102 150
279 3300025932 Ga0207690_10606998 Ga0207690_106069982 150
280 3300025933 Ga0207706_10378085 Ga0207706_103780851 150
281 3300025933 Ga0207706_10396369 Ga0207706_103963692 150
282 3300025933 Ga0207706_10457836 Ga0207706_104578362 150
283 3300025934 Ga0207686_10003728 Ga0207686_100037287 150
284 3300025934 Ga0207686_10011750 Ga0207686_100117505 150
285 3300025934 Ga0207686_10126340 Ga0207686_101263403 150
286 3300025935 Ga0207709_10202294 Ga0207709_102022942 150
287 3300025935 Ga0207709_10367943 Ga0207709_103679433 150
288 3300025935 Ga0207709_11641727 Ga0207709_116417271 150
289 3300025936 Ga0207670_10180642 Ga0207670_101806423 150
290 3300025936 Ga0207670_10254610 Ga0207670_102546103 150
291 3300025937 Ga0207669_10171538 Ga0207669_101715382 150
292 3300025938 Ga0207704_10047507 Ga0207704_100475073 150
293 3300025938 Ga0207704_10400270 Ga0207704_104002702 150
294 3300025940 Ga0207691_10045665 Ga0207691_100456653 150
295 3300025940 Ga0207691_10103221 Ga0207691_101032213 150
296 3300025941 Ga0207711_10010569 Ga0207711_100105697 150
297 3300025941 Ga0207711_10360775 Ga0207711_103607753 150
298 3300025942 Ga0207689_10430139 Ga0207689_104301393 150
299 3300025945 Ga0207679_10251685 Ga0207679_102516853 150
300 3300025945 Ga0207679_10251814 Ga0207679_102518142 150
301 3300025960 Ga0207651_10100180 Ga0207651_101001803 150
302 3300025960 Ga0207651_10244351 Ga0207651_102443513 150
303 3300025960 Ga0207651_10872576 Ga0207651_108725761 150
304 3300025961 Ga0207712_10043645 Ga0207712_100436451 150
305 3300025961 Ga0207712_10430682 Ga0207712_104306821 150
306 3300025972 Ga0207668_10019746 Ga0207668_100197461 150
307 3300025986 Ga0207658_10065949 Ga0207658_100659493 150
308 3300025986 Ga0207658_10283542 Ga0207658_102835423 150
309 3300025986 Ga0207658_10340326 Ga0207658_103403263 150
310 3300026023 Ga0207677_10060548 Ga0207677_100605483 150
311 3300026023 Ga0207677_10306272 Ga0207677_103062723 150
312 3300026035 Ga0207703_10442094 Ga0207703_104420942 150
313 3300026035 Ga0207703_11051856 Ga0207703_110518562 150
314 3300026075 Ga0207708_10538345 Ga0207708_105383452 150
315 3300026075 Ga0207708_10691169 Ga0207708_106911692 150
316 3300026088 Ga0207641_10000409 Ga0207641_1000040925 150
317 3300026088 Ga0207641_10223522 Ga0207641_102235224 150
318 3300026089 Ga0207648_10016299 Ga0207648_100162996 150
319 3300026089 Ga0207648_10231522 Ga0207648_102315223 150
320 3300026089 Ga0207648_10677017 Ga0207648_106770172 150
321 3300026089 Ga0207648_11068992 Ga0207648_110689922 150
322 3300026116 Ga0207674_10274214 Ga0207674_102742141 150
323 3300026118 Ga0207675_100044993 Ga0207675_1000449934 150
324 3300026118 Ga0207675_100102955 Ga0207675_1001029553 150
325 3300026118 Ga0207675_100541528 Ga0207675_1005415282 150
326 3300026118 Ga0207675_100658214 Ga0207675_1006582142 150
327 3300026118 Ga0207675_100661992 Ga0207675_1006619923 150
328 3300026118 Ga0207675_100960003 Ga0207675_1009600032 150
329 3300026121 Ga0207683_10028853 Ga0207683_100288533 150
330 3300026121 Ga0207683_10090290 Ga0207683_100902903 150
331 3300026121 Ga0207683_10931314 Ga0207683_109313141 150
332 3300026142 Ga0207698_10361555 Ga0207698_103615552 150
333 3300026142 Ga0207698_11287098 Ga0207698_112870982 150
334 3300027907 Ga0207428_10000022 Ga0207428_1000002286 150
335 3300027907 Ga0207428_10043263 Ga0207428_100432632 150
336 3300028379 Ga0268266_10032844 Ga0268266_100328444 150
337 3300028379 Ga0268266_10048341 Ga0268266_100483413 150
338 3300028380 Ga0268265_10045567 Ga0268265_100455674 150
339 3300028380 Ga0268265_10458438 Ga0268265_104584383 150
340 3300028380 Ga0268265_10961418 Ga0268265_109614182 150
341 3300028381 Ga0268264_10175281 Ga0268264_101752813 150
342 3300028381 Ga0268264_10689980 Ga0268264_106899802 150
343 3300028381 Ga0268264_11254498 Ga0268264_112544982 150
344 3300034957 Ga0373938_0093415 Ga0373938_0093415_62_529 150
345 3300035088 Ga0373940_0165575 Ga0373940_0165575_181_648 150
346 3300035242 Ga0373962_0088519 Ga0373962_0088519_35_502 150
347 3300035691 Ga0373931_0304200 Ga0373931_0304200_454_921 150
348 3300035691 Ga0373931_0468274 Ga0373931_0468274_212_679 150
349 3300039437 Ga0436365_0560402 Ga0436365_0560402_975_1451 150
350 3300044694 Ga0466963_0013024 Ga0466963_0013024_1200_1730 150
351 3300045051 Ga0451576_1030893 Ga0451576_1030893_142_615 150
352 3300045836 Ga0466958_0815828 Ga0466958_0815828_97_579 150
353 3300046537 Ga0495598_0112521 Ga0495598_0112521_59_526 150
354 3300046615 Ga0495656_0354468 Ga0495656_0354468_15_479 150
355 3300046663 Ga0495635_0361741 Ga0495635_0361741_31_507 150
356 3300046664 Ga0495659_0044209 Ga0495659_0044209_394_867 150
357 3300048903 Ga0496100_0436842 Ga0496100_0436842_304_771 150
358 3300048903 Ga0496100_0676023 Ga0496100_0676023_215_691 150
359 3300048904 Ga0496101_0646701 Ga0496101_0646701_31_498 150
360 3300048905 Ga0496102_0506596 Ga0496102_0506596_612_1088 150
361 3300048905 Ga0496102_1302553 Ga0496102_1302553_157_633 150
362 3300048906 Ga0496103_0857183 Ga0496103_0857183_27_491 150
363 3300048907 Ga0496104_0279070 Ga0496104_0279070_827_1294 150
364 3300048907 Ga0496104_0298908 Ga0496104_0298908_395_859 150
365 3300048907 Ga0496104_1100407 Ga0496104_1100407_17_481 150
366 3300048907 Ga0496104_1126867 Ga0496104_1126867_111_578 150
367 3300048908 Ga0496105_0255395 Ga0496105_0255395_862_1326 150
368 3300048909 Ga0496106_0079923 Ga0496106_0079923_212_679 150
369 3300048910 Ga0496107_0214035 Ga0496107_0214035_494_961 150
370 3300048912 Ga0496109_0619944 Ga0496109_0619944_63_530 150
371 3300048913 Ga0496110_0183516 Ga0496110_0183516_251_718 150
372 3300050507 nmdc:mga05p37_14016_c1 nmdc:mga05p37_14016_c1_7641_8117 150
373 3300050507 nmdc:mga05p37_172089_c1 nmdc:mga05p37_172089_c1_784_1257 150
374 3300050507 nmdc:mga05p37_17354_c1 nmdc:mga05p37_17354_c1_74_538 150
375 3300050507 nmdc:mga05p37_226164_c1 nmdc:mga05p37_226164_c1_689_1162 150
376 3300050507 nmdc:mga05p37_24324_c1 nmdc:mga05p37_24324_c1_2230_2700 150
377 3300050507 nmdc:mga05p37_277160_c1 nmdc:mga05p37_277160_c1_823_1296 150
378 3300050507 nmdc:mga05p37_511413_c1 nmdc:mga05p37_511413_c1_660_1136 150
379 3300050508 nmdc:mga09592_21615_c2 nmdc:mga09592_21615_c2_1657_2133 150
380 3300050508 nmdc:mga09592_933250_c1 nmdc:mga09592_933250_c1_12_482 150
381 3300050510 nmdc:mga06r32_118024_c1 nmdc:mga06r32_118024_c1_1714_2190 150
382 3300050510 nmdc:mga06r32_63954_c1 nmdc:mga06r32_63954_c1_1267_1758 150
383 3300050511 nmdc:mga08y16_1274313_c1 nmdc:mga08y16_1274313_c1_139_603 150
384 3300050511 nmdc:mga08y16_18129_c1 nmdc:mga08y16_18129_c1_954_1421 150
385 3300050511 nmdc:mga08y16_21_c1 nmdc:mga08y16_21_c1_162225_162716 150
386 3300050511 nmdc:mga08y16_37358_c1 nmdc:mga08y16_37358_c1_228_695 150
387 3300050512 nmdc:mga0n895_254453_c1 nmdc:mga0n895_254453_c1_742_1209 150
388 3300050512 nmdc:mga0n895_372908_c1 nmdc:mga0n895_372908_c1_810_1274 150
389 3300050512 nmdc:mga0n895_39426_c1 nmdc:mga0n895_39426_c1_2519_2983 150
390 3300050512 nmdc:mga0n895_549338_c1 nmdc:mga0n895_549338_c1_61_528 150
391 3300050513 nmdc:mga0rr50_1670720_c1 nmdc:mga0rr50_1670720_c1_23_493 150
392 3300050513 nmdc:mga0rr50_240957_c1 nmdc:mga0rr50_240957_c1_692_1156 150
393 3300050513 nmdc:mga0rr50_60767_c1 nmdc:mga0rr50_60767_c1_443_931 150
394 3300050514 nmdc:mga08x19_121175_c1 nmdc:mga08x19_121175_c1_871_1347 150
395 3300050514 nmdc:mga08x19_1236768_c1 nmdc:mga08x19_1236768_c1_23_502 150
396 3300050514 nmdc:mga08x19_38503_c1 nmdc:mga08x19_38503_c1_2245_2715 150
397 3300050515 nmdc:mga0a205_191661_c1 nmdc:mga0a205_191661_c1_430_903 150
398 3300050515 nmdc:mga0a205_652307_c1 nmdc:mga0a205_652307_c1_175_651 150
399 3300050515 nmdc:mga0a205_825211_c1 nmdc:mga0a205_825211_c1_35_502 150
400 3300050515 nmdc:mga0a205_87111_c1 nmdc:mga0a205_87111_c1_1767_2231 150
401 3300053077 Ga0495601_0279647 Ga0495601_0279647_508_984 150
402 3300061734 Ga0530510_1219117 Ga0530510_1219117_14_475 150
403 3300005434 Ga0070709_10493408 Ga0070709_104934082 151
404 3300005467 Ga0070706_101245726 Ga0070706_1012457261 151
405 3300005468 Ga0070707_100128094 Ga0070707_1001280943 151
406 3300005536 Ga0070697_100040806 Ga0070697_1000408063 151
407 3300006871 Ga0075434_100014854 Ga0075434_1000148545 151
408 3300014968 Ga0157379_11587829 Ga0157379_115878291 151
409 3300025906 Ga0207699_10261803 Ga0207699_102618033 151
410 3300025910 Ga0207684_11035191 Ga0207684_110351911 151
411 3300025922 Ga0207646_10451982 Ga0207646_104519822 151
412 3300026121 Ga0207683_10371555 Ga0207683_103715553 151
413 3300046528 Ga0495642_0047484 Ga0495642_0047484_812_1339 151
414 3300050512 nmdc:mga0n895_38575_c1 nmdc:mga0n895_38575_c1_1295_1795 151
415 3300005337 Ga0070682_100431594 Ga0070682_1004315941 152
416 3300005343 Ga0070687_100182483 Ga0070687_1001824833 152
417 3300005347 Ga0070668_100268044 Ga0070668_1002680443 152
418 3300005353 Ga0070669_100361940 Ga0070669_1003619401 152
419 3300005441 Ga0070700_100109117 Ga0070700_1001091172 152
420 3300005441 Ga0070700_100906851 Ga0070700_1009068511 152
421 3300005468 Ga0070707_100561210 Ga0070707_1005612102 152
422 3300005539 Ga0068853_100805322 Ga0068853_1008053221 152
423 3300005543 Ga0070672_100637720 Ga0070672_1006377201 152
424 3300005545 Ga0070695_100110168 Ga0070695_1001101681 152
425 3300005547 Ga0070693_100218155 Ga0070693_1002181552 152
426 3300005615 Ga0070702_100693488 Ga0070702_1006934881 152
427 3300005844 Ga0068862_100109126 Ga0068862_1001091263 152
428 3300006237 Ga0097621_100034551 Ga0097621_1000345514 152
429 3300006847 Ga0075431_100089929 Ga0075431_1000899295 152
430 3300007076 Ga0075435_100016194 Ga0075435_1000161946 152
431 3300007076 Ga0075435_101341200 Ga0075435_1013412001 152
432 3300007265 Ga0099794_10263078 Ga0099794_102630782 152
433 3300009098 Ga0105245_10230764 Ga0105245_102307643 152
434 3300009147 Ga0114129_10407884 Ga0114129_104078843 152
435 3300009147 Ga0114129_10668027 Ga0114129_106680274 152
436 3300009147 Ga0114129_11386554 Ga0114129_113865541 152
437 3300009148 Ga0105243_11329237 Ga0105243_113292371 152
438 3300009177 Ga0105248_10733657 Ga0105248_107336572 152
439 3300009553 Ga0105249_10685088 Ga0105249_106850882 152
440 3300014326 Ga0157380_10174194 Ga0157380_101741944 152
441 3300014745 Ga0157377_11178686 Ga0157377_111786861 152
442 3300014968 Ga0157379_10351832 Ga0157379_103518321 152
443 3300025907 Ga0207645_10058984 Ga0207645_100589843 152
444 3300025918 Ga0207662_10420177 Ga0207662_104201772 152
445 3300025922 Ga0207646_10382851 Ga0207646_103828512 152
446 3300025927 Ga0207687_10111812 Ga0207687_101118123 152
447 3300025933 Ga0207706_10026485 Ga0207706_100264856 152
448 3300025934 Ga0207686_10103642 Ga0207686_101036423 152
449 3300025940 Ga0207691_10138534 Ga0207691_101385342 152
450 3300025961 Ga0207712_10044811 Ga0207712_100448114 152
451 3300025972 Ga0207668_10053905 Ga0207668_100539053 152
452 3300026075 Ga0207708_10032003 Ga0207708_100320032 152
453 3300026075 Ga0207708_10714530 Ga0207708_107145302 152
454 3300028379 Ga0268266_11495191 Ga0268266_114951911 152
455 3300028380 Ga0268265_11011319 Ga0268265_110113192 152
456 3300034816 Ga0373930_0011012 Ga0373930_0011012_227_730 152
457 3300035724 Ga0373933_0585883 Ga0373933_0585883_17_487 152
458 3300036401 Ga0373937_0624090 Ga0373937_0624090_371_841 152
459 3300037068 Ga0373925_0462159 Ga0373925_0462159_415_882 152
460 3300037068 Ga0373925_1533968 Ga0373925_1533968_51_521 152
461 3300045051 Ga0451576_0296635 Ga0451576_0296635_765_1241 152
462 3300046455 Ga0495603_0385882 Ga0495603_0385882_18_485 152
463 3300046473 Ga0495582_0207423 Ga0495582_0207423_58_525 152
464 3300046683 Ga0495658_0068189 Ga0495658_0068189_1488_1955 152
465 3300048903 Ga0496100_0000944 Ga0496100_0000944_2204_2779 152
466 3300048904 Ga0496101_0001899 Ga0496101_0001899_5974_6549 152
467 3300048908 Ga0496105_0021862 Ga0496105_0021862_2818_3339 152
468 3300048917 Ga0496114_0020828 Ga0496114_0020828_3666_4241 152
469 3300048918 Ga0496115_0038754 Ga0496115_0038754_1663_2238 152
470 3300050507 nmdc:mga05p37_296117_c1 nmdc:mga05p37_296117_c1_74_559 152
471 3300050507 nmdc:mga05p37_780222_c1 nmdc:mga05p37_780222_c1_491_1000 152
472 3300050510 nmdc:mga06r32_238483_c1 nmdc:mga06r32_238483_c1_347_832 152
473 3300050512 nmdc:mga0n895_476758_c1 nmdc:mga0n895_476758_c1_148_636 152
474 3300004800 Ga0058861_11794399 Ga0058861_117943992 153
475 3300004803 Ga0058862_10215903 Ga0058862_102159033 153
476 3300005290 Ga0065712_10104326 Ga0065712_101043264 153
477 3300005293 Ga0065715_10011211 Ga0065715_100112113 153
478 3300005329 Ga0070683_100547814 Ga0070683_1005478143 153
479 3300005331 Ga0070670_100091860 Ga0070670_1000918602 153
480 3300005334 Ga0068869_100105587 Ga0068869_1001055874 153
481 3300005336 Ga0070680_100035994 Ga0070680_1000359943 153
482 3300005336 Ga0070680_101420094 Ga0070680_1014200941 153
483 3300005339 Ga0070660_100005024 Ga0070660_1000050245 153
484 3300005340 Ga0070689_100443957 Ga0070689_1004439573 153
485 3300005343 Ga0070687_100061394 Ga0070687_1000613943 153
486 3300005343 Ga0070687_100462813 Ga0070687_1004628131 153
487 3300005344 Ga0070661_100570016 Ga0070661_1005700163 153
488 3300005355 Ga0070671_100631495 Ga0070671_1006314951 153
489 3300005355 Ga0070671_100932829 Ga0070671_1009328292 153
490 3300005356 Ga0070674_100620616 Ga0070674_1006206162 153
491 3300005364 Ga0070673_101404190 Ga0070673_1014041901 153
492 3300005365 Ga0070688_100085989 Ga0070688_1000859893 153
493 3300005366 Ga0070659_100059747 Ga0070659_1000597474 153
494 3300005366 Ga0070659_100102679 Ga0070659_1001026791 153
495 3300005435 Ga0070714_100744055 Ga0070714_1007440552 153
496 3300005436 Ga0070713_100079681 Ga0070713_1000796813 153
497 3300005444 Ga0070694_100888550 Ga0070694_1008885501 153
498 3300005456 Ga0070678_100161269 Ga0070678_1001612693 153
499 3300005458 Ga0070681_10012336 Ga0070681_100123365 153
500 3300005467 Ga0070706_100280137 Ga0070706_1002801373 153
501 3300005530 Ga0070679_100295562 Ga0070679_1002955621 153
502 3300005530 Ga0070679_101618933 Ga0070679_1016189331 153
503 3300005543 Ga0070672_101094461 Ga0070672_1010944612 153
504 3300005544 Ga0070686_100020103 Ga0070686_1000201034 153
505 3300005544 Ga0070686_100602724 Ga0070686_1006027242 153
506 3300005546 Ga0070696_100158511 Ga0070696_1001585113 153
507 3300005548 Ga0070665_100163570 Ga0070665_1001635701 153
508 3300005564 Ga0070664_100111635 Ga0070664_1001116352 153
509 3300005564 Ga0070664_100286926 Ga0070664_1002869263 153
510 3300005577 Ga0068857_100227389 Ga0068857_1002273892 153
511 3300005578 Ga0068854_100045603 Ga0068854_1000456033 153
512 3300005617 Ga0068859_100037441 Ga0068859_1000374416 153
513 3300005617 Ga0068859_100361110 Ga0068859_1003611102 153
514 3300005618 Ga0068864_100012604 Ga0068864_1000126044 153
515 3300005618 Ga0068864_100289994 Ga0068864_1002899941 153
516 3300005719 Ga0068861_101717754 Ga0068861_1017177541 153
517 3300005841 Ga0068863_100192030 Ga0068863_1001920304 153
518 3300005842 Ga0068858_100041172 Ga0068858_1000411722 153
519 3300005843 Ga0068860_100288617 Ga0068860_1002886174 153
520 3300005843 Ga0068860_100494770 Ga0068860_1004947702 153
521 3300005843 Ga0068860_100559689 Ga0068860_1005596892 153
522 3300006163 Ga0070715_10013608 Ga0070715_100136084 153
523 3300006237 Ga0097621_100004117 Ga0097621_10000411710 153
524 3300006237 Ga0097621_100053650 Ga0097621_1000536504 153
525 3300006237 Ga0097621_100112068 Ga0097621_1001120683 153
526 3300006237 Ga0097621_100521204 Ga0097621_1005212043 153
527 3300006358 Ga0068871_100000670 Ga0068871_10000067010 153
528 3300006358 Ga0068871_100051184 Ga0068871_1000511843 153
529 3300006358 Ga0068871_100100775 Ga0068871_1001007753 153
530 3300006852 Ga0075433_10025649 Ga0075433_100256493 153
531 3300006852 Ga0075433_10323315 Ga0075433_103233152 153
532 3300006852 Ga0075433_10435665 Ga0075433_104356652 153
533 3300006871 Ga0075434_100000134 Ga0075434_10000013423 153
534 3300006871 Ga0075434_100135105 Ga0075434_1001351054 153
535 3300006881 Ga0068865_100007288 Ga0068865_1000072888 153
536 3300006914 Ga0075436_100000233 Ga0075436_10000023322 153
537 3300006914 Ga0075436_100006348 Ga0075436_1000063484 153
538 3300006914 Ga0075436_100117907 Ga0075436_1001179073 153
539 3300006931 Ga0097620_100037442 Ga0097620_1000374426 153
540 3300006931 Ga0097620_100361086 Ga0097620_1003610862 153
541 3300006931 Ga0097620_101660241 Ga0097620_1016602412 153
542 3300007076 Ga0075435_100000220 Ga0075435_10000022022 153
543 3300007076 Ga0075435_100002765 Ga0075435_1000027657 153
544 3300007076 Ga0075435_100026406 Ga0075435_1000264064 153
545 3300007076 Ga0075435_100298903 Ga0075435_1002989034 153
546 3300007076 Ga0075435_100347327 Ga0075435_1003473272 153
547 3300009093 Ga0105240_10085699 Ga0105240_100856996 153
548 3300009094 Ga0111539_10184065 Ga0111539_101840654 153
549 3300009101 Ga0105247_10011056 Ga0105247_100110565 153
550 3300009147 Ga0114129_10034764 Ga0114129_100347642 153
551 3300009147 Ga0114129_10043922 Ga0114129_100439223 153
552 3300009148 Ga0105243_12322397 Ga0105243_123223971 153
553 3300009174 Ga0105241_10040605 Ga0105241_100406054 153
554 3300009176 Ga0105242_10014004 Ga0105242_100140045 153
555 3300009177 Ga0105248_10001520 Ga0105248_1000152026 153
556 3300009177 Ga0105248_10477785 Ga0105248_104777853 153
557 3300009177 Ga0105248_11542307 Ga0105248_115423072 153
558 3300010375 Ga0105239_11104557 Ga0105239_111045571 153
559 3300010375 Ga0105239_11347253 Ga0105239_113472532 153
560 3300011119 Ga0105246_11272292 Ga0105246_112722922 153
561 3300013105 Ga0157369_11215275 Ga0157369_112152751 153
562 3300013297 Ga0157378_10301949 Ga0157378_103019493 153
563 3300013297 Ga0157378_10704411 Ga0157378_107044112 153
564 3300013307 Ga0157372_10634619 Ga0157372_106346193 153
565 3300013308 Ga0157375_11287801 Ga0157375_112878012 153
566 3300014325 Ga0163163_10002362 Ga0163163_1000236210 153
567 3300014325 Ga0163163_10076945 Ga0163163_100769455 153
568 3300014325 Ga0163163_10271672 Ga0163163_102716723 153
569 3300014326 Ga0157380_10085607 Ga0157380_100856074 153
570 3300014968 Ga0157379_10100607 Ga0157379_101006074 153
571 3300014969 Ga0157376_10033464 Ga0157376_100334644 153
572 3300014969 Ga0157376_10112853 Ga0157376_101128533 153
573 3300014969 Ga0157376_10527194 Ga0157376_105271942 153
574 3300014969 Ga0157376_12036715 Ga0157376_120367152 153
575 3300020080 Ga0206350_10238524 Ga0206350_102385241 153
576 3300025315 Ga0207697_10183827 Ga0207697_101838272 153
577 3300025893 Ga0207682_10062740 Ga0207682_100627403 153
578 3300025900 Ga0207710_10242787 Ga0207710_102427872 153
579 3300025903 Ga0207680_10016138 Ga0207680_100161382 153
580 3300025907 Ga0207645_10340146 Ga0207645_103401462 153
581 3300025910 Ga0207684_10245858 Ga0207684_102458583 153
582 3300025911 Ga0207654_10083693 Ga0207654_100836932 153
583 3300025912 Ga0207707_10096365 Ga0207707_100963653 153
584 3300025913 Ga0207695_10057917 Ga0207695_100579173 153
585 3300025913 Ga0207695_10140240 Ga0207695_101402403 153
586 3300025913 Ga0207695_10149476 Ga0207695_101494764 153
587 3300025914 Ga0207671_10816727 Ga0207671_108167271 153
588 3300025917 Ga0207660_11012960 Ga0207660_110129602 153
589 3300025919 Ga0207657_10013707 Ga0207657_100137073 153
590 3300025920 Ga0207649_10512829 Ga0207649_105128293 153
591 3300025921 Ga0207652_10067785 Ga0207652_100677853 153
592 3300025921 Ga0207652_11130648 Ga0207652_111306482 153
593 3300025923 Ga0207681_10945128 Ga0207681_109451282 153
594 3300025925 Ga0207650_10086397 Ga0207650_100863972 153
595 3300025925 Ga0207650_10333950 Ga0207650_103339502 153
596 3300025927 Ga0207687_10973222 Ga0207687_109732222 153
597 3300025928 Ga0207700_10221376 Ga0207700_102213764 153
598 3300025929 Ga0207664_10040462 Ga0207664_100404623 153
599 3300025931 Ga0207644_10079652 Ga0207644_100796523 153
600 3300025932 Ga0207690_10065447 Ga0207690_100654472 153
601 3300025933 Ga0207706_10841678 Ga0207706_108416782 153
602 3300025934 Ga0207686_10053537 Ga0207686_100535373 153
603 3300025936 Ga0207670_10327067 Ga0207670_103270673 153
604 3300025941 Ga0207711_10009258 Ga0207711_100092583 153
605 3300025941 Ga0207711_10738736 Ga0207711_107387362 153
606 3300025941 Ga0207711_11307495 Ga0207711_113074952 153
607 3300025944 Ga0207661_10657478 Ga0207661_106574782 153
608 3300025945 Ga0207679_10246854 Ga0207679_102468543 153
609 3300025945 Ga0207679_10311421 Ga0207679_103114213 153
610 3300025960 Ga0207651_10134178 Ga0207651_101341784 153
611 3300025981 Ga0207640_10004967 Ga0207640_100049678 153
612 3300025986 Ga0207658_10571963 Ga0207658_105719632 153
613 3300026023 Ga0207677_10360054 Ga0207677_103600543 153
614 3300026023 Ga0207677_10744258 Ga0207677_107442582 153
615 3300026023 Ga0207677_11195218 Ga0207677_111952181 153
616 3300026035 Ga0207703_10071163 Ga0207703_100711632 153
617 3300026035 Ga0207703_10531658 Ga0207703_105316582 153
618 3300026041 Ga0207639_11379445 Ga0207639_113794451 153
619 3300026075 Ga0207708_10337514 Ga0207708_103375141 153
620 3300026088 Ga0207641_10998164 Ga0207641_109981641 153
621 3300026095 Ga0207676_10022651 Ga0207676_100226514 153
622 3300026095 Ga0207676_11120418 Ga0207676_111204182 153
623 3300026116 Ga0207674_10087223 Ga0207674_100872234 153
624 3300026118 Ga0207675_100874014 Ga0207675_1008740142 153
625 3300026118 Ga0207675_101493076 Ga0207675_1014930762 153
626 3300028379 Ga0268266_10033346 Ga0268266_100333465 153
627 3300028380 Ga0268265_10780022 Ga0268265_107800222 153
628 3300028381 Ga0268264_10217406 Ga0268264_102174063 153
629 3300028381 Ga0268264_10753744 Ga0268264_107537442 153
630 3300028381 Ga0268264_10903078 Ga0268264_109030782 153
631 3300031711 Ga0265314_10108617 Ga0265314_101086171 153
632 3300034817 Ga0373948_0000440 Ga0373948_0000440_847_1353 153
633 3300034818 Ga0373950_0000944 Ga0373950_0000944_1853_2359 153
634 3300034819 Ga0373958_0001739 Ga0373958_0001739_861_1367 153
635 3300034819 Ga0373958_0059256 Ga0373958_0059256_190_705 153
636 3300034820 Ga0373959_0002963 Ga0373959_0002963_1954_2460 153
637 3300034957 Ga0373938_0000829 Ga0373938_0000829_2759_3265 153
638 3300035085 Ga0373929_0001288 Ga0373929_0001288_1658_2164 153
639 3300035086 Ga0373934_0053214 Ga0373934_0053214_499_969 153
640 3300035086 Ga0373934_0371962 Ga0373934_0371962_48_563 153
641 3300035088 Ga0373940_0001530 Ga0373940_0001530_2882_3388 153
642 3300035090 Ga0373949_0001914 Ga0373949_0001914_3383_3889 153
643 3300035091 Ga0373951_0007763 Ga0373951_0007763_1752_2258 153
644 3300035112 Ga0373932_0001883 Ga0373932_0001883_736_1242 153
645 3300035114 Ga0373939_0004389 Ga0373939_0004389_1580_2086 153
646 3300035115 Ga0373941_0000682 Ga0373941_0000682_2749_3255 153
647 3300035116 Ga0373945_0025158 Ga0373945_0025158_272_742 153
648 3300035116 Ga0373945_0154212 Ga0373945_0154212_289_828 153
649 3300035120 Ga0373957_0130457 Ga0373957_0130457_146_673 153
650 3300035121 Ga0373960_0001092 Ga0373960_0001092_2940_3446 153
651 3300035170 Ga0373943_0402001 Ga0373943_0402001_38_562 153
652 3300035171 Ga0373946_0039785 Ga0373946_0039785_109_615 153
653 3300035172 Ga0373955_0155423 Ga0373955_0155423_35_508 153
654 3300035172 Ga0373955_0164196 Ga0373955_0164196_327_869 153
655 3300035207 Ga0373942_0002521 Ga0373942_0002521_2682_3188 153
656 3300035241 Ga0373961_0002143 Ga0373961_0002143_863_1369 153
657 3300035242 Ga0373962_0001173 Ga0373962_0001173_3615_4121 153
658 3300035242 Ga0373962_0049677 Ga0373962_0049677_421_933 153
659 3300035691 Ga0373931_0004099 Ga0373931_0004099_1736_2242 153
660 3300035692 Ga0373935_1275824 Ga0373935_1275824_19_489 153
661 3300035695 Ga0373927_0252943 Ga0373927_0252943_383_853 153
662 3300035724 Ga0373933_0212880 Ga0373933_0212880_152_622 153
663 3300036401 Ga0373937_0078586 Ga0373937_0078586_2343_2849 153
664 3300036401 Ga0373937_0079910 Ga0373937_0079910_805_1278 153
665 3300045051 Ga0451576_0024123 Ga0451576_0024123_4796_5302 153
666 3300046462 Ga0495651_0442437 Ga0495651_0442437_342_812 153
667 3300046463 Ga0495653_0638420 Ga0495653_0638420_21_491 153
668 3300046477 Ga0495664_0456919 Ga0495664_0456919_61_534 153
669 3300046492 Ga0495585_0407659 Ga0495585_0407659_121_597 153
670 3300046516 Ga0495628_0123131 Ga0495628_0123131_713_1183 153
671 3300046516 Ga0495628_0261459 Ga0495628_0261459_654_1160 153
672 3300046529 Ga0495652_0280352 Ga0495652_0280352_613_1083 153
673 3300046533 Ga0495640_0066661 Ga0495640_0066661_514_1020 153
674 3300046533 Ga0495640_0165846 Ga0495640_0165846_764_1303 153
675 3300046559 Ga0495667_0448398 Ga0495667_0448398_36_506 153
676 3300046681 Ga0495647_0010795 Ga0495647_0010795_2064_2603 153
677 3300046683 Ga0495658_0265983 Ga0495658_0265983_523_1029 153
678 3300046683 Ga0495658_0278542 Ga0495658_0278542_79_618 153
679 3300046683 Ga0495658_0580589 Ga0495658_0580589_191_664 153
680 3300046684 Ga0495669_0078873 Ga0495669_0078873_66_572 153
681 3300046684 Ga0495669_0262984 Ga0495669_0262984_31_501 153
682 3300046809 Ga0495600_0149796 Ga0495600_0149796_68_574 153
683 3300047317 Ga0495604_0143892 Ga0495604_0143892_896_1366 153
684 3300047319 Ga0495674_0672013 Ga0495674_0672013_219_758 153
685 3300047319 Ga0495674_0974245 Ga0495674_0974245_56_529 153
686 3300048903 Ga0496100_0724089 Ga0496100_0724089_111_632 153
687 3300048904 Ga0496101_0144681 Ga0496101_0144681_1184_1705 153
688 3300048906 Ga0496103_0270038 Ga0496103_0270038_244_750 153
689 3300048907 Ga0496104_0132771 Ga0496104_0132771_21_542 153
690 3300048908 Ga0496105_0369823 Ga0496105_0369823_164_685 153
691 3300048909 Ga0496106_0120690 Ga0496106_0120690_378_896 153
692 3300048910 Ga0496107_0195217 Ga0496107_0195217_462_968 153
693 3300048911 Ga0496108_0012961 Ga0496108_0012961_1777_2283 153
694 3300048911 Ga0496108_0559543 Ga0496108_0559543_440_961 153
695 3300048911 Ga0496108_0618193 Ga0496108_0618193_157_627 153
696 3300048912 Ga0496109_0241984 Ga0496109_0241984_724_1194 153
697 3300048913 Ga0496110_0100033 Ga0496110_0100033_436_906 153
698 3300048914 Ga0496111_0656292 Ga0496111_0656292_145_615 153
699 3300048915 Ga0496112_0049109 Ga0496112_0049109_1930_2436 153
700 3300048915 Ga0496112_0263438 Ga0496112_0263438_1074_1598 153
701 3300048915 Ga0496112_1201335 Ga0496112_1201335_179_640 153
702 3300048916 Ga0496113_0027293 Ga0496113_0027293_442_948 153
703 3300048917 Ga0496114_0138992 Ga0496114_0138992_956_1462 153
704 3300048917 Ga0496114_0690913 Ga0496114_0690913_275_781 153
705 3300050507 nmdc:mga05p37_11396_c1 nmdc:mga05p37_11396_c1_8950_9420 153
706 3300050507 nmdc:mga05p37_70327_c1 nmdc:mga05p37_70327_c1_1005_1502 153
707 3300050508 nmdc:mga09592_493833_c1 nmdc:mga09592_493833_c1_243_755 153
708 3300050511 nmdc:mga08y16_340131_c1 nmdc:mga08y16_340131_c1_455_967 153
709 3300050511 nmdc:mga08y16_716563_c1 nmdc:mga08y16_716563_c1_309_776 153
710 3300050512 nmdc:mga0n895_10_c1 nmdc:mga0n895_10_c1_56553_57059 153
711 3300050512 nmdc:mga0n895_174577_c1 nmdc:mga0n895_174577_c1_1157_1663 153
712 3300050512 nmdc:mga0n895_439219_c1 nmdc:mga0n895_439219_c1_261_731 153
713 3300050513 nmdc:mga0rr50_137975_c1 nmdc:mga0rr50_137975_c1_472_990 153
714 3300050513 nmdc:mga0rr50_1933_c1 nmdc:mga0rr50_1933_c1_7071_7577 153
715 3300050513 nmdc:mga0rr50_20_c1 nmdc:mga0rr50_20_c1_107984_108490 153
716 3300050513 nmdc:mga0rr50_299275_c1 nmdc:mga0rr50_299275_c1_821_1327 153
717 3300050514 nmdc:mga08x19_155532_c1 nmdc:mga08x19_155532_c1_482_988 153
718 3300050514 nmdc:mga08x19_319_c1 nmdc:mga08x19_319_c1_13147_13653 153
719 3300050514 nmdc:mga08x19_388156_c1 nmdc:mga08x19_388156_c1_163_669 153
720 3300053077 Ga0495601_0138533 Ga0495601_0138533_693_1163 153
721 3300053077 Ga0495601_0148880 Ga0495601_0148880_356_829 153
722 3300053077 Ga0495601_0455427 Ga0495601_0455427_85_624 153
723 3300053078 Ga0495612_0319906 Ga0495612_0319906_81_587 153
724 3300053084 Ga0495595_0056068 Ga0495595_0056068_547_1053 153
725 3300053084 Ga0495595_0076666 Ga0495595_0076666_388_912 153
726 3300053084 Ga0495595_0150828 Ga0495595_0150828_336_806 153
727 3300053085 Ga0495619_0010785 Ga0495619_0010785_861_1331 153
728 3300053085 Ga0495619_0103811 Ga0495619_0103811_307_849 153
729 3300053134 Ga0500658_0300173 Ga0500658_0300173_101_574 153

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13411

MerR_1

MerR HTH family regulatory protein

25

100

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qao-assembly1.cif.gz_A-2 the crystal structure of the n-terminal domain of a merr-like transcriptional regulator from listeria monocytogenes egd-e 0.8344 4 78
6jni-assembly4.cif.gz_G crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.8131 7 85
6jni-assembly3.cif.gz_E crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.8121 7 85
6jni-assembly4.cif.gz_H crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna 0.8115 7 85
1jbg-assembly1.cif.gz_A-2 crystal structure of mtan, the bacillus subtilis multidrug transporter activator, n-terminus 0.8114 7 78
ID Description Score Start End Superfamily
3d6zA01 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8385 6 76 1.10.1660.10
1r8dA00 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8338 6 80 1.10.1660.10
af_Q2FVM8_3_134_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.8094 6 76 1.10.1660.10
af_Q2G2L8_2_138_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.7971 6 85 1.10.1660.10
1exjA02 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.7911 4 76 1.10.1660.10
ID Description Score Start End GO Terms
AF-A0A843SY63-F1-model_v4 MerR family transcriptional regulator 0.9609 1 153 GO:0003677
GO:0006355
AF-A0A843SY63-F1-model_v4 MerR family transcriptional regulator 0.9552 1 153 GO:0003677
GO:0006355
AF-A0A381S194-F1-model_v4 HTH merR-type domain-containing protein 0.952 1 152 GO:0003677
GO:0003700
AF-A0A2E4W978-F1-model_v4 HTH merR-type domain-containing protein 0.9419 1 153 GO:0003677
GO:0003700
AF-A0A381S194-F1-model_v4 HTH merR-type domain-containing protein 0.94 1 152 GO:0003677
GO:0003700

Feature Viewer

pLDDT pTM Quality
88.52 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map