F477882
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 729 | 263 | 729 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300048903|Ga0496100_0000944|Ga0496100_0000944_2204_2779 |
| Length | 191 |
| Sequence | MRLERDWTKCAHADRNESMRLKRTYSSREIASLTGLTARQLQLWDASGLMAAAIPTHRTDAGGYTERRYTPIELFELLVLADLRRRGFSVPQLHQIIATLRGQFGARLFEATGGGGHVQLLTDGHDIYARTDRGEFFNLLREPAQPLLVVGDEGLLKELSSTLRPRRPRSHKGALPAPRKRSAGRSRDQKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 2 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 3 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 75 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 76 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 77 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 78 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 175 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 176 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 177 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 178 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 179 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 180 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 181 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 186 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 187 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 188 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 191 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 198 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 199 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 200 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 201 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 206 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 207 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 252 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 262 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.59 |
| Metatranscriptomes | 0.41 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 5.35 |
| Rhizosphere | 94.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0058861_11794399 | 3300004800 | Bacteria | 1965 |
| 2 | Ga0058862_10215903 | 3300004803 | Unclassified | 1914 |
| 3 | Ga0065704_10309473 | 3300005289 | Unclassified | 871 |
| 4 | Ga0065712_10104326 | 3300005290 | Bacteria | 1964 |
| 5 | Ga0065715_10008955 | 3300005293 | Bacteria | 4270 |
| 6 | Ga0065715_10011211 | 3300005293 | Bacteria | 2063 |
| 7 | Ga0070676_10732885 | 3300005328 | Unclassified | 724 |
| 8 | Ga0070683_100547814 | 3300005329 | Unclassified | 1106 |
| 9 | Ga0070690_100689438 | 3300005330 | Bacteria | 783 |
| 10 | Ga0070670_100091860 | 3300005331 | Bacteria | 2610 |
| 11 | Ga0070670_100385630 | 3300005331 | Bacteria | 1235 |
| 12 | Ga0068869_100105587 | 3300005334 | Bacteria | 2137 |
| 13 | Ga0068869_100663065 | 3300005334 | Unclassified | 887 |
| 14 | Ga0070666_10020939 | 3300005335 | Bacteria | 4234 |
| 15 | Ga0070666_10200812 | 3300005335 | Unclassified | 1403 |
| 16 | Ga0070680_100035994 | 3300005336 | Bacteria | 3998 |
| 17 | Ga0070680_101038433 | 3300005336 | Bacteria | 708 |
| 18 | Ga0070680_101420094 | 3300005336 | Bacteria | 601 |
| 19 | Ga0070682_100431594 | 3300005337 | Bacteria | 1004 |
| 20 | Ga0068868_100016138 | 3300005338 | Bacteria | 5540 |
| 21 | Ga0068868_100029482 | 3300005338 | Bacteria | 4202 |
| 22 | Ga0068868_100786000 | 3300005338 | Unclassified | 858 |
| 23 | Ga0070660_100005024 | 3300005339 | Bacteria | 9144 |
| 24 | Ga0070689_100152789 | 3300005340 | Bacteria | 1862 |
| 25 | Ga0070689_100443957 | 3300005340 | Bacteria | 1103 |
| 26 | Ga0070687_100061394 | 3300005343 | Bacteria | 1987 |
| 27 | Ga0070687_100182483 | 3300005343 | Unclassified | 1258 |
| 28 | Ga0070687_100462813 | 3300005343 | Bacteria | 846 |
| 29 | Ga0070661_100570016 | 3300005344 | Bacteria | 913 |
| 30 | Ga0070668_100145233 | 3300005347 | Bacteria | 1914 |
| 31 | Ga0070668_100268044 | 3300005347 | Bacteria | 1422 |
| 32 | Ga0070669_100008803 | 3300005353 | Bacteria | 7199 |
| 33 | Ga0070669_100069820 | 3300005353 | Bacteria | 2595 |
| 34 | Ga0070669_100361940 | 3300005353 | Bacteria | 1180 |
| 35 | Ga0070675_100153447 | 3300005354 | Unclassified | 1976 |
| 36 | Ga0070671_100022694 | 3300005355 | Bacteria | 5127 |
| 37 | Ga0070671_100393607 | 3300005355 | Bacteria | 1185 |
| 38 | Ga0070671_100631495 | 3300005355 | Unclassified | 927 |
| 39 | Ga0070671_100932829 | 3300005355 | Unclassified | 759 |
| 40 | Ga0070671_100942501 | 3300005355 | Unclassified | 755 |
| 41 | Ga0070674_100108568 | 3300005356 | Unclassified | 2034 |
| 42 | Ga0070674_100150230 | 3300005356 | Bacteria | 1757 |
| 43 | Ga0070674_100271766 | 3300005356 | Bacteria | 1340 |
| 44 | Ga0070674_100620616 | 3300005356 | Bacteria | 916 |
| 45 | Ga0070673_100314915 | 3300005364 | Bacteria | 1381 |
| 46 | Ga0070673_100374824 | 3300005364 | Unclassified | 1268 |
| 47 | Ga0070673_100565925 | 3300005364 | Bacteria | 1034 |
| 48 | Ga0070673_101404190 | 3300005364 | Unclassified | 657 |
| 49 | Ga0070688_100085989 | 3300005365 | Bacteria | 2045 |
| 50 | Ga0070688_100105316 | 3300005365 | Unclassified | 1867 |
| 51 | Ga0070688_100248469 | 3300005365 | Bacteria | 1265 |
| 52 | Ga0070659_100059747 | 3300005366 | Bacteria | 3010 |
| 53 | Ga0070659_100102679 | 3300005366 | Bacteria | 2302 |
| 54 | Ga0070667_100038020 | 3300005367 | Bacteria | 4036 |
| 55 | Ga0070667_100360609 | 3300005367 | Bacteria | 1317 |
| 56 | Ga0070709_10493408 | 3300005434 | Bacteria | 929 |
| 57 | Ga0070714_100744055 | 3300005435 | Bacteria | 947 |
| 58 | Ga0070713_100079681 | 3300005436 | Bacteria | 2790 |
| 59 | Ga0070701_10305087 | 3300005438 | Unclassified | 980 |
| 60 | Ga0070701_10403681 | 3300005438 | Bacteria | 866 |
| 61 | Ga0070701_10620954 | 3300005438 | Bacteria | 718 |
| 62 | Ga0070705_100510647 | 3300005440 | Unclassified | 914 |
| 63 | Ga0070700_100109117 | 3300005441 | Bacteria | 1837 |
| 64 | Ga0070700_100194041 | 3300005441 | Unclassified | 1422 |
| 65 | Ga0070700_100906851 | 3300005441 | Bacteria | 718 |
| 66 | Ga0070694_100018134 | 3300005444 | Bacteria | 4463 |
| 67 | Ga0070694_100106599 | 3300005444 | Bacteria | 1990 |
| 68 | Ga0070694_100888550 | 3300005444 | Bacteria | 735 |
| 69 | Ga0070708_100036911 | 3300005445 | Bacteria | 4262 |
| 70 | Ga0070708_100642728 | 3300005445 | Bacteria | 1000 |
| 71 | Ga0070678_100161269 | 3300005456 | Bacteria | 1817 |
| 72 | Ga0070678_100173014 | 3300005456 | Bacteria | 1761 |
| 73 | Ga0070678_100357755 | 3300005456 | Bacteria | 1257 |
| 74 | Ga0070662_100456949 | 3300005457 | Bacteria | 1061 |
| 75 | Ga0070681_10012336 | 3300005458 | Bacteria | 8474 |
| 76 | Ga0070681_10834860 | 3300005458 | Bacteria | 839 |
| 77 | Ga0068867_100250438 | 3300005459 | Bacteria | 1440 |
| 78 | Ga0068867_100625023 | 3300005459 | Bacteria | 942 |
| 79 | Ga0070706_100280137 | 3300005467 | Bacteria | 1556 |
| 80 | Ga0070706_100826941 | 3300005467 | Bacteria | 857 |
| 81 | Ga0070706_100987075 | 3300005467 | Bacteria | 777 |
| 82 | Ga0070706_101245726 | 3300005467 | Bacteria | 683 |
| 83 | Ga0070707_100102237 | 3300005468 | Unclassified | 2777 |
| 84 | Ga0070707_100106459 | 3300005468 | Bacteria | 2720 |
| 85 | Ga0070707_100128094 | 3300005468 | Bacteria | 2467 |
| 86 | Ga0070707_100413052 | 3300005468 | Bacteria | 1310 |
| 87 | Ga0070707_100561210 | 3300005468 | Bacteria | 1104 |
| 88 | Ga0070707_101706518 | 3300005468 | Bacteria | 597 |
| 89 | Ga0070698_100056676 | 3300005471 | Bacteria | 3970 |
| 90 | Ga0070699_100014967 | 3300005518 | Bacteria | 6666 |
| 91 | Ga0070699_100074390 | 3300005518 | Bacteria | 2956 |
| 92 | Ga0070699_100081960 | 3300005518 | Bacteria | 2812 |
| 93 | Ga0070679_100295562 | 3300005530 | Unclassified | 1571 |
| 94 | Ga0070679_101618933 | 3300005530 | Bacteria | 595 |
| 95 | Ga0070684_100502300 | 3300005535 | Unclassified | 1123 |
| 96 | Ga0070697_100040806 | 3300005536 | Bacteria | 3756 |
| 97 | Ga0070697_100674575 | 3300005536 | Unclassified | 911 |
| 98 | Ga0070697_100764836 | 3300005536 | Bacteria | 854 |
| 99 | Ga0068853_100805322 | 3300005539 | Unclassified | 900 |
| 100 | Ga0070672_100002128 | 3300005543 | Bacteria | 12501 |
| 101 | Ga0070672_100147334 | 3300005543 | Unclassified | 1946 |
| 102 | Ga0070672_100637720 | 3300005543 | Bacteria | 930 |
| 103 | Ga0070672_101094461 | 3300005543 | Bacteria | 708 |
| 104 | Ga0070686_100020103 | 3300005544 | Bacteria | 3948 |
| 105 | Ga0070686_100070078 | 3300005544 | Bacteria | 2292 |
| 106 | Ga0070686_100093777 | 3300005544 | Bacteria | 2014 |
| 107 | Ga0070686_100187636 | 3300005544 | Bacteria | 1473 |
| 108 | Ga0070686_100602724 | 3300005544 | Unclassified | 866 |
| 109 | Ga0070695_100006549 | 3300005545 | Bacteria | 6882 |
| 110 | Ga0070695_100110168 | 3300005545 | Bacteria | 1867 |
| 111 | Ga0070696_100085226 | 3300005546 | Bacteria | 2242 |
| 112 | Ga0070696_100156796 | 3300005546 | Unclassified | 1675 |
| 113 | Ga0070696_100158511 | 3300005546 | Bacteria | 1666 |
| 114 | Ga0070696_100168474 | 3300005546 | Bacteria | 1618 |
| 115 | Ga0070696_100657387 | 3300005546 | Unclassified | 850 |
| 116 | Ga0070696_101215242 | 3300005546 | Bacteria | 637 |
| 117 | Ga0070693_100217419 | 3300005547 | Bacteria | 1250 |
| 118 | Ga0070693_100218155 | 3300005547 | Bacteria | 1248 |
| 119 | Ga0070665_100014048 | 3300005548 | Bacteria | 8050 |
| 120 | Ga0070665_100022599 | 3300005548 | Bacteria | 6332 |
| 121 | Ga0070665_100163570 | 3300005548 | Bacteria | 2227 |
| 122 | Ga0070704_100029626 | 3300005549 | Unclassified | 3657 |
| 123 | Ga0070704_100861213 | 3300005549 | Unclassified | 813 |
| 124 | Ga0068855_100285795 | 3300005563 | Bacteria | 1830 |
| 125 | Ga0068855_100292620 | 3300005563 | Bacteria | 1805 |
| 126 | Ga0070664_100111635 | 3300005564 | Unclassified | 2386 |
| 127 | Ga0070664_100200107 | 3300005564 | Bacteria | 1782 |
| 128 | Ga0070664_100286926 | 3300005564 | Unclassified | 1485 |
| 129 | Ga0068857_100227389 | 3300005577 | Bacteria | 1705 |
| 130 | Ga0068854_100045603 | 3300005578 | Bacteria | 3118 |
| 131 | Ga0068854_100159208 | 3300005578 | Bacteria | 1747 |
| 132 | Ga0068854_100205010 | 3300005578 | Unclassified | 1552 |
| 133 | Ga0068854_100355577 | 3300005578 | Unclassified | 1200 |
| 134 | Ga0068856_100041738 | 3300005614 | Bacteria | 4510 |
| 135 | Ga0070702_100307945 | 3300005615 | Unclassified | 1099 |
| 136 | Ga0070702_100693488 | 3300005615 | Unclassified | 775 |
| 137 | Ga0068852_100393989 | 3300005616 | Unclassified | 1361 |
| 138 | Ga0068859_100004413 | 3300005617 | Bacteria | 14352 |
| 139 | Ga0068859_100037441 | 3300005617 | Bacteria | 4868 |
| 140 | Ga0068859_100110799 | 3300005617 | Bacteria | 2807 |
| 141 | Ga0068859_100139856 | 3300005617 | Unclassified | 2494 |
| 142 | Ga0068859_100361110 | 3300005617 | Bacteria | 1547 |
| 143 | Ga0068859_100828231 | 3300005617 | Bacteria | 1012 |
| 144 | Ga0068864_100012604 | 3300005618 | Bacteria | 6991 |
| 145 | Ga0068864_100289994 | 3300005618 | Bacteria | 1530 |
| 146 | Ga0068866_10025138 | 3300005718 | Bacteria | 2796 |
| 147 | Ga0068866_11255111 | 3300005718 | Unclassified | 537 |
| 148 | Ga0068861_100012934 | 3300005719 | Bacteria | 5827 |
| 149 | Ga0068861_100072744 | 3300005719 | Bacteria | 2668 |
| 150 | Ga0068861_100142405 | 3300005719 | Bacteria | 1958 |
| 151 | Ga0068861_100703915 | 3300005719 | Unclassified | 939 |
| 152 | Ga0068861_101717754 | 3300005719 | Bacteria | 621 |
| 153 | Ga0068870_10293112 | 3300005840 | Bacteria | 1024 |
| 154 | Ga0068863_100192030 | 3300005841 | Unclassified | 1963 |
| 155 | Ga0068863_101894779 | 3300005841 | Unclassified | 606 |
| 156 | Ga0068858_100012051 | 3300005842 | Bacteria | 8150 |
| 157 | Ga0068858_100041172 | 3300005842 | Bacteria | 4284 |
| 158 | Ga0068858_100071308 | 3300005842 | Bacteria | 3222 |
| 159 | Ga0068858_100409361 | 3300005842 | Unclassified | 1304 |
| 160 | Ga0068860_100069823 | 3300005843 | Unclassified | 3340 |
| 161 | Ga0068860_100120363 | 3300005843 | Bacteria | 2514 |
| 162 | Ga0068860_100288617 | 3300005843 | Bacteria | 1605 |
| 163 | Ga0068860_100494770 | 3300005843 | Bacteria | 1220 |
| 164 | Ga0068860_100559689 | 3300005843 | Bacteria | 1146 |
| 165 | Ga0068862_100028651 | 3300005844 | Unclassified | 4691 |
| 166 | Ga0068862_100109126 | 3300005844 | Bacteria | 2427 |
| 167 | Ga0068862_100194662 | 3300005844 | Unclassified | 1826 |
| 168 | Ga0068862_101162696 | 3300005844 | Bacteria | 769 |
| 169 | Ga0070715_10013608 | 3300006163 | Bacteria | 2993 |
| 170 | Ga0070716_100543294 | 3300006173 | Bacteria | 865 |
| 171 | Ga0097621_100004117 | 3300006237 | Bacteria | 10085 |
| 172 | Ga0097621_100021404 | 3300006237 | Bacteria | 5002 |
| 173 | Ga0097621_100034551 | 3300006237 | Bacteria | 4034 |
| 174 | Ga0097621_100053650 | 3300006237 | Bacteria | 3286 |
| 175 | Ga0097621_100057424 | 3300006237 | Bacteria | 3183 |
| 176 | Ga0097621_100112068 | 3300006237 | Bacteria | 2306 |
| 177 | Ga0097621_100132474 | 3300006237 | Bacteria | 2123 |
| 178 | Ga0097621_100186678 | 3300006237 | Unclassified | 1794 |
| 179 | Ga0097621_100222990 | 3300006237 | Bacteria | 1643 |
| 180 | Ga0097621_100418628 | 3300006237 | Bacteria | 1202 |
| 181 | Ga0097621_100521204 | 3300006237 | Bacteria | 1079 |
| 182 | Ga0097621_100654898 | 3300006237 | Bacteria | 964 |
| 183 | Ga0068871_100000670 | 3300006358 | Bacteria | 23450 |
| 184 | Ga0068871_100051184 | 3300006358 | Bacteria | 3343 |
| 185 | Ga0068871_100055205 | 3300006358 | Bacteria | 3225 |
| 186 | Ga0068871_100057193 | 3300006358 | Bacteria | 3173 |
| 187 | Ga0068871_100100775 | 3300006358 | Bacteria | 2420 |
| 188 | Ga0068871_100141055 | 3300006358 | Bacteria | 2049 |
| 189 | Ga0068871_100155946 | 3300006358 | Unclassified | 1950 |
| 190 | Ga0068871_100214812 | 3300006358 | Unclassified | 1664 |
| 191 | Ga0068871_100540775 | 3300006358 | Bacteria | 1054 |
| 192 | Ga0068871_101454766 | 3300006358 | Bacteria | 647 |
| 193 | Ga0075428_100000007 | 3300006844 | Bacteria | 273226 |
| 194 | Ga0075428_100106189 | 3300006844 | Bacteria | 3061 |
| 195 | Ga0075428_100831261 | 3300006844 | Bacteria | 981 |
| 196 | Ga0075428_100935433 | 3300006844 | Bacteria | 919 |
| 197 | Ga0075430_100825898 | 3300006846 | Bacteria | 764 |
| 198 | Ga0075431_100013395 | 3300006847 | Bacteria | 8285 |
| 199 | Ga0075431_100048384 | 3300006847 | Unclassified | 4386 |
| 200 | Ga0075431_100089929 | 3300006847 | Bacteria | 3169 |
| 201 | Ga0075433_10025649 | 3300006852 | Unclassified | 4984 |
| 202 | Ga0075433_10098369 | 3300006852 | Bacteria | 2590 |
| 203 | Ga0075433_10180809 | 3300006852 | Bacteria | 1877 |
| 204 | Ga0075433_10220526 | 3300006852 | Bacteria | 1685 |
| 205 | Ga0075433_10323315 | 3300006852 | Bacteria | 1365 |
| 206 | Ga0075433_10429002 | 3300006852 | Unclassified | 1166 |
| 207 | Ga0075433_10435665 | 3300006852 | Bacteria | 1156 |
| 208 | Ga0075433_10869367 | 3300006852 | Bacteria | 787 |
| 209 | Ga0075434_100000134 | 3300006871 | Bacteria | 44745 |
| 210 | Ga0075434_100014854 | 3300006871 | Bacteria | 7449 |
| 211 | Ga0075434_100041050 | 3300006871 | Bacteria | 4582 |
| 212 | Ga0075434_100135105 | 3300006871 | Bacteria | 2485 |
| 213 | Ga0075434_100164745 | 3300006871 | Unclassified | 2237 |
| 214 | Ga0075434_100541510 | 3300006871 | Bacteria | 1184 |
| 215 | Ga0075434_101146006 | 3300006871 | Unclassified | 790 |
| 216 | Ga0075434_101532064 | 3300006871 | Unclassified | 676 |
| 217 | Ga0075434_101628579 | 3300006871 | Bacteria | 654 |
| 218 | Ga0075429_100149587 | 3300006880 | Bacteria | 2044 |
| 219 | Ga0075429_100598858 | 3300006880 | Bacteria | 966 |
| 220 | Ga0075429_100618383 | 3300006880 | Unclassified | 949 |
| 221 | Ga0075429_100627333 | 3300006880 | Bacteria | 942 |
| 222 | Ga0068865_100007288 | 3300006881 | Bacteria | 6797 |
| 223 | Ga0068865_100210965 | 3300006881 | Bacteria | 1513 |
| 224 | Ga0068865_100337974 | 3300006881 | Bacteria | 1216 |
| 225 | Ga0068865_101290534 | 3300006881 | Bacteria | 649 |
| 226 | Ga0075436_100000233 | 3300006914 | Bacteria | 34841 |
| 227 | Ga0075436_100006348 | 3300006914 | Bacteria | 8100 |
| 228 | Ga0075436_100021857 | 3300006914 | Bacteria | 4392 |
| 229 | Ga0075436_100028943 | 3300006914 | Bacteria | 3811 |
| 230 | Ga0075436_100029792 | 3300006914 | Bacteria | 3753 |
| 231 | Ga0075436_100117907 | 3300006914 | Bacteria | 1856 |
| 232 | Ga0075436_100697747 | 3300006914 | Unclassified | 752 |
| 233 | Ga0097620_100004413 | 3300006931 | Bacteria | 14352 |
| 234 | Ga0097620_100037442 | 3300006931 | Bacteria | 4868 |
| 235 | Ga0097620_100110791 | 3300006931 | Bacteria | 2807 |
| 236 | Ga0097620_100139860 | 3300006931 | Unclassified | 2494 |
| 237 | Ga0097620_100361086 | 3300006931 | Bacteria | 1547 |
| 238 | Ga0097620_100828117 | 3300006931 | Bacteria | 1012 |
| 239 | Ga0097620_101660241 | 3300006931 | Bacteria | 706 |
| 240 | Ga0075435_100000220 | 3300007076 | Bacteria | 35137 |
| 241 | Ga0075435_100002765 | 3300007076 | Bacteria | 11718 |
| 242 | Ga0075435_100016194 | 3300007076 | Bacteria | 5619 |
| 243 | Ga0075435_100021209 | 3300007076 | Bacteria | 4993 |
| 244 | Ga0075435_100026406 | 3300007076 | Unclassified | 4530 |
| 245 | Ga0075435_100298903 | 3300007076 | Bacteria | 1377 |
| 246 | Ga0075435_100347327 | 3300007076 | Bacteria | 1271 |
| 247 | Ga0075435_100528562 | 3300007076 | Bacteria | 1021 |
| 248 | Ga0075435_101118762 | 3300007076 | Bacteria | 689 |
| 249 | Ga0075435_101341200 | 3300007076 | Unclassified | 627 |
| 250 | Ga0075435_102030348 | 3300007076 | Unclassified | 505 |
| 251 | Ga0099794_10263078 | 3300007265 | Bacteria | 890 |
| 252 | Ga0105240_10062935 | 3300009093 | Bacteria | 4618 |
| 253 | Ga0105240_10085699 | 3300009093 | Bacteria | 3859 |
| 254 | Ga0105240_10216820 | 3300009093 | Unclassified | 2232 |
| 255 | Ga0111539_10000009 | 3300009094 | Bacteria | 375223 |
| 256 | Ga0111539_10093939 | 3300009094 | Bacteria | 3523 |
| 257 | Ga0111539_10184065 | 3300009094 | Bacteria | 2440 |
| 258 | Ga0111539_10596571 | 3300009094 | Bacteria | 1286 |
| 259 | Ga0111539_10747835 | 3300009094 | Unclassified | 1138 |
| 260 | Ga0111539_11104190 | 3300009094 | Unclassified | 922 |
| 261 | Ga0105245_10006254 | 3300009098 | Bacteria | 10476 |
| 262 | Ga0105245_10010096 | 3300009098 | Bacteria | 8225 |
| 263 | Ga0105245_10122846 | 3300009098 | Unclassified | 2427 |
| 264 | Ga0105245_10230764 | 3300009098 | Bacteria | 1790 |
| 265 | Ga0105245_11210980 | 3300009098 | Unclassified | 803 |
| 266 | Ga0105245_11417869 | 3300009098 | Bacteria | 745 |
| 267 | Ga0105247_10011056 | 3300009101 | Bacteria | 5446 |
| 268 | Ga0105247_11351083 | 3300009101 | Unclassified | 574 |
| 269 | Ga0114129_10004706 | 3300009147 | Bacteria | 19261 |
| 270 | Ga0114129_10007723 | 3300009147 | Bacteria | 15300 |
| 271 | Ga0114129_10009392 | 3300009147 | Bacteria | 13941 |
| 272 | Ga0114129_10015041 | 3300009147 | Bacteria | 11017 |
| 273 | Ga0114129_10015597 | 3300009147 | Bacteria | 10804 |
| 274 | Ga0114129_10034764 | 3300009147 | Bacteria | 7119 |
| 275 | Ga0114129_10043922 | 3300009147 | Bacteria | 6287 |
| 276 | Ga0114129_10048650 | 3300009147 | Bacteria | 5958 |
| 277 | Ga0114129_10059158 | 3300009147 | Bacteria | 5358 |
| 278 | Ga0114129_10195958 | 3300009147 | Bacteria | 2739 |
| 279 | Ga0114129_10407884 | 3300009147 | Bacteria | 1790 |
| 280 | Ga0114129_10541827 | 3300009147 | Bacteria | 1514 |
| 281 | Ga0114129_10668027 | 3300009147 | Bacteria | 1339 |
| 282 | Ga0114129_11386554 | 3300009147 | Bacteria | 868 |
| 283 | Ga0105243_10008653 | 3300009148 | Bacteria | 7807 |
| 284 | Ga0105243_10191534 | 3300009148 | Bacteria | 1786 |
| 285 | Ga0105243_10372456 | 3300009148 | Bacteria | 1318 |
| 286 | Ga0105243_10487293 | 3300009148 | Bacteria | 1165 |
| 287 | Ga0105243_10747343 | 3300009148 | Unclassified | 958 |
| 288 | Ga0105243_11329237 | 3300009148 | Bacteria | 737 |
| 289 | Ga0105243_11398444 | 3300009148 | Bacteria | 720 |
| 290 | Ga0105243_12322397 | 3300009148 | Bacteria | 574 |
| 291 | Ga0105241_10040605 | 3300009174 | Bacteria | 3513 |
| 292 | Ga0105241_10661645 | 3300009174 | Unclassified | 950 |
| 293 | Ga0105242_10014004 | 3300009176 | Bacteria | 6206 |
| 294 | Ga0105242_10057921 | 3300009176 | Bacteria | 3174 |
| 295 | Ga0105242_10143979 | 3300009176 | Bacteria | 2071 |
| 296 | Ga0105242_10236770 | 3300009176 | Bacteria | 1639 |
| 297 | Ga0105242_10972295 | 3300009176 | Unclassified | 855 |
| 298 | Ga0105242_11233705 | 3300009176 | Unclassified | 768 |
| 299 | Ga0105242_11271527 | 3300009176 | Bacteria | 758 |
| 300 | Ga0105248_10001520 | 3300009177 | Bacteria | 25812 |
| 301 | Ga0105248_10079497 | 3300009177 | Bacteria | 3686 |
| 302 | Ga0105248_10084319 | 3300009177 | Bacteria | 3574 |
| 303 | Ga0105248_10088785 | 3300009177 | Bacteria | 3479 |
| 304 | Ga0105248_10163207 | 3300009177 | Unclassified | 2512 |
| 305 | Ga0105248_10477785 | 3300009177 | Bacteria | 1405 |
| 306 | Ga0105248_10733657 | 3300009177 | Unclassified | 1115 |
| 307 | Ga0105248_10966032 | 3300009177 | Bacteria | 962 |
| 308 | Ga0105248_11542307 | 3300009177 | Bacteria | 752 |
| 309 | Ga0105237_10272351 | 3300009545 | Bacteria | 1696 |
| 310 | Ga0105237_10833675 | 3300009545 | Bacteria | 929 |
| 311 | Ga0105238_10038628 | 3300009551 | Bacteria | 4847 |
| 312 | Ga0105249_10150964 | 3300009553 | Unclassified | 2237 |
| 313 | Ga0105249_10199644 | 3300009553 | Bacteria | 1957 |
| 314 | Ga0105249_10449673 | 3300009553 | Bacteria | 1327 |
| 315 | Ga0105249_10685088 | 3300009553 | Bacteria | 1084 |
| 316 | Ga0105239_11104557 | 3300010375 | Bacteria | 913 |
| 317 | Ga0105239_11302357 | 3300010375 | Unclassified | 838 |
| 318 | Ga0105239_11347253 | 3300010375 | Bacteria | 823 |
| 319 | Ga0105246_11272292 | 3300011119 | Bacteria | 680 |
| 320 | Ga0157369_11215275 | 3300013105 | Bacteria | 769 |
| 321 | Ga0157374_10103311 | 3300013296 | Bacteria | 2734 |
| 322 | Ga0157374_12029313 | 3300013296 | Unclassified | 601 |
| 323 | Ga0157378_10167637 | 3300013297 | Unclassified | 2058 |
| 324 | Ga0157378_10301949 | 3300013297 | Bacteria | 1550 |
| 325 | Ga0157378_10392125 | 3300013297 | Unclassified | 1366 |
| 326 | Ga0157378_10704411 | 3300013297 | Unclassified | 1029 |
| 327 | Ga0163162_10105974 | 3300013306 | Bacteria | 2906 |
| 328 | Ga0163162_10227342 | 3300013306 | Unclassified | 1996 |
| 329 | Ga0163162_10600550 | 3300013306 | Bacteria | 1227 |
| 330 | Ga0157372_10634619 | 3300013307 | Bacteria | 1244 |
| 331 | Ga0157375_10099977 | 3300013308 | Bacteria | 2980 |
| 332 | Ga0157375_10108935 | 3300013308 | Bacteria | 2865 |
| 333 | Ga0157375_11287801 | 3300013308 | Bacteria | 859 |
| 334 | Ga0163163_10002362 | 3300014325 | Bacteria | 15969 |
| 335 | Ga0163163_10076945 | 3300014325 | Bacteria | 3332 |
| 336 | Ga0163163_10271672 | 3300014325 | Unclassified | 1746 |
| 337 | Ga0163163_11331606 | 3300014325 | Unclassified | 780 |
| 338 | Ga0157380_10085607 | 3300014326 | Unclassified | 2587 |
| 339 | Ga0157380_10088492 | 3300014326 | Bacteria | 2548 |
| 340 | Ga0157380_10174194 | 3300014326 | Bacteria | 1883 |
| 341 | Ga0157380_10454279 | 3300014326 | Bacteria | 1231 |
| 342 | Ga0157380_10458400 | 3300014326 | Bacteria | 1226 |
| 343 | Ga0157380_11039878 | 3300014326 | Unclassified | 855 |
| 344 | Ga0157380_12498293 | 3300014326 | Unclassified | 582 |
| 345 | Ga0157377_11027803 | 3300014745 | Bacteria | 626 |
| 346 | Ga0157377_11178686 | 3300014745 | Unclassified | 592 |
| 347 | Ga0157379_10008466 | 3300014968 | Bacteria | 8947 |
| 348 | Ga0157379_10100607 | 3300014968 | Bacteria | 2595 |
| 349 | Ga0157379_10351832 | 3300014968 | Bacteria | 1349 |
| 350 | Ga0157379_10770349 | 3300014968 | Bacteria | 907 |
| 351 | Ga0157379_11587829 | 3300014968 | Unclassified | 638 |
| 352 | Ga0157376_10003000 | 3300014969 | Bacteria | 11581 |
| 353 | Ga0157376_10005627 | 3300014969 | Bacteria | 8769 |
| 354 | Ga0157376_10033464 | 3300014969 | Bacteria | 4139 |
| 355 | Ga0157376_10112853 | 3300014969 | Bacteria | 2395 |
| 356 | Ga0157376_10253384 | 3300014969 | Bacteria | 1645 |
| 357 | Ga0157376_10527194 | 3300014969 | Bacteria | 1165 |
| 358 | Ga0157376_12036715 | 3300014969 | Unclassified | 612 |
| 359 | Ga0163161_10276673 | 3300017792 | Unclassified | 1315 |
| 360 | Ga0163161_10691982 | 3300017792 | Bacteria | 848 |
| 361 | Ga0206350_10238524 | 3300020080 | Bacteria | 539 |
| 362 | Ga0207697_10183827 | 3300025315 | Bacteria | 917 |
| 363 | Ga0207682_10062740 | 3300025893 | Bacteria | 1559 |
| 364 | Ga0207642_10016420 | 3300025899 | Bacteria | 2788 |
| 365 | Ga0207642_11062646 | 3300025899 | Unclassified | 523 |
| 366 | Ga0207710_10242787 | 3300025900 | Bacteria | 899 |
| 367 | Ga0207688_10028547 | 3300025901 | Unclassified | 3069 |
| 368 | Ga0207680_10012053 | 3300025903 | Bacteria | 4393 |
| 369 | Ga0207680_10016138 | 3300025903 | Bacteria | 3914 |
| 370 | Ga0207680_10052673 | 3300025903 | Bacteria | 2440 |
| 371 | Ga0207680_10126668 | 3300025903 | Unclassified | 1677 |
| 372 | Ga0207685_10665649 | 3300025905 | Unclassified | 564 |
| 373 | Ga0207699_10261803 | 3300025906 | Bacteria | 1196 |
| 374 | Ga0207645_10058984 | 3300025907 | Bacteria | 2451 |
| 375 | Ga0207645_10181749 | 3300025907 | Unclassified | 1380 |
| 376 | Ga0207645_10340146 | 3300025907 | Unclassified | 1003 |
| 377 | Ga0207645_10513293 | 3300025907 | Unclassified | 812 |
| 378 | Ga0207645_10904731 | 3300025907 | Unclassified | 599 |
| 379 | Ga0207684_10245858 | 3300025910 | Bacteria | 1544 |
| 380 | Ga0207684_10770727 | 3300025910 | Bacteria | 814 |
| 381 | Ga0207684_10889375 | 3300025910 | Bacteria | 749 |
| 382 | Ga0207684_11035191 | 3300025910 | Bacteria | 685 |
| 383 | Ga0207654_10083693 | 3300025911 | Bacteria | 1927 |
| 384 | Ga0207654_10315895 | 3300025911 | Bacteria | 1066 |
| 385 | Ga0207707_10096365 | 3300025912 | Bacteria | 2585 |
| 386 | Ga0207707_10365421 | 3300025912 | Bacteria | 1242 |
| 387 | Ga0207707_10561086 | 3300025912 | Bacteria | 969 |
| 388 | Ga0207695_10057917 | 3300025913 | Bacteria | 4024 |
| 389 | Ga0207695_10140240 | 3300025913 | Bacteria | 2366 |
| 390 | Ga0207695_10149476 | 3300025913 | Bacteria | 2276 |
| 391 | Ga0207695_10193738 | 3300025913 | Bacteria | 1949 |
| 392 | Ga0207671_10213152 | 3300025914 | Bacteria | 1511 |
| 393 | Ga0207671_10816727 | 3300025914 | Bacteria | 739 |
| 394 | Ga0207671_10929289 | 3300025914 | Unclassified | 687 |
| 395 | Ga0207660_11012960 | 3300025917 | Bacteria | 677 |
| 396 | Ga0207662_10063755 | 3300025918 | Bacteria | 2216 |
| 397 | Ga0207662_10420177 | 3300025918 | Unclassified | 910 |
| 398 | Ga0207657_10013707 | 3300025919 | Bacteria | 7938 |
| 399 | Ga0207649_10512829 | 3300025920 | Bacteria | 913 |
| 400 | Ga0207652_10067785 | 3300025921 | Bacteria | 3095 |
| 401 | Ga0207652_11130648 | 3300025921 | Bacteria | 684 |
| 402 | Ga0207646_10139140 | 3300025922 | Bacteria | 2186 |
| 403 | Ga0207646_10382851 | 3300025922 | Bacteria | 1271 |
| 404 | Ga0207646_10405508 | 3300025922 | Bacteria | 1231 |
| 405 | Ga0207646_10451982 | 3300025922 | Bacteria | 1159 |
| 406 | Ga0207681_10105502 | 3300025923 | Unclassified | 2040 |
| 407 | Ga0207681_10899938 | 3300025923 | Bacteria | 741 |
| 408 | Ga0207681_10945128 | 3300025923 | Unclassified | 723 |
| 409 | Ga0207694_10967337 | 3300025924 | Unclassified | 720 |
| 410 | Ga0207650_10086397 | 3300025925 | Bacteria | 2388 |
| 411 | Ga0207650_10311367 | 3300025925 | Bacteria | 1288 |
| 412 | Ga0207650_10333950 | 3300025925 | Bacteria | 1243 |
| 413 | Ga0207687_10005610 | 3300025927 | Bacteria | 8294 |
| 414 | Ga0207687_10016516 | 3300025927 | Bacteria | 4848 |
| 415 | Ga0207687_10111812 | 3300025927 | Bacteria | 2028 |
| 416 | Ga0207687_10973222 | 3300025927 | Unclassified | 727 |
| 417 | Ga0207687_11135110 | 3300025927 | Unclassified | 671 |
| 418 | Ga0207700_10221376 | 3300025928 | Unclassified | 1604 |
| 419 | Ga0207664_10040462 | 3300025929 | Bacteria | 3625 |
| 420 | Ga0207644_10079652 | 3300025931 | Bacteria | 2417 |
| 421 | Ga0207644_10106453 | 3300025931 | Bacteria | 2114 |
| 422 | Ga0207644_10685610 | 3300025931 | Unclassified | 854 |
| 423 | Ga0207690_10065447 | 3300025932 | Bacteria | 2486 |
| 424 | Ga0207690_10606998 | 3300025932 | Unclassified | 894 |
| 425 | Ga0207706_10026485 | 3300025933 | Bacteria | 5190 |
| 426 | Ga0207706_10378085 | 3300025933 | Bacteria | 1229 |
| 427 | Ga0207706_10396369 | 3300025933 | Bacteria | 1197 |
| 428 | Ga0207706_10457836 | 3300025933 | Unclassified | 1103 |
| 429 | Ga0207706_10841678 | 3300025933 | Bacteria | 777 |
| 430 | Ga0207686_10003728 | 3300025934 | Bacteria | 8173 |
| 431 | Ga0207686_10011750 | 3300025934 | Bacteria | 4802 |
| 432 | Ga0207686_10053537 | 3300025934 | Bacteria | 2523 |
| 433 | Ga0207686_10103642 | 3300025934 | Bacteria | 1904 |
| 434 | Ga0207686_10126340 | 3300025934 | Bacteria | 1748 |
| 435 | Ga0207686_10332392 | 3300025934 | Bacteria | 1139 |
| 436 | Ga0207709_10202294 | 3300025935 | Bacteria | 1419 |
| 437 | Ga0207709_10367943 | 3300025935 | Bacteria | 1090 |
| 438 | Ga0207709_11641727 | 3300025935 | Unclassified | 534 |
| 439 | Ga0207670_10180642 | 3300025936 | Bacteria | 1589 |
| 440 | Ga0207670_10254610 | 3300025936 | Unclassified | 1358 |
| 441 | Ga0207670_10276812 | 3300025936 | Bacteria | 1306 |
| 442 | Ga0207670_10327067 | 3300025936 | Bacteria | 1208 |
| 443 | Ga0207669_10171538 | 3300025937 | Bacteria | 1544 |
| 444 | Ga0207669_10293830 | 3300025937 | Bacteria | 1232 |
| 445 | Ga0207704_10047507 | 3300025938 | Bacteria | 2566 |
| 446 | Ga0207704_10400270 | 3300025938 | Bacteria | 1083 |
| 447 | Ga0207691_10045665 | 3300025940 | Bacteria | 4026 |
| 448 | Ga0207691_10103221 | 3300025940 | Bacteria | 2542 |
| 449 | Ga0207691_10138534 | 3300025940 | Bacteria | 2145 |
| 450 | Ga0207711_10009258 | 3300025941 | Bacteria | 8223 |
| 451 | Ga0207711_10010569 | 3300025941 | Bacteria | 7672 |
| 452 | Ga0207711_10360775 | 3300025941 | Unclassified | 1346 |
| 453 | Ga0207711_10511947 | 3300025941 | Bacteria | 1119 |
| 454 | Ga0207711_10738736 | 3300025941 | Bacteria | 918 |
| 455 | Ga0207711_11304305 | 3300025941 | Bacteria | 668 |
| 456 | Ga0207711_11307495 | 3300025941 | Bacteria | 667 |
| 457 | Ga0207689_10430139 | 3300025942 | Bacteria | 1102 |
| 458 | Ga0207661_10011981 | 3300025944 | Bacteria | 6299 |
| 459 | Ga0207661_10657478 | 3300025944 | Unclassified | 963 |
| 460 | Ga0207679_10246854 | 3300025945 | Bacteria | 1515 |
| 461 | Ga0207679_10251685 | 3300025945 | Unclassified | 1502 |
| 462 | Ga0207679_10251814 | 3300025945 | Bacteria | 1502 |
| 463 | Ga0207679_10311421 | 3300025945 | Unclassified | 1360 |
| 464 | Ga0207667_10870105 | 3300025949 | Unclassified | 894 |
| 465 | Ga0207651_10100180 | 3300025960 | Bacteria | 2148 |
| 466 | Ga0207651_10134178 | 3300025960 | Bacteria | 1901 |
| 467 | Ga0207651_10244351 | 3300025960 | Bacteria | 1465 |
| 468 | Ga0207651_10872576 | 3300025960 | Unclassified | 800 |
| 469 | Ga0207712_10043645 | 3300025961 | Bacteria | 3094 |
| 470 | Ga0207712_10044811 | 3300025961 | Bacteria | 3060 |
| 471 | Ga0207712_10430682 | 3300025961 | Bacteria | 1115 |
| 472 | Ga0207668_10019746 | 3300025972 | Bacteria | 4267 |
| 473 | Ga0207668_10053905 | 3300025972 | Bacteria | 2789 |
| 474 | Ga0207640_10004967 | 3300025981 | Bacteria | 7232 |
| 475 | Ga0207640_11167871 | 3300025981 | Unclassified | 683 |
| 476 | Ga0207658_10065949 | 3300025986 | Bacteria | 2721 |
| 477 | Ga0207658_10283542 | 3300025986 | Unclassified | 1421 |
| 478 | Ga0207658_10340326 | 3300025986 | Bacteria | 1304 |
| 479 | Ga0207658_10571963 | 3300025986 | Bacteria | 1013 |
| 480 | Ga0207677_10060548 | 3300026023 | Bacteria | 2617 |
| 481 | Ga0207677_10306272 | 3300026023 | Bacteria | 1314 |
| 482 | Ga0207677_10360054 | 3300026023 | Bacteria | 1222 |
| 483 | Ga0207677_10744258 | 3300026023 | Bacteria | 873 |
| 484 | Ga0207677_11195218 | 3300026023 | Unclassified | 696 |
| 485 | Ga0207703_10071163 | 3300026035 | Bacteria | 2872 |
| 486 | Ga0207703_10442094 | 3300026035 | Unclassified | 1213 |
| 487 | Ga0207703_10531658 | 3300026035 | Bacteria | 1107 |
| 488 | Ga0207703_11051856 | 3300026035 | Unclassified | 781 |
| 489 | Ga0207639_11379445 | 3300026041 | Bacteria | 661 |
| 490 | Ga0207708_10032003 | 3300026075 | Bacteria | 3993 |
| 491 | Ga0207708_10337514 | 3300026075 | Bacteria | 1233 |
| 492 | Ga0207708_10538345 | 3300026075 | Unclassified | 983 |
| 493 | Ga0207708_10691169 | 3300026075 | Unclassified | 871 |
| 494 | Ga0207708_10714530 | 3300026075 | Bacteria | 857 |
| 495 | Ga0207641_10000409 | 3300026088 | Bacteria | 50240 |
| 496 | Ga0207641_10223522 | 3300026088 | Bacteria | 1747 |
| 497 | Ga0207641_10998164 | 3300026088 | Bacteria | 834 |
| 498 | Ga0207648_10016299 | 3300026089 | Bacteria | 6794 |
| 499 | Ga0207648_10231522 | 3300026089 | Bacteria | 1643 |
| 500 | Ga0207648_10677017 | 3300026089 | Bacteria | 955 |
| 501 | Ga0207648_11068992 | 3300026089 | Bacteria | 756 |
| 502 | Ga0207676_10022651 | 3300026095 | Bacteria | 4621 |
| 503 | Ga0207676_11120418 | 3300026095 | Unclassified | 778 |
| 504 | Ga0207674_10087223 | 3300026116 | Bacteria | 3115 |
| 505 | Ga0207674_10274214 | 3300026116 | Bacteria | 1634 |
| 506 | Ga0207675_100044993 | 3300026118 | Bacteria | 4124 |
| 507 | Ga0207675_100102955 | 3300026118 | Bacteria | 2690 |
| 508 | Ga0207675_100541528 | 3300026118 | Bacteria | 1162 |
| 509 | Ga0207675_100658214 | 3300026118 | Bacteria | 1054 |
| 510 | Ga0207675_100661992 | 3300026118 | Bacteria | 1051 |
| 511 | Ga0207675_100874014 | 3300026118 | Bacteria | 914 |
| 512 | Ga0207675_100960003 | 3300026118 | Bacteria | 872 |
| 513 | Ga0207675_101493076 | 3300026118 | Bacteria | 697 |
| 514 | Ga0207683_10028853 | 3300026121 | Bacteria | 4801 |
| 515 | Ga0207683_10090290 | 3300026121 | Bacteria | 2728 |
| 516 | Ga0207683_10371555 | 3300026121 | Unclassified | 1314 |
| 517 | Ga0207683_10931314 | 3300026121 | Bacteria | 807 |
| 518 | Ga0207698_10361555 | 3300026142 | Unclassified | 1375 |
| 519 | Ga0207698_11287098 | 3300026142 | Bacteria | 746 |
| 520 | Ga0207428_10000022 | 3300027907 | Bacteria | 273333 |
| 521 | Ga0207428_10043263 | 3300027907 | Unclassified | 3638 |
| 522 | Ga0268266_10032844 | 3300028379 | Bacteria | 4410 |
| 523 | Ga0268266_10033346 | 3300028379 | Bacteria | 4377 |
| 524 | Ga0268266_10048341 | 3300028379 | Bacteria | 3646 |
| 525 | Ga0268266_11495191 | 3300028379 | Unclassified | 651 |
| 526 | Ga0268265_10045567 | 3300028380 | Unclassified | 3273 |
| 527 | Ga0268265_10458438 | 3300028380 | Unclassified | 1192 |
| 528 | Ga0268265_10780022 | 3300028380 | Unclassified | 930 |
| 529 | Ga0268265_10961418 | 3300028380 | Bacteria | 842 |
| 530 | Ga0268265_11011319 | 3300028380 | Unclassified | 821 |
| 531 | Ga0268264_10175281 | 3300028381 | Bacteria | 1943 |
| 532 | Ga0268264_10217406 | 3300028381 | Bacteria | 1758 |
| 533 | Ga0268264_10689980 | 3300028381 | Unclassified | 1013 |
| 534 | Ga0268264_10753744 | 3300028381 | Bacteria | 970 |
| 535 | Ga0268264_10903078 | 3300028381 | Unclassified | 887 |
| 536 | Ga0268264_11254498 | 3300028381 | Bacteria | 751 |
| 537 | Ga0265314_10108617 | 3300031711 | Bacteria | 1767 |
| 538 | Ga0373930_0011012 | 3300034816 | Bacteria | 1626 |
| 539 | Ga0373948_0000440 | 3300034817 | Bacteria | 5140 |
| 540 | Ga0373950_0000944 | 3300034818 | Unclassified | 3678 |
| 541 | Ga0373958_0001739 | 3300034819 | Bacteria | 2958 |
| 542 | Ga0373958_0059256 | 3300034819 | Bacteria | 826 |
| 543 | Ga0373959_0002963 | 3300034820 | Bacteria | 2696 |
| 544 | Ga0373938_0000829 | 3300034957 | Bacteria | 4994 |
| 545 | Ga0373938_0093415 | 3300034957 | Unclassified | 747 |
| 546 | Ga0373929_0001288 | 3300035085 | Bacteria | 4844 |
| 547 | Ga0373934_0053214 | 3300035086 | Bacteria | 1606 |
| 548 | Ga0373934_0371962 | 3300035086 | Unclassified | 596 |
| 549 | Ga0373940_0001530 | 3300035088 | Bacteria | 4218 |
| 550 | Ga0373940_0165575 | 3300035088 | Unclassified | 712 |
| 551 | Ga0373949_0001914 | 3300035090 | Bacteria | 5623 |
| 552 | Ga0373951_0007763 | 3300035091 | Unclassified | 2434 |
| 553 | Ga0373952_0008447 | 3300035092 | Bacteria | 1955 |
| 554 | Ga0373932_0001883 | 3300035112 | Bacteria | 5607 |
| 555 | Ga0373939_0004389 | 3300035114 | Bacteria | 3332 |
| 556 | Ga0373941_0000682 | 3300035115 | Bacteria | 6907 |
| 557 | Ga0373945_0025158 | 3300035116 | Unclassified | 2067 |
| 558 | Ga0373945_0154212 | 3300035116 | Bacteria | 933 |
| 559 | Ga0373957_0130457 | 3300035120 | Unclassified | 1023 |
| 560 | Ga0373960_0001092 | 3300035121 | Bacteria | 5874 |
| 561 | Ga0373943_0402001 | 3300035170 | Bacteria | 791 |
| 562 | Ga0373946_0039785 | 3300035171 | Unclassified | 1921 |
| 563 | Ga0373955_0155423 | 3300035172 | Bacteria | 1347 |
| 564 | Ga0373955_0164196 | 3300035172 | Bacteria | 1312 |
| 565 | Ga0373942_0002521 | 3300035207 | Bacteria | 4434 |
| 566 | Ga0373961_0002143 | 3300035241 | Bacteria | 5237 |
| 567 | Ga0373962_0001173 | 3300035242 | Bacteria | 6127 |
| 568 | Ga0373962_0049677 | 3300035242 | Bacteria | 1206 |
| 569 | Ga0373962_0088519 | 3300035242 | Unclassified | 950 |
| 570 | Ga0373931_0004099 | 3300035691 | Bacteria | 6611 |
| 571 | Ga0373931_0304200 | 3300035691 | Bacteria | 986 |
| 572 | Ga0373931_0468274 | 3300035691 | Unclassified | 808 |
| 573 | Ga0373935_1275824 | 3300035692 | Unclassified | 548 |
| 574 | Ga0373927_0252943 | 3300035695 | Bacteria | 1158 |
| 575 | Ga0373933_0212880 | 3300035724 | Bacteria | 1239 |
| 576 | Ga0373933_0585883 | 3300035724 | Bacteria | 732 |
| 577 | Ga0373937_0078586 | 3300036401 | Bacteria | 3049 |
| 578 | Ga0373937_0079910 | 3300036401 | Bacteria | 3023 |
| 579 | Ga0373937_0624090 | 3300036401 | Bacteria | 1023 |
| 580 | Ga0373925_0462159 | 3300037068 | Unclassified | 1040 |
| 581 | Ga0373925_1533968 | 3300037068 | Unclassified | 545 |
| 582 | Ga0436365_0560402 | 3300039437 | Bacteria | 2893 |
| 583 | Ga0466963_0013024 | 3300044694 | Bacteria | 5098 |
| 584 | Ga0451576_0024123 | 3300045051 | Bacteria | 6571 |
| 585 | Ga0451576_0296635 | 3300045051 | Bacteria | 1690 |
| 586 | Ga0451576_1030893 | 3300045051 | Unclassified | 862 |
| 587 | Ga0466958_0815828 | 3300045836 | Bacteria | 608 |
| 588 | Ga0495603_0385882 | 3300046455 | Unclassified | 803 |
| 589 | Ga0495651_0442437 | 3300046462 | Bacteria | 841 |
| 590 | Ga0495653_0638420 | 3300046463 | Unclassified | 651 |
| 591 | Ga0495582_0207423 | 3300046473 | Unclassified | 1120 |
| 592 | Ga0495664_0456919 | 3300046477 | Unclassified | 765 |
| 593 | Ga0495585_0407659 | 3300046492 | Bacteria | 654 |
| 594 | Ga0495628_0123131 | 3300046516 | Bacteria | 1988 |
| 595 | Ga0495628_0261459 | 3300046516 | Unclassified | 1290 |
| 596 | Ga0495642_0047484 | 3300046528 | Unclassified | 1759 |
| 597 | Ga0495652_0280352 | 3300046529 | Bacteria | 1221 |
| 598 | Ga0495640_0066661 | 3300046533 | Bacteria | 2428 |
| 599 | Ga0495640_0165846 | 3300046533 | Bacteria | 1413 |
| 600 | Ga0495598_0112521 | 3300046537 | Bacteria | 914 |
| 601 | Ga0495667_0448398 | 3300046559 | Bacteria | 811 |
| 602 | Ga0495656_0354468 | 3300046615 | Unclassified | 761 |
| 603 | Ga0495635_0361741 | 3300046663 | Unclassified | 967 |
| 604 | Ga0495659_0044209 | 3300046664 | Bacteria | 1601 |
| 605 | Ga0495647_0010795 | 3300046681 | Bacteria | 3119 |
| 606 | Ga0495658_0068189 | 3300046683 | Bacteria | 2059 |
| 607 | Ga0495658_0265983 | 3300046683 | Viruses | 1080 |
| 608 | Ga0495658_0278542 | 3300046683 | Unclassified | 1055 |
| 609 | Ga0495658_0580589 | 3300046683 | Unclassified | 718 |
| 610 | Ga0495669_0078873 | 3300046684 | Unclassified | 1509 |
| 611 | Ga0495669_0262984 | 3300046684 | Unclassified | 829 |
| 612 | Ga0495600_0149796 | 3300046809 | Bacteria | 1511 |
| 613 | Ga0495604_0143892 | 3300047317 | Bacteria | 1701 |
| 614 | Ga0495674_0672013 | 3300047319 | Bacteria | 815 |
| 615 | Ga0495674_0974245 | 3300047319 | Unclassified | 651 |
| 616 | Ga0496100_0000944 | 3300048903 | Bacteria | 13902 |
| 617 | Ga0496100_0436842 | 3300048903 | Unclassified | 1002 |
| 618 | Ga0496100_0676023 | 3300048903 | Bacteria | 805 |
| 619 | Ga0496100_0724089 | 3300048903 | Unclassified | 777 |
| 620 | Ga0496101_0001899 | 3300048904 | Bacteria | 12622 |
| 621 | Ga0496101_0144681 | 3300048904 | Bacteria | 1815 |
| 622 | Ga0496101_0646701 | 3300048904 | Unclassified | 835 |
| 623 | Ga0496102_0506596 | 3300048905 | Bacteria | 1129 |
| 624 | Ga0496102_1302553 | 3300048905 | Unclassified | 646 |
| 625 | Ga0496103_0270038 | 3300048906 | Bacteria | 1094 |
| 626 | Ga0496103_0857183 | 3300048906 | Bacteria | 571 |
| 627 | Ga0496104_0132771 | 3300048907 | Bacteria | 2392 |
| 628 | Ga0496104_0279070 | 3300048907 | Bacteria | 1584 |
| 629 | Ga0496104_0298908 | 3300048907 | Unclassified | 1522 |
| 630 | Ga0496104_1100407 | 3300048907 | Bacteria | 698 |
| 631 | Ga0496104_1126867 | 3300048907 | Unclassified | 688 |
| 632 | Ga0496105_0021862 | 3300048908 | Bacteria | 5178 |
| 633 | Ga0496105_0255395 | 3300048908 | Bacteria | 1419 |
| 634 | Ga0496105_0369823 | 3300048908 | Bacteria | 1142 |
| 635 | Ga0496106_0079923 | 3300048909 | Bacteria | 2511 |
| 636 | Ga0496106_0120690 | 3300048909 | Bacteria | 2049 |
| 637 | Ga0496107_0195217 | 3300048910 | Bacteria | 1504 |
| 638 | Ga0496107_0214035 | 3300048910 | Bacteria | 1433 |
| 639 | Ga0496108_0012961 | 3300048911 | Bacteria | 6792 |
| 640 | Ga0496108_0559543 | 3300048911 | Bacteria | 997 |
| 641 | Ga0496108_0618193 | 3300048911 | Bacteria | 943 |
| 642 | Ga0496109_0241984 | 3300048912 | Bacteria | 1698 |
| 643 | Ga0496109_0619944 | 3300048912 | Bacteria | 1018 |
| 644 | Ga0496110_0100033 | 3300048913 | Bacteria | 2599 |
| 645 | Ga0496110_0183516 | 3300048913 | Unclassified | 1900 |
| 646 | Ga0496111_0656292 | 3300048914 | Bacteria | 765 |
| 647 | Ga0496112_0049109 | 3300048915 | Bacteria | 4135 |
| 648 | Ga0496112_0263438 | 3300048915 | Bacteria | 1673 |
| 649 | Ga0496112_1201335 | 3300048915 | Unclassified | 675 |
| 650 | Ga0496113_0027293 | 3300048916 | Bacteria | 4092 |
| 651 | Ga0496114_0020828 | 3300048917 | Bacteria | 5324 |
| 652 | Ga0496114_0138992 | 3300048917 | Bacteria | 2102 |
| 653 | Ga0496114_0690913 | 3300048917 | Unclassified | 895 |
| 654 | Ga0496115_0038754 | 3300048918 | Bacteria | 3783 |
| 655 | Ga0501036_0903194 | 3300049572 | Bacteria | 725 |
| 656 | Ga0501039_0181342 | 3300049575 | Unclassified | 1656 |
| 657 | Ga0501072_0998305 | 3300049588 | Bacteria | 652 |
| 658 | Ga0501076_0263985 | 3300049592 | Bacteria | 1410 |
| 659 | nmdc:mga05p37_11396_c1 | 3300050507 | Bacteria | 10581 |
| 660 | nmdc:mga05p37_14016_c1 | 3300050507 | Bacteria | 9615 |
| 661 | nmdc:mga05p37_172089_c1 | 3300050507 | Bacteria | 2641 |
| 662 | nmdc:mga05p37_17354_c1 | 3300050507 | Bacteria | 8684 |
| 663 | nmdc:mga05p37_226164_c1 | 3300050507 | Bacteria | 2256 |
| 664 | nmdc:mga05p37_24324_c1 | 3300050507 | Bacteria | 7360 |
| 665 | nmdc:mga05p37_277160_c1 | 3300050507 | Bacteria | 2002 |
| 666 | nmdc:mga05p37_296117_c1 | 3300050507 | Unclassified | 1924 |
| 667 | nmdc:mga05p37_511413_c1 | 3300050507 | Bacteria | 1376 |
| 668 | nmdc:mga05p37_70327_c1 | 3300050507 | Bacteria | 4304 |
| 669 | nmdc:mga05p37_780222_c1 | 3300050507 | Bacteria | 1049 |
| 670 | nmdc:mga09592_21615_c2 | 3300050508 | Bacteria | 3254 |
| 671 | nmdc:mga09592_493833_c1 | 3300050508 | Bacteria | 1054 |
| 672 | nmdc:mga09592_933250_c1 | 3300050508 | Unclassified | 728 |
| 673 | nmdc:mga06r32_118024_c1 | 3300050510 | Bacteria | 2615 |
| 674 | nmdc:mga06r32_238483_c1 | 3300050510 | Bacteria | 1806 |
| 675 | nmdc:mga06r32_63954_c1 | 3300050510 | Unclassified | 3547 |
| 676 | nmdc:mga08y16_1274313_c1 | 3300050511 | Bacteria | 703 |
| 677 | nmdc:mga08y16_18129_c1 | 3300050511 | Bacteria | 7416 |
| 678 | nmdc:mga08y16_1978066_c1 | 3300050511 | Bacteria | 532 |
| 679 | nmdc:mga08y16_21_c1 | 3300050511 | Bacteria | 254790 |
| 680 | nmdc:mga08y16_340131_c1 | 3300050511 | Bacteria | 1543 |
| 681 | nmdc:mga08y16_37358_c1 | 3300050511 | Bacteria | 5101 |
| 682 | nmdc:mga08y16_716563_c1 | 3300050511 | Bacteria | 999 |
| 683 | nmdc:mga0n895_10_c1 | 3300050512 | Bacteria | 115544 |
| 684 | nmdc:mga0n895_174577_c1 | 3300050512 | Bacteria | 2180 |
| 685 | nmdc:mga0n895_254453_c1 | 3300050512 | Bacteria | 1782 |
| 686 | nmdc:mga0n895_372908_c1 | 3300050512 | Bacteria | 1444 |
| 687 | nmdc:mga0n895_38575_c1 | 3300050512 | Unclassified | 4630 |
| 688 | nmdc:mga0n895_39426_c1 | 3300050512 | Bacteria | 4583 |
| 689 | nmdc:mga0n895_439219_c1 | 3300050512 | Bacteria | 1318 |
| 690 | nmdc:mga0n895_476758_c1 | 3300050512 | Unclassified | 1259 |
| 691 | nmdc:mga0n895_499117_c1 | 3300050512 | Bacteria | 1226 |
| 692 | nmdc:mga0n895_549338_c1 | 3300050512 | Bacteria | 1161 |
| 693 | nmdc:mga0rr50_103167_c1 | 3300050513 | Bacteria | 2244 |
| 694 | nmdc:mga0rr50_124049_c1 | 3300050513 | Unclassified | 2060 |
| 695 | nmdc:mga0rr50_137975_c1 | 3300050513 | Bacteria | 1959 |
| 696 | nmdc:mga0rr50_1670720_c1 | 3300050513 | Unclassified | 537 |
| 697 | nmdc:mga0rr50_1933_c1 | 3300050513 | Bacteria | 11522 |
| 698 | nmdc:mga0rr50_20_c1 | 3300050513 | Bacteria | 140799 |
| 699 | nmdc:mga0rr50_240957_c1 | 3300050513 | Bacteria | 1499 |
| 700 | nmdc:mga0rr50_299275_c1 | 3300050513 | Bacteria | 1345 |
| 701 | nmdc:mga0rr50_60767_c1 | 3300050513 | Bacteria | 2844 |
| 702 | nmdc:mga08x19_121175_c1 | 3300050514 | Bacteria | 1754 |
| 703 | nmdc:mga08x19_1236768_c1 | 3300050514 | Unclassified | 529 |
| 704 | nmdc:mga08x19_155532_c1 | 3300050514 | Bacteria | 1550 |
| 705 | nmdc:mga08x19_24787_c1 | 3300050514 | Bacteria | 3732 |
| 706 | nmdc:mga08x19_319_c1 | 3300050514 | Bacteria | 34836 |
| 707 | nmdc:mga08x19_38503_c1 | 3300050514 | Unclassified | 3038 |
| 708 | nmdc:mga08x19_388156_c1 | 3300050514 | Bacteria | 978 |
| 709 | nmdc:mga08x19_695905_c1 | 3300050514 | Bacteria | 721 |
| 710 | nmdc:mga08x19_7727_c1 | 3300050514 | Bacteria | 6387 |
| 711 | nmdc:mga0a205_16668_c1 | 3300050515 | Bacteria | 6881 |
| 712 | nmdc:mga0a205_191661_c1 | 3300050515 | Unclassified | 1936 |
| 713 | nmdc:mga0a205_652307_c1 | 3300050515 | Unclassified | 904 |
| 714 | nmdc:mga0a205_825211_c1 | 3300050515 | Unclassified | 775 |
| 715 | nmdc:mga0a205_87111_c1 | 3300050515 | Bacteria | 3017 |
| 716 | Ga0495601_0138533 | 3300053077 | Bacteria | 1587 |
| 717 | Ga0495601_0148880 | 3300053077 | Bacteria | 1528 |
| 718 | Ga0495601_0279647 | 3300053077 | Bacteria | 1088 |
| 719 | Ga0495601_0455427 | 3300053077 | Unclassified | 827 |
| 720 | Ga0495612_0319906 | 3300053078 | Bacteria | 698 |
| 721 | Ga0495595_0056068 | 3300053084 | Unclassified | 1836 |
| 722 | Ga0495595_0076666 | 3300053084 | Unclassified | 1587 |
| 723 | Ga0495595_0150828 | 3300053084 | Bacteria | 1144 |
| 724 | Ga0495619_0010785 | 3300053085 | Bacteria | 5750 |
| 725 | Ga0495619_0103811 | 3300053085 | Unclassified | 1937 |
| 726 | Ga0500658_0300173 | 3300053134 | Unclassified | 738 |
| 727 | Ga0501084_0185310 | 3300054114 | Bacteria | 1757 |
| 728 | Ga0530510_0227236 | 3300061734 | Unclassified | 1388 |
| 729 | Ga0530510_1219117 | 3300061734 | Bacteria | 577 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035092 | Ga0373952_0008447 | Ga0373952_0008447_14_448 | 129 |
| 2 | 3300007076 | Ga0075435_102030348 | Ga0075435_1020303481 | 134 |
| 3 | 3300025937 | Ga0207669_10293830 | Ga0207669_102938303 | 136 |
| 4 | 3300050511 | nmdc:mga08y16_1978066_c1 | nmdc:mga08y16_1978066_c1_11_478 | 136 |
| 5 | 3300006871 | Ga0075434_101146006 | Ga0075434_1011460061 | 138 |
| 6 | 3300005365 | Ga0070688_100248469 | Ga0070688_1002484692 | 139 |
| 7 | 3300005438 | Ga0070701_10620954 | Ga0070701_106209542 | 139 |
| 8 | 3300005546 | Ga0070696_101215242 | Ga0070696_1012152422 | 139 |
| 9 | 3300005578 | Ga0068854_100159208 | Ga0068854_1001592084 | 139 |
| 10 | 3300005578 | Ga0068854_100355577 | Ga0068854_1003555772 | 139 |
| 11 | 3300005617 | Ga0068859_100110799 | Ga0068859_1001107993 | 139 |
| 12 | 3300006844 | Ga0075428_100935433 | Ga0075428_1009354332 | 139 |
| 13 | 3300006846 | Ga0075430_100825898 | Ga0075430_1008258981 | 139 |
| 14 | 3300006852 | Ga0075433_10429002 | Ga0075433_104290022 | 139 |
| 15 | 3300006880 | Ga0075429_100627333 | Ga0075429_1006273332 | 139 |
| 16 | 3300006914 | Ga0075436_100029792 | Ga0075436_1000297922 | 139 |
| 17 | 3300006931 | Ga0097620_100110791 | Ga0097620_1001107914 | 139 |
| 18 | 3300025936 | Ga0207670_10276812 | Ga0207670_102768123 | 139 |
| 19 | 3300050514 | nmdc:mga08x19_24787_c1 | nmdc:mga08x19_24787_c1_18_524 | 139 |
| 20 | 3300014968 | Ga0157379_10770349 | Ga0157379_107703492 | 140 |
| 21 | 3300009147 | Ga0114129_10015041 | Ga0114129_1001504113 | 142 |
| 22 | 3300009545 | Ga0105237_10833675 | Ga0105237_108336752 | 142 |
| 23 | 3300050513 | nmdc:mga0rr50_124049_c1 | nmdc:mga0rr50_124049_c1_1571_2038 | 142 |
| 24 | 3300050514 | nmdc:mga08x19_7727_c1 | nmdc:mga08x19_7727_c1_2964_3431 | 142 |
| 25 | 3300050515 | nmdc:mga0a205_16668_c1 | nmdc:mga0a205_16668_c1_3757_4224 | 142 |
| 26 | 3300005535 | Ga0070684_100502300 | Ga0070684_1005023003 | 149 |
| 27 | 3300005536 | Ga0070697_100674575 | Ga0070697_1006745752 | 149 |
| 28 | 3300005546 | Ga0070696_100657387 | Ga0070696_1006573872 | 149 |
| 29 | 3300005563 | Ga0068855_100285795 | Ga0068855_1002857954 | 149 |
| 30 | 3300005578 | Ga0068854_100205010 | Ga0068854_1002050102 | 149 |
| 31 | 3300005614 | Ga0068856_100041738 | Ga0068856_1000417385 | 149 |
| 32 | 3300006871 | Ga0075434_100541510 | Ga0075434_1005415103 | 149 |
| 33 | 3300007076 | Ga0075435_100021209 | Ga0075435_1000212095 | 149 |
| 34 | 3300009093 | Ga0105240_10216820 | Ga0105240_102168204 | 149 |
| 35 | 3300009098 | Ga0105245_10122846 | Ga0105245_101228463 | 149 |
| 36 | 3300009176 | Ga0105242_10972295 | Ga0105242_109722952 | 149 |
| 37 | 3300009177 | Ga0105248_10966032 | Ga0105248_109660322 | 149 |
| 38 | 3300025905 | Ga0207685_10665649 | Ga0207685_106656491 | 149 |
| 39 | 3300025914 | Ga0207671_10929289 | Ga0207671_109292892 | 149 |
| 40 | 3300025934 | Ga0207686_10332392 | Ga0207686_103323923 | 149 |
| 41 | 3300025941 | Ga0207711_10511947 | Ga0207711_105119471 | 149 |
| 42 | 3300025941 | Ga0207711_11304305 | Ga0207711_113043051 | 149 |
| 43 | 3300025944 | Ga0207661_10011981 | Ga0207661_100119815 | 149 |
| 44 | 3300025949 | Ga0207667_10870105 | Ga0207667_108701052 | 149 |
| 45 | 3300025981 | Ga0207640_11167871 | Ga0207640_111678711 | 149 |
| 46 | 3300049572 | Ga0501036_0903194 | Ga0501036_0903194_176_640 | 149 |
| 47 | 3300049575 | Ga0501039_0181342 | Ga0501039_0181342_278_742 | 149 |
| 48 | 3300049588 | Ga0501072_0998305 | Ga0501072_0998305_92_556 | 149 |
| 49 | 3300049592 | Ga0501076_0263985 | Ga0501076_0263985_37_513 | 149 |
| 50 | 3300050512 | nmdc:mga0n895_499117_c1 | nmdc:mga0n895_499117_c1_182_652 | 149 |
| 51 | 3300050513 | nmdc:mga0rr50_103167_c1 | nmdc:mga0rr50_103167_c1_286_756 | 149 |
| 52 | 3300050514 | nmdc:mga08x19_695905_c1 | nmdc:mga08x19_695905_c1_234_701 | 149 |
| 53 | 3300054114 | Ga0501084_0185310 | Ga0501084_0185310_263_739 | 149 |
| 54 | 3300061734 | Ga0530510_0227236 | Ga0530510_0227236_44_508 | 149 |
| 55 | 3300005289 | Ga0065704_10309473 | Ga0065704_103094731 | 150 |
| 56 | 3300005293 | Ga0065715_10008955 | Ga0065715_100089554 | 150 |
| 57 | 3300005328 | Ga0070676_10732885 | Ga0070676_107328851 | 150 |
| 58 | 3300005330 | Ga0070690_100689438 | Ga0070690_1006894382 | 150 |
| 59 | 3300005331 | Ga0070670_100385630 | Ga0070670_1003856302 | 150 |
| 60 | 3300005334 | Ga0068869_100663065 | Ga0068869_1006630652 | 150 |
| 61 | 3300005335 | Ga0070666_10020939 | Ga0070666_100209397 | 150 |
| 62 | 3300005335 | Ga0070666_10200812 | Ga0070666_102008122 | 150 |
| 63 | 3300005336 | Ga0070680_101038433 | Ga0070680_1010384331 | 150 |
| 64 | 3300005338 | Ga0068868_100016138 | Ga0068868_1000161386 | 150 |
| 65 | 3300005338 | Ga0068868_100029482 | Ga0068868_1000294824 | 150 |
| 66 | 3300005338 | Ga0068868_100786000 | Ga0068868_1007860001 | 150 |
| 67 | 3300005340 | Ga0070689_100152789 | Ga0070689_1001527891 | 150 |
| 68 | 3300005347 | Ga0070668_100145233 | Ga0070668_1001452333 | 150 |
| 69 | 3300005353 | Ga0070669_100008803 | Ga0070669_1000088039 | 150 |
| 70 | 3300005353 | Ga0070669_100069820 | Ga0070669_1000698203 | 150 |
| 71 | 3300005354 | Ga0070675_100153447 | Ga0070675_1001534473 | 150 |
| 72 | 3300005355 | Ga0070671_100022694 | Ga0070671_1000226942 | 150 |
| 73 | 3300005355 | Ga0070671_100393607 | Ga0070671_1003936071 | 150 |
| 74 | 3300005355 | Ga0070671_100942501 | Ga0070671_1009425011 | 150 |
| 75 | 3300005356 | Ga0070674_100108568 | Ga0070674_1001085684 | 150 |
| 76 | 3300005356 | Ga0070674_100150230 | Ga0070674_1001502302 | 150 |
| 77 | 3300005356 | Ga0070674_100271766 | Ga0070674_1002717662 | 150 |
| 78 | 3300005364 | Ga0070673_100314915 | Ga0070673_1003149151 | 150 |
| 79 | 3300005364 | Ga0070673_100374824 | Ga0070673_1003748243 | 150 |
| 80 | 3300005364 | Ga0070673_100565925 | Ga0070673_1005659253 | 150 |
| 81 | 3300005365 | Ga0070688_100105316 | Ga0070688_1001053163 | 150 |
| 82 | 3300005367 | Ga0070667_100038020 | Ga0070667_1000380203 | 150 |
| 83 | 3300005367 | Ga0070667_100360609 | Ga0070667_1003606092 | 150 |
| 84 | 3300005438 | Ga0070701_10305087 | Ga0070701_103050871 | 150 |
| 85 | 3300005438 | Ga0070701_10403681 | Ga0070701_104036811 | 150 |
| 86 | 3300005440 | Ga0070705_100510647 | Ga0070705_1005106471 | 150 |
| 87 | 3300005441 | Ga0070700_100194041 | Ga0070700_1001940414 | 150 |
| 88 | 3300005444 | Ga0070694_100018134 | Ga0070694_1000181345 | 150 |
| 89 | 3300005444 | Ga0070694_100106599 | Ga0070694_1001065993 | 150 |
| 90 | 3300005445 | Ga0070708_100036911 | Ga0070708_1000369113 | 150 |
| 91 | 3300005445 | Ga0070708_100642728 | Ga0070708_1006427282 | 150 |
| 92 | 3300005456 | Ga0070678_100173014 | Ga0070678_1001730142 | 150 |
| 93 | 3300005456 | Ga0070678_100357755 | Ga0070678_1003577553 | 150 |
| 94 | 3300005457 | Ga0070662_100456949 | Ga0070662_1004569492 | 150 |
| 95 | 3300005458 | Ga0070681_10834860 | Ga0070681_108348602 | 150 |
| 96 | 3300005459 | Ga0068867_100250438 | Ga0068867_1002504382 | 150 |
| 97 | 3300005459 | Ga0068867_100625023 | Ga0068867_1006250232 | 150 |
| 98 | 3300005467 | Ga0070706_100826941 | Ga0070706_1008269412 | 150 |
| 99 | 3300005467 | Ga0070706_100987075 | Ga0070706_1009870751 | 150 |
| 100 | 3300005468 | Ga0070707_100102237 | Ga0070707_1001022375 | 150 |
| 101 | 3300005468 | Ga0070707_100106459 | Ga0070707_1001064594 | 150 |
| 102 | 3300005468 | Ga0070707_100413052 | Ga0070707_1004130523 | 150 |
| 103 | 3300005468 | Ga0070707_101706518 | Ga0070707_1017065181 | 150 |
| 104 | 3300005471 | Ga0070698_100056676 | Ga0070698_1000566764 | 150 |
| 105 | 3300005518 | Ga0070699_100014967 | Ga0070699_1000149671 | 150 |
| 106 | 3300005518 | Ga0070699_100074390 | Ga0070699_1000743903 | 150 |
| 107 | 3300005518 | Ga0070699_100081960 | Ga0070699_1000819604 | 150 |
| 108 | 3300005536 | Ga0070697_100764836 | Ga0070697_1007648362 | 150 |
| 109 | 3300005543 | Ga0070672_100002128 | Ga0070672_10000212811 | 150 |
| 110 | 3300005543 | Ga0070672_100147334 | Ga0070672_1001473343 | 150 |
| 111 | 3300005544 | Ga0070686_100070078 | Ga0070686_1000700784 | 150 |
| 112 | 3300005544 | Ga0070686_100093777 | Ga0070686_1000937771 | 150 |
| 113 | 3300005544 | Ga0070686_100187636 | Ga0070686_1001876363 | 150 |
| 114 | 3300005545 | Ga0070695_100006549 | Ga0070695_1000065496 | 150 |
| 115 | 3300005546 | Ga0070696_100085226 | Ga0070696_1000852264 | 150 |
| 116 | 3300005546 | Ga0070696_100156796 | Ga0070696_1001567963 | 150 |
| 117 | 3300005546 | Ga0070696_100168474 | Ga0070696_1001684742 | 150 |
| 118 | 3300005547 | Ga0070693_100217419 | Ga0070693_1002174191 | 150 |
| 119 | 3300005548 | Ga0070665_100014048 | Ga0070665_1000140487 | 150 |
| 120 | 3300005548 | Ga0070665_100022599 | Ga0070665_1000225994 | 150 |
| 121 | 3300005549 | Ga0070704_100029626 | Ga0070704_1000296263 | 150 |
| 122 | 3300005549 | Ga0070704_100861213 | Ga0070704_1008612131 | 150 |
| 123 | 3300005563 | Ga0068855_100292620 | Ga0068855_1002926202 | 150 |
| 124 | 3300005564 | Ga0070664_100200107 | Ga0070664_1002001073 | 150 |
| 125 | 3300005615 | Ga0070702_100307945 | Ga0070702_1003079451 | 150 |
| 126 | 3300005616 | Ga0068852_100393989 | Ga0068852_1003939892 | 150 |
| 127 | 3300005617 | Ga0068859_100004413 | Ga0068859_1000044133 | 150 |
| 128 | 3300005617 | Ga0068859_100139856 | Ga0068859_1001398564 | 150 |
| 129 | 3300005617 | Ga0068859_100828231 | Ga0068859_1008282312 | 150 |
| 130 | 3300005718 | Ga0068866_10025138 | Ga0068866_100251383 | 150 |
| 131 | 3300005718 | Ga0068866_11255111 | Ga0068866_112551111 | 150 |
| 132 | 3300005719 | Ga0068861_100012934 | Ga0068861_1000129343 | 150 |
| 133 | 3300005719 | Ga0068861_100072744 | Ga0068861_1000727444 | 150 |
| 134 | 3300005719 | Ga0068861_100142405 | Ga0068861_1001424052 | 150 |
| 135 | 3300005719 | Ga0068861_100703915 | Ga0068861_1007039152 | 150 |
| 136 | 3300005840 | Ga0068870_10293112 | Ga0068870_102931123 | 150 |
| 137 | 3300005841 | Ga0068863_101894779 | Ga0068863_1018947791 | 150 |
| 138 | 3300005842 | Ga0068858_100012051 | Ga0068858_1000120518 | 150 |
| 139 | 3300005842 | Ga0068858_100071308 | Ga0068858_1000713084 | 150 |
| 140 | 3300005842 | Ga0068858_100409361 | Ga0068858_1004093613 | 150 |
| 141 | 3300005843 | Ga0068860_100069823 | Ga0068860_1000698235 | 150 |
| 142 | 3300005843 | Ga0068860_100120363 | Ga0068860_1001203633 | 150 |
| 143 | 3300005844 | Ga0068862_100028651 | Ga0068862_1000286516 | 150 |
| 144 | 3300005844 | Ga0068862_100194662 | Ga0068862_1001946623 | 150 |
| 145 | 3300005844 | Ga0068862_101162696 | Ga0068862_1011626962 | 150 |
| 146 | 3300006173 | Ga0070716_100543294 | Ga0070716_1005432942 | 150 |
| 147 | 3300006237 | Ga0097621_100021404 | Ga0097621_1000214044 | 150 |
| 148 | 3300006237 | Ga0097621_100057424 | Ga0097621_1000574244 | 150 |
| 149 | 3300006237 | Ga0097621_100132474 | Ga0097621_1001324743 | 150 |
| 150 | 3300006237 | Ga0097621_100186678 | Ga0097621_1001866783 | 150 |
| 151 | 3300006237 | Ga0097621_100222990 | Ga0097621_1002229903 | 150 |
| 152 | 3300006237 | Ga0097621_100418628 | Ga0097621_1004186283 | 150 |
| 153 | 3300006237 | Ga0097621_100654898 | Ga0097621_1006548981 | 150 |
| 154 | 3300006358 | Ga0068871_100055205 | Ga0068871_1000552053 | 150 |
| 155 | 3300006358 | Ga0068871_100057193 | Ga0068871_1000571933 | 150 |
| 156 | 3300006358 | Ga0068871_100141055 | Ga0068871_1001410554 | 150 |
| 157 | 3300006358 | Ga0068871_100155946 | Ga0068871_1001559464 | 150 |
| 158 | 3300006358 | Ga0068871_100214812 | Ga0068871_1002148123 | 150 |
| 159 | 3300006358 | Ga0068871_100540775 | Ga0068871_1005407752 | 150 |
| 160 | 3300006358 | Ga0068871_101454766 | Ga0068871_1014547661 | 150 |
| 161 | 3300006844 | Ga0075428_100000007 | Ga0075428_10000000786 | 150 |
| 162 | 3300006844 | Ga0075428_100106189 | Ga0075428_1001061895 | 150 |
| 163 | 3300006844 | Ga0075428_100831261 | Ga0075428_1008312611 | 150 |
| 164 | 3300006847 | Ga0075431_100013395 | Ga0075431_1000133957 | 150 |
| 165 | 3300006847 | Ga0075431_100048384 | Ga0075431_1000483841 | 150 |
| 166 | 3300006852 | Ga0075433_10098369 | Ga0075433_100983694 | 150 |
| 167 | 3300006852 | Ga0075433_10180809 | Ga0075433_101808093 | 150 |
| 168 | 3300006852 | Ga0075433_10220526 | Ga0075433_102205262 | 150 |
| 169 | 3300006852 | Ga0075433_10869367 | Ga0075433_108693672 | 150 |
| 170 | 3300006871 | Ga0075434_100041050 | Ga0075434_1000410504 | 150 |
| 171 | 3300006871 | Ga0075434_100164745 | Ga0075434_1001647453 | 150 |
| 172 | 3300006871 | Ga0075434_101532064 | Ga0075434_1015320641 | 150 |
| 173 | 3300006871 | Ga0075434_101628579 | Ga0075434_1016285791 | 150 |
| 174 | 3300006880 | Ga0075429_100149587 | Ga0075429_1001495872 | 150 |
| 175 | 3300006880 | Ga0075429_100598858 | Ga0075429_1005988582 | 150 |
| 176 | 3300006880 | Ga0075429_100618383 | Ga0075429_1006183832 | 150 |
| 177 | 3300006881 | Ga0068865_100210965 | Ga0068865_1002109652 | 150 |
| 178 | 3300006881 | Ga0068865_100337974 | Ga0068865_1003379742 | 150 |
| 179 | 3300006881 | Ga0068865_101290534 | Ga0068865_1012905342 | 150 |
| 180 | 3300006914 | Ga0075436_100021857 | Ga0075436_1000218572 | 150 |
| 181 | 3300006914 | Ga0075436_100028943 | Ga0075436_1000289434 | 150 |
| 182 | 3300006914 | Ga0075436_100697747 | Ga0075436_1006977471 | 150 |
| 183 | 3300006931 | Ga0097620_100004413 | Ga0097620_1000044133 | 150 |
| 184 | 3300006931 | Ga0097620_100139860 | Ga0097620_1001398604 | 150 |
| 185 | 3300006931 | Ga0097620_100828117 | Ga0097620_1008281172 | 150 |
| 186 | 3300007076 | Ga0075435_100528562 | Ga0075435_1005285622 | 150 |
| 187 | 3300007076 | Ga0075435_101118762 | Ga0075435_1011187622 | 150 |
| 188 | 3300009093 | Ga0105240_10062935 | Ga0105240_100629353 | 150 |
| 189 | 3300009094 | Ga0111539_10000009 | Ga0111539_1000000919 | 150 |
| 190 | 3300009094 | Ga0111539_10093939 | Ga0111539_100939393 | 150 |
| 191 | 3300009094 | Ga0111539_10596571 | Ga0111539_105965713 | 150 |
| 192 | 3300009094 | Ga0111539_10747835 | Ga0111539_107478353 | 150 |
| 193 | 3300009094 | Ga0111539_11104190 | Ga0111539_111041903 | 150 |
| 194 | 3300009098 | Ga0105245_10006254 | Ga0105245_1000625410 | 150 |
| 195 | 3300009098 | Ga0105245_10010096 | Ga0105245_100100965 | 150 |
| 196 | 3300009098 | Ga0105245_11210980 | Ga0105245_112109802 | 150 |
| 197 | 3300009098 | Ga0105245_11417869 | Ga0105245_114178691 | 150 |
| 198 | 3300009101 | Ga0105247_11351083 | Ga0105247_113510831 | 150 |
| 199 | 3300009147 | Ga0114129_10004706 | Ga0114129_1000470614 | 150 |
| 200 | 3300009147 | Ga0114129_10007723 | Ga0114129_100077235 | 150 |
| 201 | 3300009147 | Ga0114129_10009392 | Ga0114129_100093926 | 150 |
| 202 | 3300009147 | Ga0114129_10015597 | Ga0114129_100155975 | 150 |
| 203 | 3300009147 | Ga0114129_10048650 | Ga0114129_100486504 | 150 |
| 204 | 3300009147 | Ga0114129_10059158 | Ga0114129_100591585 | 150 |
| 205 | 3300009147 | Ga0114129_10195958 | Ga0114129_101959582 | 150 |
| 206 | 3300009147 | Ga0114129_10541827 | Ga0114129_105418272 | 150 |
| 207 | 3300009148 | Ga0105243_10008653 | Ga0105243_100086535 | 150 |
| 208 | 3300009148 | Ga0105243_10191534 | Ga0105243_101915344 | 150 |
| 209 | 3300009148 | Ga0105243_10372456 | Ga0105243_103724563 | 150 |
| 210 | 3300009148 | Ga0105243_10487293 | Ga0105243_104872932 | 150 |
| 211 | 3300009148 | Ga0105243_10747343 | Ga0105243_107473432 | 150 |
| 212 | 3300009148 | Ga0105243_11398444 | Ga0105243_113984441 | 150 |
| 213 | 3300009174 | Ga0105241_10661645 | Ga0105241_106616452 | 150 |
| 214 | 3300009176 | Ga0105242_10057921 | Ga0105242_100579213 | 150 |
| 215 | 3300009176 | Ga0105242_10143979 | Ga0105242_101439793 | 150 |
| 216 | 3300009176 | Ga0105242_10236770 | Ga0105242_102367703 | 150 |
| 217 | 3300009176 | Ga0105242_11233705 | Ga0105242_112337051 | 150 |
| 218 | 3300009176 | Ga0105242_11271527 | Ga0105242_112715272 | 150 |
| 219 | 3300009177 | Ga0105248_10079497 | Ga0105248_100794975 | 150 |
| 220 | 3300009177 | Ga0105248_10084319 | Ga0105248_100843192 | 150 |
| 221 | 3300009177 | Ga0105248_10088785 | Ga0105248_100887855 | 150 |
| 222 | 3300009177 | Ga0105248_10163207 | Ga0105248_101632073 | 150 |
| 223 | 3300009545 | Ga0105237_10272351 | Ga0105237_102723514 | 150 |
| 224 | 3300009551 | Ga0105238_10038628 | Ga0105238_100386281 | 150 |
| 225 | 3300009553 | Ga0105249_10150964 | Ga0105249_101509644 | 150 |
| 226 | 3300009553 | Ga0105249_10199644 | Ga0105249_101996443 | 150 |
| 227 | 3300009553 | Ga0105249_10449673 | Ga0105249_104496732 | 150 |
| 228 | 3300010375 | Ga0105239_11302357 | Ga0105239_113023572 | 150 |
| 229 | 3300013296 | Ga0157374_10103311 | Ga0157374_101033115 | 150 |
| 230 | 3300013296 | Ga0157374_12029313 | Ga0157374_120293132 | 150 |
| 231 | 3300013297 | Ga0157378_10167637 | Ga0157378_101676373 | 150 |
| 232 | 3300013297 | Ga0157378_10392125 | Ga0157378_103921252 | 150 |
| 233 | 3300013306 | Ga0163162_10105974 | Ga0163162_101059744 | 150 |
| 234 | 3300013306 | Ga0163162_10227342 | Ga0163162_102273424 | 150 |
| 235 | 3300013306 | Ga0163162_10600550 | Ga0163162_106005502 | 150 |
| 236 | 3300013308 | Ga0157375_10099977 | Ga0157375_100999772 | 150 |
| 237 | 3300013308 | Ga0157375_10108935 | Ga0157375_101089355 | 150 |
| 238 | 3300014325 | Ga0163163_11331606 | Ga0163163_113316062 | 150 |
| 239 | 3300014326 | Ga0157380_10088492 | Ga0157380_100884924 | 150 |
| 240 | 3300014326 | Ga0157380_10454279 | Ga0157380_104542793 | 150 |
| 241 | 3300014326 | Ga0157380_10458400 | Ga0157380_104584002 | 150 |
| 242 | 3300014326 | Ga0157380_11039878 | Ga0157380_110398782 | 150 |
| 243 | 3300014326 | Ga0157380_12498293 | Ga0157380_124982931 | 150 |
| 244 | 3300014745 | Ga0157377_11027803 | Ga0157377_110278032 | 150 |
| 245 | 3300014968 | Ga0157379_10008466 | Ga0157379_100084662 | 150 |
| 246 | 3300014969 | Ga0157376_10003000 | Ga0157376_100030007 | 150 |
| 247 | 3300014969 | Ga0157376_10005627 | Ga0157376_100056275 | 150 |
| 248 | 3300014969 | Ga0157376_10253384 | Ga0157376_102533842 | 150 |
| 249 | 3300017792 | Ga0163161_10276673 | Ga0163161_102766733 | 150 |
| 250 | 3300017792 | Ga0163161_10691982 | Ga0163161_106919822 | 150 |
| 251 | 3300025899 | Ga0207642_10016420 | Ga0207642_100164203 | 150 |
| 252 | 3300025899 | Ga0207642_11062646 | Ga0207642_110626461 | 150 |
| 253 | 3300025901 | Ga0207688_10028547 | Ga0207688_100285472 | 150 |
| 254 | 3300025903 | Ga0207680_10012053 | Ga0207680_100120535 | 150 |
| 255 | 3300025903 | Ga0207680_10052673 | Ga0207680_100526731 | 150 |
| 256 | 3300025903 | Ga0207680_10126668 | Ga0207680_101266681 | 150 |
| 257 | 3300025907 | Ga0207645_10181749 | Ga0207645_101817493 | 150 |
| 258 | 3300025907 | Ga0207645_10513293 | Ga0207645_105132932 | 150 |
| 259 | 3300025907 | Ga0207645_10904731 | Ga0207645_109047312 | 150 |
| 260 | 3300025910 | Ga0207684_10770727 | Ga0207684_107707271 | 150 |
| 261 | 3300025910 | Ga0207684_10889375 | Ga0207684_108893751 | 150 |
| 262 | 3300025911 | Ga0207654_10315895 | Ga0207654_103158952 | 150 |
| 263 | 3300025912 | Ga0207707_10365421 | Ga0207707_103654212 | 150 |
| 264 | 3300025912 | Ga0207707_10561086 | Ga0207707_105610862 | 150 |
| 265 | 3300025913 | Ga0207695_10193738 | Ga0207695_101937383 | 150 |
| 266 | 3300025914 | Ga0207671_10213152 | Ga0207671_102131523 | 150 |
| 267 | 3300025918 | Ga0207662_10063755 | Ga0207662_100637554 | 150 |
| 268 | 3300025922 | Ga0207646_10139140 | Ga0207646_101391404 | 150 |
| 269 | 3300025922 | Ga0207646_10405508 | Ga0207646_104055083 | 150 |
| 270 | 3300025923 | Ga0207681_10105502 | Ga0207681_101055022 | 150 |
| 271 | 3300025923 | Ga0207681_10899938 | Ga0207681_108999382 | 150 |
| 272 | 3300025924 | Ga0207694_10967337 | Ga0207694_109673371 | 150 |
| 273 | 3300025925 | Ga0207650_10311367 | Ga0207650_103113673 | 150 |
| 274 | 3300025927 | Ga0207687_10005610 | Ga0207687_100056104 | 150 |
| 275 | 3300025927 | Ga0207687_10016516 | Ga0207687_100165164 | 150 |
| 276 | 3300025927 | Ga0207687_11135110 | Ga0207687_111351102 | 150 |
| 277 | 3300025931 | Ga0207644_10106453 | Ga0207644_101064533 | 150 |
| 278 | 3300025931 | Ga0207644_10685610 | Ga0207644_106856102 | 150 |
| 279 | 3300025932 | Ga0207690_10606998 | Ga0207690_106069982 | 150 |
| 280 | 3300025933 | Ga0207706_10378085 | Ga0207706_103780851 | 150 |
| 281 | 3300025933 | Ga0207706_10396369 | Ga0207706_103963692 | 150 |
| 282 | 3300025933 | Ga0207706_10457836 | Ga0207706_104578362 | 150 |
| 283 | 3300025934 | Ga0207686_10003728 | Ga0207686_100037287 | 150 |
| 284 | 3300025934 | Ga0207686_10011750 | Ga0207686_100117505 | 150 |
| 285 | 3300025934 | Ga0207686_10126340 | Ga0207686_101263403 | 150 |
| 286 | 3300025935 | Ga0207709_10202294 | Ga0207709_102022942 | 150 |
| 287 | 3300025935 | Ga0207709_10367943 | Ga0207709_103679433 | 150 |
| 288 | 3300025935 | Ga0207709_11641727 | Ga0207709_116417271 | 150 |
| 289 | 3300025936 | Ga0207670_10180642 | Ga0207670_101806423 | 150 |
| 290 | 3300025936 | Ga0207670_10254610 | Ga0207670_102546103 | 150 |
| 291 | 3300025937 | Ga0207669_10171538 | Ga0207669_101715382 | 150 |
| 292 | 3300025938 | Ga0207704_10047507 | Ga0207704_100475073 | 150 |
| 293 | 3300025938 | Ga0207704_10400270 | Ga0207704_104002702 | 150 |
| 294 | 3300025940 | Ga0207691_10045665 | Ga0207691_100456653 | 150 |
| 295 | 3300025940 | Ga0207691_10103221 | Ga0207691_101032213 | 150 |
| 296 | 3300025941 | Ga0207711_10010569 | Ga0207711_100105697 | 150 |
| 297 | 3300025941 | Ga0207711_10360775 | Ga0207711_103607753 | 150 |
| 298 | 3300025942 | Ga0207689_10430139 | Ga0207689_104301393 | 150 |
| 299 | 3300025945 | Ga0207679_10251685 | Ga0207679_102516853 | 150 |
| 300 | 3300025945 | Ga0207679_10251814 | Ga0207679_102518142 | 150 |
| 301 | 3300025960 | Ga0207651_10100180 | Ga0207651_101001803 | 150 |
| 302 | 3300025960 | Ga0207651_10244351 | Ga0207651_102443513 | 150 |
| 303 | 3300025960 | Ga0207651_10872576 | Ga0207651_108725761 | 150 |
| 304 | 3300025961 | Ga0207712_10043645 | Ga0207712_100436451 | 150 |
| 305 | 3300025961 | Ga0207712_10430682 | Ga0207712_104306821 | 150 |
| 306 | 3300025972 | Ga0207668_10019746 | Ga0207668_100197461 | 150 |
| 307 | 3300025986 | Ga0207658_10065949 | Ga0207658_100659493 | 150 |
| 308 | 3300025986 | Ga0207658_10283542 | Ga0207658_102835423 | 150 |
| 309 | 3300025986 | Ga0207658_10340326 | Ga0207658_103403263 | 150 |
| 310 | 3300026023 | Ga0207677_10060548 | Ga0207677_100605483 | 150 |
| 311 | 3300026023 | Ga0207677_10306272 | Ga0207677_103062723 | 150 |
| 312 | 3300026035 | Ga0207703_10442094 | Ga0207703_104420942 | 150 |
| 313 | 3300026035 | Ga0207703_11051856 | Ga0207703_110518562 | 150 |
| 314 | 3300026075 | Ga0207708_10538345 | Ga0207708_105383452 | 150 |
| 315 | 3300026075 | Ga0207708_10691169 | Ga0207708_106911692 | 150 |
| 316 | 3300026088 | Ga0207641_10000409 | Ga0207641_1000040925 | 150 |
| 317 | 3300026088 | Ga0207641_10223522 | Ga0207641_102235224 | 150 |
| 318 | 3300026089 | Ga0207648_10016299 | Ga0207648_100162996 | 150 |
| 319 | 3300026089 | Ga0207648_10231522 | Ga0207648_102315223 | 150 |
| 320 | 3300026089 | Ga0207648_10677017 | Ga0207648_106770172 | 150 |
| 321 | 3300026089 | Ga0207648_11068992 | Ga0207648_110689922 | 150 |
| 322 | 3300026116 | Ga0207674_10274214 | Ga0207674_102742141 | 150 |
| 323 | 3300026118 | Ga0207675_100044993 | Ga0207675_1000449934 | 150 |
| 324 | 3300026118 | Ga0207675_100102955 | Ga0207675_1001029553 | 150 |
| 325 | 3300026118 | Ga0207675_100541528 | Ga0207675_1005415282 | 150 |
| 326 | 3300026118 | Ga0207675_100658214 | Ga0207675_1006582142 | 150 |
| 327 | 3300026118 | Ga0207675_100661992 | Ga0207675_1006619923 | 150 |
| 328 | 3300026118 | Ga0207675_100960003 | Ga0207675_1009600032 | 150 |
| 329 | 3300026121 | Ga0207683_10028853 | Ga0207683_100288533 | 150 |
| 330 | 3300026121 | Ga0207683_10090290 | Ga0207683_100902903 | 150 |
| 331 | 3300026121 | Ga0207683_10931314 | Ga0207683_109313141 | 150 |
| 332 | 3300026142 | Ga0207698_10361555 | Ga0207698_103615552 | 150 |
| 333 | 3300026142 | Ga0207698_11287098 | Ga0207698_112870982 | 150 |
| 334 | 3300027907 | Ga0207428_10000022 | Ga0207428_1000002286 | 150 |
| 335 | 3300027907 | Ga0207428_10043263 | Ga0207428_100432632 | 150 |
| 336 | 3300028379 | Ga0268266_10032844 | Ga0268266_100328444 | 150 |
| 337 | 3300028379 | Ga0268266_10048341 | Ga0268266_100483413 | 150 |
| 338 | 3300028380 | Ga0268265_10045567 | Ga0268265_100455674 | 150 |
| 339 | 3300028380 | Ga0268265_10458438 | Ga0268265_104584383 | 150 |
| 340 | 3300028380 | Ga0268265_10961418 | Ga0268265_109614182 | 150 |
| 341 | 3300028381 | Ga0268264_10175281 | Ga0268264_101752813 | 150 |
| 342 | 3300028381 | Ga0268264_10689980 | Ga0268264_106899802 | 150 |
| 343 | 3300028381 | Ga0268264_11254498 | Ga0268264_112544982 | 150 |
| 344 | 3300034957 | Ga0373938_0093415 | Ga0373938_0093415_62_529 | 150 |
| 345 | 3300035088 | Ga0373940_0165575 | Ga0373940_0165575_181_648 | 150 |
| 346 | 3300035242 | Ga0373962_0088519 | Ga0373962_0088519_35_502 | 150 |
| 347 | 3300035691 | Ga0373931_0304200 | Ga0373931_0304200_454_921 | 150 |
| 348 | 3300035691 | Ga0373931_0468274 | Ga0373931_0468274_212_679 | 150 |
| 349 | 3300039437 | Ga0436365_0560402 | Ga0436365_0560402_975_1451 | 150 |
| 350 | 3300044694 | Ga0466963_0013024 | Ga0466963_0013024_1200_1730 | 150 |
| 351 | 3300045051 | Ga0451576_1030893 | Ga0451576_1030893_142_615 | 150 |
| 352 | 3300045836 | Ga0466958_0815828 | Ga0466958_0815828_97_579 | 150 |
| 353 | 3300046537 | Ga0495598_0112521 | Ga0495598_0112521_59_526 | 150 |
| 354 | 3300046615 | Ga0495656_0354468 | Ga0495656_0354468_15_479 | 150 |
| 355 | 3300046663 | Ga0495635_0361741 | Ga0495635_0361741_31_507 | 150 |
| 356 | 3300046664 | Ga0495659_0044209 | Ga0495659_0044209_394_867 | 150 |
| 357 | 3300048903 | Ga0496100_0436842 | Ga0496100_0436842_304_771 | 150 |
| 358 | 3300048903 | Ga0496100_0676023 | Ga0496100_0676023_215_691 | 150 |
| 359 | 3300048904 | Ga0496101_0646701 | Ga0496101_0646701_31_498 | 150 |
| 360 | 3300048905 | Ga0496102_0506596 | Ga0496102_0506596_612_1088 | 150 |
| 361 | 3300048905 | Ga0496102_1302553 | Ga0496102_1302553_157_633 | 150 |
| 362 | 3300048906 | Ga0496103_0857183 | Ga0496103_0857183_27_491 | 150 |
| 363 | 3300048907 | Ga0496104_0279070 | Ga0496104_0279070_827_1294 | 150 |
| 364 | 3300048907 | Ga0496104_0298908 | Ga0496104_0298908_395_859 | 150 |
| 365 | 3300048907 | Ga0496104_1100407 | Ga0496104_1100407_17_481 | 150 |
| 366 | 3300048907 | Ga0496104_1126867 | Ga0496104_1126867_111_578 | 150 |
| 367 | 3300048908 | Ga0496105_0255395 | Ga0496105_0255395_862_1326 | 150 |
| 368 | 3300048909 | Ga0496106_0079923 | Ga0496106_0079923_212_679 | 150 |
| 369 | 3300048910 | Ga0496107_0214035 | Ga0496107_0214035_494_961 | 150 |
| 370 | 3300048912 | Ga0496109_0619944 | Ga0496109_0619944_63_530 | 150 |
| 371 | 3300048913 | Ga0496110_0183516 | Ga0496110_0183516_251_718 | 150 |
| 372 | 3300050507 | nmdc:mga05p37_14016_c1 | nmdc:mga05p37_14016_c1_7641_8117 | 150 |
| 373 | 3300050507 | nmdc:mga05p37_172089_c1 | nmdc:mga05p37_172089_c1_784_1257 | 150 |
| 374 | 3300050507 | nmdc:mga05p37_17354_c1 | nmdc:mga05p37_17354_c1_74_538 | 150 |
| 375 | 3300050507 | nmdc:mga05p37_226164_c1 | nmdc:mga05p37_226164_c1_689_1162 | 150 |
| 376 | 3300050507 | nmdc:mga05p37_24324_c1 | nmdc:mga05p37_24324_c1_2230_2700 | 150 |
| 377 | 3300050507 | nmdc:mga05p37_277160_c1 | nmdc:mga05p37_277160_c1_823_1296 | 150 |
| 378 | 3300050507 | nmdc:mga05p37_511413_c1 | nmdc:mga05p37_511413_c1_660_1136 | 150 |
| 379 | 3300050508 | nmdc:mga09592_21615_c2 | nmdc:mga09592_21615_c2_1657_2133 | 150 |
| 380 | 3300050508 | nmdc:mga09592_933250_c1 | nmdc:mga09592_933250_c1_12_482 | 150 |
| 381 | 3300050510 | nmdc:mga06r32_118024_c1 | nmdc:mga06r32_118024_c1_1714_2190 | 150 |
| 382 | 3300050510 | nmdc:mga06r32_63954_c1 | nmdc:mga06r32_63954_c1_1267_1758 | 150 |
| 383 | 3300050511 | nmdc:mga08y16_1274313_c1 | nmdc:mga08y16_1274313_c1_139_603 | 150 |
| 384 | 3300050511 | nmdc:mga08y16_18129_c1 | nmdc:mga08y16_18129_c1_954_1421 | 150 |
| 385 | 3300050511 | nmdc:mga08y16_21_c1 | nmdc:mga08y16_21_c1_162225_162716 | 150 |
| 386 | 3300050511 | nmdc:mga08y16_37358_c1 | nmdc:mga08y16_37358_c1_228_695 | 150 |
| 387 | 3300050512 | nmdc:mga0n895_254453_c1 | nmdc:mga0n895_254453_c1_742_1209 | 150 |
| 388 | 3300050512 | nmdc:mga0n895_372908_c1 | nmdc:mga0n895_372908_c1_810_1274 | 150 |
| 389 | 3300050512 | nmdc:mga0n895_39426_c1 | nmdc:mga0n895_39426_c1_2519_2983 | 150 |
| 390 | 3300050512 | nmdc:mga0n895_549338_c1 | nmdc:mga0n895_549338_c1_61_528 | 150 |
| 391 | 3300050513 | nmdc:mga0rr50_1670720_c1 | nmdc:mga0rr50_1670720_c1_23_493 | 150 |
| 392 | 3300050513 | nmdc:mga0rr50_240957_c1 | nmdc:mga0rr50_240957_c1_692_1156 | 150 |
| 393 | 3300050513 | nmdc:mga0rr50_60767_c1 | nmdc:mga0rr50_60767_c1_443_931 | 150 |
| 394 | 3300050514 | nmdc:mga08x19_121175_c1 | nmdc:mga08x19_121175_c1_871_1347 | 150 |
| 395 | 3300050514 | nmdc:mga08x19_1236768_c1 | nmdc:mga08x19_1236768_c1_23_502 | 150 |
| 396 | 3300050514 | nmdc:mga08x19_38503_c1 | nmdc:mga08x19_38503_c1_2245_2715 | 150 |
| 397 | 3300050515 | nmdc:mga0a205_191661_c1 | nmdc:mga0a205_191661_c1_430_903 | 150 |
| 398 | 3300050515 | nmdc:mga0a205_652307_c1 | nmdc:mga0a205_652307_c1_175_651 | 150 |
| 399 | 3300050515 | nmdc:mga0a205_825211_c1 | nmdc:mga0a205_825211_c1_35_502 | 150 |
| 400 | 3300050515 | nmdc:mga0a205_87111_c1 | nmdc:mga0a205_87111_c1_1767_2231 | 150 |
| 401 | 3300053077 | Ga0495601_0279647 | Ga0495601_0279647_508_984 | 150 |
| 402 | 3300061734 | Ga0530510_1219117 | Ga0530510_1219117_14_475 | 150 |
| 403 | 3300005434 | Ga0070709_10493408 | Ga0070709_104934082 | 151 |
| 404 | 3300005467 | Ga0070706_101245726 | Ga0070706_1012457261 | 151 |
| 405 | 3300005468 | Ga0070707_100128094 | Ga0070707_1001280943 | 151 |
| 406 | 3300005536 | Ga0070697_100040806 | Ga0070697_1000408063 | 151 |
| 407 | 3300006871 | Ga0075434_100014854 | Ga0075434_1000148545 | 151 |
| 408 | 3300014968 | Ga0157379_11587829 | Ga0157379_115878291 | 151 |
| 409 | 3300025906 | Ga0207699_10261803 | Ga0207699_102618033 | 151 |
| 410 | 3300025910 | Ga0207684_11035191 | Ga0207684_110351911 | 151 |
| 411 | 3300025922 | Ga0207646_10451982 | Ga0207646_104519822 | 151 |
| 412 | 3300026121 | Ga0207683_10371555 | Ga0207683_103715553 | 151 |
| 413 | 3300046528 | Ga0495642_0047484 | Ga0495642_0047484_812_1339 | 151 |
| 414 | 3300050512 | nmdc:mga0n895_38575_c1 | nmdc:mga0n895_38575_c1_1295_1795 | 151 |
| 415 | 3300005337 | Ga0070682_100431594 | Ga0070682_1004315941 | 152 |
| 416 | 3300005343 | Ga0070687_100182483 | Ga0070687_1001824833 | 152 |
| 417 | 3300005347 | Ga0070668_100268044 | Ga0070668_1002680443 | 152 |
| 418 | 3300005353 | Ga0070669_100361940 | Ga0070669_1003619401 | 152 |
| 419 | 3300005441 | Ga0070700_100109117 | Ga0070700_1001091172 | 152 |
| 420 | 3300005441 | Ga0070700_100906851 | Ga0070700_1009068511 | 152 |
| 421 | 3300005468 | Ga0070707_100561210 | Ga0070707_1005612102 | 152 |
| 422 | 3300005539 | Ga0068853_100805322 | Ga0068853_1008053221 | 152 |
| 423 | 3300005543 | Ga0070672_100637720 | Ga0070672_1006377201 | 152 |
| 424 | 3300005545 | Ga0070695_100110168 | Ga0070695_1001101681 | 152 |
| 425 | 3300005547 | Ga0070693_100218155 | Ga0070693_1002181552 | 152 |
| 426 | 3300005615 | Ga0070702_100693488 | Ga0070702_1006934881 | 152 |
| 427 | 3300005844 | Ga0068862_100109126 | Ga0068862_1001091263 | 152 |
| 428 | 3300006237 | Ga0097621_100034551 | Ga0097621_1000345514 | 152 |
| 429 | 3300006847 | Ga0075431_100089929 | Ga0075431_1000899295 | 152 |
| 430 | 3300007076 | Ga0075435_100016194 | Ga0075435_1000161946 | 152 |
| 431 | 3300007076 | Ga0075435_101341200 | Ga0075435_1013412001 | 152 |
| 432 | 3300007265 | Ga0099794_10263078 | Ga0099794_102630782 | 152 |
| 433 | 3300009098 | Ga0105245_10230764 | Ga0105245_102307643 | 152 |
| 434 | 3300009147 | Ga0114129_10407884 | Ga0114129_104078843 | 152 |
| 435 | 3300009147 | Ga0114129_10668027 | Ga0114129_106680274 | 152 |
| 436 | 3300009147 | Ga0114129_11386554 | Ga0114129_113865541 | 152 |
| 437 | 3300009148 | Ga0105243_11329237 | Ga0105243_113292371 | 152 |
| 438 | 3300009177 | Ga0105248_10733657 | Ga0105248_107336572 | 152 |
| 439 | 3300009553 | Ga0105249_10685088 | Ga0105249_106850882 | 152 |
| 440 | 3300014326 | Ga0157380_10174194 | Ga0157380_101741944 | 152 |
| 441 | 3300014745 | Ga0157377_11178686 | Ga0157377_111786861 | 152 |
| 442 | 3300014968 | Ga0157379_10351832 | Ga0157379_103518321 | 152 |
| 443 | 3300025907 | Ga0207645_10058984 | Ga0207645_100589843 | 152 |
| 444 | 3300025918 | Ga0207662_10420177 | Ga0207662_104201772 | 152 |
| 445 | 3300025922 | Ga0207646_10382851 | Ga0207646_103828512 | 152 |
| 446 | 3300025927 | Ga0207687_10111812 | Ga0207687_101118123 | 152 |
| 447 | 3300025933 | Ga0207706_10026485 | Ga0207706_100264856 | 152 |
| 448 | 3300025934 | Ga0207686_10103642 | Ga0207686_101036423 | 152 |
| 449 | 3300025940 | Ga0207691_10138534 | Ga0207691_101385342 | 152 |
| 450 | 3300025961 | Ga0207712_10044811 | Ga0207712_100448114 | 152 |
| 451 | 3300025972 | Ga0207668_10053905 | Ga0207668_100539053 | 152 |
| 452 | 3300026075 | Ga0207708_10032003 | Ga0207708_100320032 | 152 |
| 453 | 3300026075 | Ga0207708_10714530 | Ga0207708_107145302 | 152 |
| 454 | 3300028379 | Ga0268266_11495191 | Ga0268266_114951911 | 152 |
| 455 | 3300028380 | Ga0268265_11011319 | Ga0268265_110113192 | 152 |
| 456 | 3300034816 | Ga0373930_0011012 | Ga0373930_0011012_227_730 | 152 |
| 457 | 3300035724 | Ga0373933_0585883 | Ga0373933_0585883_17_487 | 152 |
| 458 | 3300036401 | Ga0373937_0624090 | Ga0373937_0624090_371_841 | 152 |
| 459 | 3300037068 | Ga0373925_0462159 | Ga0373925_0462159_415_882 | 152 |
| 460 | 3300037068 | Ga0373925_1533968 | Ga0373925_1533968_51_521 | 152 |
| 461 | 3300045051 | Ga0451576_0296635 | Ga0451576_0296635_765_1241 | 152 |
| 462 | 3300046455 | Ga0495603_0385882 | Ga0495603_0385882_18_485 | 152 |
| 463 | 3300046473 | Ga0495582_0207423 | Ga0495582_0207423_58_525 | 152 |
| 464 | 3300046683 | Ga0495658_0068189 | Ga0495658_0068189_1488_1955 | 152 |
| 465 | 3300048903 | Ga0496100_0000944 | Ga0496100_0000944_2204_2779 | 152 |
| 466 | 3300048904 | Ga0496101_0001899 | Ga0496101_0001899_5974_6549 | 152 |
| 467 | 3300048908 | Ga0496105_0021862 | Ga0496105_0021862_2818_3339 | 152 |
| 468 | 3300048917 | Ga0496114_0020828 | Ga0496114_0020828_3666_4241 | 152 |
| 469 | 3300048918 | Ga0496115_0038754 | Ga0496115_0038754_1663_2238 | 152 |
| 470 | 3300050507 | nmdc:mga05p37_296117_c1 | nmdc:mga05p37_296117_c1_74_559 | 152 |
| 471 | 3300050507 | nmdc:mga05p37_780222_c1 | nmdc:mga05p37_780222_c1_491_1000 | 152 |
| 472 | 3300050510 | nmdc:mga06r32_238483_c1 | nmdc:mga06r32_238483_c1_347_832 | 152 |
| 473 | 3300050512 | nmdc:mga0n895_476758_c1 | nmdc:mga0n895_476758_c1_148_636 | 152 |
| 474 | 3300004800 | Ga0058861_11794399 | Ga0058861_117943992 | 153 |
| 475 | 3300004803 | Ga0058862_10215903 | Ga0058862_102159033 | 153 |
| 476 | 3300005290 | Ga0065712_10104326 | Ga0065712_101043264 | 153 |
| 477 | 3300005293 | Ga0065715_10011211 | Ga0065715_100112113 | 153 |
| 478 | 3300005329 | Ga0070683_100547814 | Ga0070683_1005478143 | 153 |
| 479 | 3300005331 | Ga0070670_100091860 | Ga0070670_1000918602 | 153 |
| 480 | 3300005334 | Ga0068869_100105587 | Ga0068869_1001055874 | 153 |
| 481 | 3300005336 | Ga0070680_100035994 | Ga0070680_1000359943 | 153 |
| 482 | 3300005336 | Ga0070680_101420094 | Ga0070680_1014200941 | 153 |
| 483 | 3300005339 | Ga0070660_100005024 | Ga0070660_1000050245 | 153 |
| 484 | 3300005340 | Ga0070689_100443957 | Ga0070689_1004439573 | 153 |
| 485 | 3300005343 | Ga0070687_100061394 | Ga0070687_1000613943 | 153 |
| 486 | 3300005343 | Ga0070687_100462813 | Ga0070687_1004628131 | 153 |
| 487 | 3300005344 | Ga0070661_100570016 | Ga0070661_1005700163 | 153 |
| 488 | 3300005355 | Ga0070671_100631495 | Ga0070671_1006314951 | 153 |
| 489 | 3300005355 | Ga0070671_100932829 | Ga0070671_1009328292 | 153 |
| 490 | 3300005356 | Ga0070674_100620616 | Ga0070674_1006206162 | 153 |
| 491 | 3300005364 | Ga0070673_101404190 | Ga0070673_1014041901 | 153 |
| 492 | 3300005365 | Ga0070688_100085989 | Ga0070688_1000859893 | 153 |
| 493 | 3300005366 | Ga0070659_100059747 | Ga0070659_1000597474 | 153 |
| 494 | 3300005366 | Ga0070659_100102679 | Ga0070659_1001026791 | 153 |
| 495 | 3300005435 | Ga0070714_100744055 | Ga0070714_1007440552 | 153 |
| 496 | 3300005436 | Ga0070713_100079681 | Ga0070713_1000796813 | 153 |
| 497 | 3300005444 | Ga0070694_100888550 | Ga0070694_1008885501 | 153 |
| 498 | 3300005456 | Ga0070678_100161269 | Ga0070678_1001612693 | 153 |
| 499 | 3300005458 | Ga0070681_10012336 | Ga0070681_100123365 | 153 |
| 500 | 3300005467 | Ga0070706_100280137 | Ga0070706_1002801373 | 153 |
| 501 | 3300005530 | Ga0070679_100295562 | Ga0070679_1002955621 | 153 |
| 502 | 3300005530 | Ga0070679_101618933 | Ga0070679_1016189331 | 153 |
| 503 | 3300005543 | Ga0070672_101094461 | Ga0070672_1010944612 | 153 |
| 504 | 3300005544 | Ga0070686_100020103 | Ga0070686_1000201034 | 153 |
| 505 | 3300005544 | Ga0070686_100602724 | Ga0070686_1006027242 | 153 |
| 506 | 3300005546 | Ga0070696_100158511 | Ga0070696_1001585113 | 153 |
| 507 | 3300005548 | Ga0070665_100163570 | Ga0070665_1001635701 | 153 |
| 508 | 3300005564 | Ga0070664_100111635 | Ga0070664_1001116352 | 153 |
| 509 | 3300005564 | Ga0070664_100286926 | Ga0070664_1002869263 | 153 |
| 510 | 3300005577 | Ga0068857_100227389 | Ga0068857_1002273892 | 153 |
| 511 | 3300005578 | Ga0068854_100045603 | Ga0068854_1000456033 | 153 |
| 512 | 3300005617 | Ga0068859_100037441 | Ga0068859_1000374416 | 153 |
| 513 | 3300005617 | Ga0068859_100361110 | Ga0068859_1003611102 | 153 |
| 514 | 3300005618 | Ga0068864_100012604 | Ga0068864_1000126044 | 153 |
| 515 | 3300005618 | Ga0068864_100289994 | Ga0068864_1002899941 | 153 |
| 516 | 3300005719 | Ga0068861_101717754 | Ga0068861_1017177541 | 153 |
| 517 | 3300005841 | Ga0068863_100192030 | Ga0068863_1001920304 | 153 |
| 518 | 3300005842 | Ga0068858_100041172 | Ga0068858_1000411722 | 153 |
| 519 | 3300005843 | Ga0068860_100288617 | Ga0068860_1002886174 | 153 |
| 520 | 3300005843 | Ga0068860_100494770 | Ga0068860_1004947702 | 153 |
| 521 | 3300005843 | Ga0068860_100559689 | Ga0068860_1005596892 | 153 |
| 522 | 3300006163 | Ga0070715_10013608 | Ga0070715_100136084 | 153 |
| 523 | 3300006237 | Ga0097621_100004117 | Ga0097621_10000411710 | 153 |
| 524 | 3300006237 | Ga0097621_100053650 | Ga0097621_1000536504 | 153 |
| 525 | 3300006237 | Ga0097621_100112068 | Ga0097621_1001120683 | 153 |
| 526 | 3300006237 | Ga0097621_100521204 | Ga0097621_1005212043 | 153 |
| 527 | 3300006358 | Ga0068871_100000670 | Ga0068871_10000067010 | 153 |
| 528 | 3300006358 | Ga0068871_100051184 | Ga0068871_1000511843 | 153 |
| 529 | 3300006358 | Ga0068871_100100775 | Ga0068871_1001007753 | 153 |
| 530 | 3300006852 | Ga0075433_10025649 | Ga0075433_100256493 | 153 |
| 531 | 3300006852 | Ga0075433_10323315 | Ga0075433_103233152 | 153 |
| 532 | 3300006852 | Ga0075433_10435665 | Ga0075433_104356652 | 153 |
| 533 | 3300006871 | Ga0075434_100000134 | Ga0075434_10000013423 | 153 |
| 534 | 3300006871 | Ga0075434_100135105 | Ga0075434_1001351054 | 153 |
| 535 | 3300006881 | Ga0068865_100007288 | Ga0068865_1000072888 | 153 |
| 536 | 3300006914 | Ga0075436_100000233 | Ga0075436_10000023322 | 153 |
| 537 | 3300006914 | Ga0075436_100006348 | Ga0075436_1000063484 | 153 |
| 538 | 3300006914 | Ga0075436_100117907 | Ga0075436_1001179073 | 153 |
| 539 | 3300006931 | Ga0097620_100037442 | Ga0097620_1000374426 | 153 |
| 540 | 3300006931 | Ga0097620_100361086 | Ga0097620_1003610862 | 153 |
| 541 | 3300006931 | Ga0097620_101660241 | Ga0097620_1016602412 | 153 |
| 542 | 3300007076 | Ga0075435_100000220 | Ga0075435_10000022022 | 153 |
| 543 | 3300007076 | Ga0075435_100002765 | Ga0075435_1000027657 | 153 |
| 544 | 3300007076 | Ga0075435_100026406 | Ga0075435_1000264064 | 153 |
| 545 | 3300007076 | Ga0075435_100298903 | Ga0075435_1002989034 | 153 |
| 546 | 3300007076 | Ga0075435_100347327 | Ga0075435_1003473272 | 153 |
| 547 | 3300009093 | Ga0105240_10085699 | Ga0105240_100856996 | 153 |
| 548 | 3300009094 | Ga0111539_10184065 | Ga0111539_101840654 | 153 |
| 549 | 3300009101 | Ga0105247_10011056 | Ga0105247_100110565 | 153 |
| 550 | 3300009147 | Ga0114129_10034764 | Ga0114129_100347642 | 153 |
| 551 | 3300009147 | Ga0114129_10043922 | Ga0114129_100439223 | 153 |
| 552 | 3300009148 | Ga0105243_12322397 | Ga0105243_123223971 | 153 |
| 553 | 3300009174 | Ga0105241_10040605 | Ga0105241_100406054 | 153 |
| 554 | 3300009176 | Ga0105242_10014004 | Ga0105242_100140045 | 153 |
| 555 | 3300009177 | Ga0105248_10001520 | Ga0105248_1000152026 | 153 |
| 556 | 3300009177 | Ga0105248_10477785 | Ga0105248_104777853 | 153 |
| 557 | 3300009177 | Ga0105248_11542307 | Ga0105248_115423072 | 153 |
| 558 | 3300010375 | Ga0105239_11104557 | Ga0105239_111045571 | 153 |
| 559 | 3300010375 | Ga0105239_11347253 | Ga0105239_113472532 | 153 |
| 560 | 3300011119 | Ga0105246_11272292 | Ga0105246_112722922 | 153 |
| 561 | 3300013105 | Ga0157369_11215275 | Ga0157369_112152751 | 153 |
| 562 | 3300013297 | Ga0157378_10301949 | Ga0157378_103019493 | 153 |
| 563 | 3300013297 | Ga0157378_10704411 | Ga0157378_107044112 | 153 |
| 564 | 3300013307 | Ga0157372_10634619 | Ga0157372_106346193 | 153 |
| 565 | 3300013308 | Ga0157375_11287801 | Ga0157375_112878012 | 153 |
| 566 | 3300014325 | Ga0163163_10002362 | Ga0163163_1000236210 | 153 |
| 567 | 3300014325 | Ga0163163_10076945 | Ga0163163_100769455 | 153 |
| 568 | 3300014325 | Ga0163163_10271672 | Ga0163163_102716723 | 153 |
| 569 | 3300014326 | Ga0157380_10085607 | Ga0157380_100856074 | 153 |
| 570 | 3300014968 | Ga0157379_10100607 | Ga0157379_101006074 | 153 |
| 571 | 3300014969 | Ga0157376_10033464 | Ga0157376_100334644 | 153 |
| 572 | 3300014969 | Ga0157376_10112853 | Ga0157376_101128533 | 153 |
| 573 | 3300014969 | Ga0157376_10527194 | Ga0157376_105271942 | 153 |
| 574 | 3300014969 | Ga0157376_12036715 | Ga0157376_120367152 | 153 |
| 575 | 3300020080 | Ga0206350_10238524 | Ga0206350_102385241 | 153 |
| 576 | 3300025315 | Ga0207697_10183827 | Ga0207697_101838272 | 153 |
| 577 | 3300025893 | Ga0207682_10062740 | Ga0207682_100627403 | 153 |
| 578 | 3300025900 | Ga0207710_10242787 | Ga0207710_102427872 | 153 |
| 579 | 3300025903 | Ga0207680_10016138 | Ga0207680_100161382 | 153 |
| 580 | 3300025907 | Ga0207645_10340146 | Ga0207645_103401462 | 153 |
| 581 | 3300025910 | Ga0207684_10245858 | Ga0207684_102458583 | 153 |
| 582 | 3300025911 | Ga0207654_10083693 | Ga0207654_100836932 | 153 |
| 583 | 3300025912 | Ga0207707_10096365 | Ga0207707_100963653 | 153 |
| 584 | 3300025913 | Ga0207695_10057917 | Ga0207695_100579173 | 153 |
| 585 | 3300025913 | Ga0207695_10140240 | Ga0207695_101402403 | 153 |
| 586 | 3300025913 | Ga0207695_10149476 | Ga0207695_101494764 | 153 |
| 587 | 3300025914 | Ga0207671_10816727 | Ga0207671_108167271 | 153 |
| 588 | 3300025917 | Ga0207660_11012960 | Ga0207660_110129602 | 153 |
| 589 | 3300025919 | Ga0207657_10013707 | Ga0207657_100137073 | 153 |
| 590 | 3300025920 | Ga0207649_10512829 | Ga0207649_105128293 | 153 |
| 591 | 3300025921 | Ga0207652_10067785 | Ga0207652_100677853 | 153 |
| 592 | 3300025921 | Ga0207652_11130648 | Ga0207652_111306482 | 153 |
| 593 | 3300025923 | Ga0207681_10945128 | Ga0207681_109451282 | 153 |
| 594 | 3300025925 | Ga0207650_10086397 | Ga0207650_100863972 | 153 |
| 595 | 3300025925 | Ga0207650_10333950 | Ga0207650_103339502 | 153 |
| 596 | 3300025927 | Ga0207687_10973222 | Ga0207687_109732222 | 153 |
| 597 | 3300025928 | Ga0207700_10221376 | Ga0207700_102213764 | 153 |
| 598 | 3300025929 | Ga0207664_10040462 | Ga0207664_100404623 | 153 |
| 599 | 3300025931 | Ga0207644_10079652 | Ga0207644_100796523 | 153 |
| 600 | 3300025932 | Ga0207690_10065447 | Ga0207690_100654472 | 153 |
| 601 | 3300025933 | Ga0207706_10841678 | Ga0207706_108416782 | 153 |
| 602 | 3300025934 | Ga0207686_10053537 | Ga0207686_100535373 | 153 |
| 603 | 3300025936 | Ga0207670_10327067 | Ga0207670_103270673 | 153 |
| 604 | 3300025941 | Ga0207711_10009258 | Ga0207711_100092583 | 153 |
| 605 | 3300025941 | Ga0207711_10738736 | Ga0207711_107387362 | 153 |
| 606 | 3300025941 | Ga0207711_11307495 | Ga0207711_113074952 | 153 |
| 607 | 3300025944 | Ga0207661_10657478 | Ga0207661_106574782 | 153 |
| 608 | 3300025945 | Ga0207679_10246854 | Ga0207679_102468543 | 153 |
| 609 | 3300025945 | Ga0207679_10311421 | Ga0207679_103114213 | 153 |
| 610 | 3300025960 | Ga0207651_10134178 | Ga0207651_101341784 | 153 |
| 611 | 3300025981 | Ga0207640_10004967 | Ga0207640_100049678 | 153 |
| 612 | 3300025986 | Ga0207658_10571963 | Ga0207658_105719632 | 153 |
| 613 | 3300026023 | Ga0207677_10360054 | Ga0207677_103600543 | 153 |
| 614 | 3300026023 | Ga0207677_10744258 | Ga0207677_107442582 | 153 |
| 615 | 3300026023 | Ga0207677_11195218 | Ga0207677_111952181 | 153 |
| 616 | 3300026035 | Ga0207703_10071163 | Ga0207703_100711632 | 153 |
| 617 | 3300026035 | Ga0207703_10531658 | Ga0207703_105316582 | 153 |
| 618 | 3300026041 | Ga0207639_11379445 | Ga0207639_113794451 | 153 |
| 619 | 3300026075 | Ga0207708_10337514 | Ga0207708_103375141 | 153 |
| 620 | 3300026088 | Ga0207641_10998164 | Ga0207641_109981641 | 153 |
| 621 | 3300026095 | Ga0207676_10022651 | Ga0207676_100226514 | 153 |
| 622 | 3300026095 | Ga0207676_11120418 | Ga0207676_111204182 | 153 |
| 623 | 3300026116 | Ga0207674_10087223 | Ga0207674_100872234 | 153 |
| 624 | 3300026118 | Ga0207675_100874014 | Ga0207675_1008740142 | 153 |
| 625 | 3300026118 | Ga0207675_101493076 | Ga0207675_1014930762 | 153 |
| 626 | 3300028379 | Ga0268266_10033346 | Ga0268266_100333465 | 153 |
| 627 | 3300028380 | Ga0268265_10780022 | Ga0268265_107800222 | 153 |
| 628 | 3300028381 | Ga0268264_10217406 | Ga0268264_102174063 | 153 |
| 629 | 3300028381 | Ga0268264_10753744 | Ga0268264_107537442 | 153 |
| 630 | 3300028381 | Ga0268264_10903078 | Ga0268264_109030782 | 153 |
| 631 | 3300031711 | Ga0265314_10108617 | Ga0265314_101086171 | 153 |
| 632 | 3300034817 | Ga0373948_0000440 | Ga0373948_0000440_847_1353 | 153 |
| 633 | 3300034818 | Ga0373950_0000944 | Ga0373950_0000944_1853_2359 | 153 |
| 634 | 3300034819 | Ga0373958_0001739 | Ga0373958_0001739_861_1367 | 153 |
| 635 | 3300034819 | Ga0373958_0059256 | Ga0373958_0059256_190_705 | 153 |
| 636 | 3300034820 | Ga0373959_0002963 | Ga0373959_0002963_1954_2460 | 153 |
| 637 | 3300034957 | Ga0373938_0000829 | Ga0373938_0000829_2759_3265 | 153 |
| 638 | 3300035085 | Ga0373929_0001288 | Ga0373929_0001288_1658_2164 | 153 |
| 639 | 3300035086 | Ga0373934_0053214 | Ga0373934_0053214_499_969 | 153 |
| 640 | 3300035086 | Ga0373934_0371962 | Ga0373934_0371962_48_563 | 153 |
| 641 | 3300035088 | Ga0373940_0001530 | Ga0373940_0001530_2882_3388 | 153 |
| 642 | 3300035090 | Ga0373949_0001914 | Ga0373949_0001914_3383_3889 | 153 |
| 643 | 3300035091 | Ga0373951_0007763 | Ga0373951_0007763_1752_2258 | 153 |
| 644 | 3300035112 | Ga0373932_0001883 | Ga0373932_0001883_736_1242 | 153 |
| 645 | 3300035114 | Ga0373939_0004389 | Ga0373939_0004389_1580_2086 | 153 |
| 646 | 3300035115 | Ga0373941_0000682 | Ga0373941_0000682_2749_3255 | 153 |
| 647 | 3300035116 | Ga0373945_0025158 | Ga0373945_0025158_272_742 | 153 |
| 648 | 3300035116 | Ga0373945_0154212 | Ga0373945_0154212_289_828 | 153 |
| 649 | 3300035120 | Ga0373957_0130457 | Ga0373957_0130457_146_673 | 153 |
| 650 | 3300035121 | Ga0373960_0001092 | Ga0373960_0001092_2940_3446 | 153 |
| 651 | 3300035170 | Ga0373943_0402001 | Ga0373943_0402001_38_562 | 153 |
| 652 | 3300035171 | Ga0373946_0039785 | Ga0373946_0039785_109_615 | 153 |
| 653 | 3300035172 | Ga0373955_0155423 | Ga0373955_0155423_35_508 | 153 |
| 654 | 3300035172 | Ga0373955_0164196 | Ga0373955_0164196_327_869 | 153 |
| 655 | 3300035207 | Ga0373942_0002521 | Ga0373942_0002521_2682_3188 | 153 |
| 656 | 3300035241 | Ga0373961_0002143 | Ga0373961_0002143_863_1369 | 153 |
| 657 | 3300035242 | Ga0373962_0001173 | Ga0373962_0001173_3615_4121 | 153 |
| 658 | 3300035242 | Ga0373962_0049677 | Ga0373962_0049677_421_933 | 153 |
| 659 | 3300035691 | Ga0373931_0004099 | Ga0373931_0004099_1736_2242 | 153 |
| 660 | 3300035692 | Ga0373935_1275824 | Ga0373935_1275824_19_489 | 153 |
| 661 | 3300035695 | Ga0373927_0252943 | Ga0373927_0252943_383_853 | 153 |
| 662 | 3300035724 | Ga0373933_0212880 | Ga0373933_0212880_152_622 | 153 |
| 663 | 3300036401 | Ga0373937_0078586 | Ga0373937_0078586_2343_2849 | 153 |
| 664 | 3300036401 | Ga0373937_0079910 | Ga0373937_0079910_805_1278 | 153 |
| 665 | 3300045051 | Ga0451576_0024123 | Ga0451576_0024123_4796_5302 | 153 |
| 666 | 3300046462 | Ga0495651_0442437 | Ga0495651_0442437_342_812 | 153 |
| 667 | 3300046463 | Ga0495653_0638420 | Ga0495653_0638420_21_491 | 153 |
| 668 | 3300046477 | Ga0495664_0456919 | Ga0495664_0456919_61_534 | 153 |
| 669 | 3300046492 | Ga0495585_0407659 | Ga0495585_0407659_121_597 | 153 |
| 670 | 3300046516 | Ga0495628_0123131 | Ga0495628_0123131_713_1183 | 153 |
| 671 | 3300046516 | Ga0495628_0261459 | Ga0495628_0261459_654_1160 | 153 |
| 672 | 3300046529 | Ga0495652_0280352 | Ga0495652_0280352_613_1083 | 153 |
| 673 | 3300046533 | Ga0495640_0066661 | Ga0495640_0066661_514_1020 | 153 |
| 674 | 3300046533 | Ga0495640_0165846 | Ga0495640_0165846_764_1303 | 153 |
| 675 | 3300046559 | Ga0495667_0448398 | Ga0495667_0448398_36_506 | 153 |
| 676 | 3300046681 | Ga0495647_0010795 | Ga0495647_0010795_2064_2603 | 153 |
| 677 | 3300046683 | Ga0495658_0265983 | Ga0495658_0265983_523_1029 | 153 |
| 678 | 3300046683 | Ga0495658_0278542 | Ga0495658_0278542_79_618 | 153 |
| 679 | 3300046683 | Ga0495658_0580589 | Ga0495658_0580589_191_664 | 153 |
| 680 | 3300046684 | Ga0495669_0078873 | Ga0495669_0078873_66_572 | 153 |
| 681 | 3300046684 | Ga0495669_0262984 | Ga0495669_0262984_31_501 | 153 |
| 682 | 3300046809 | Ga0495600_0149796 | Ga0495600_0149796_68_574 | 153 |
| 683 | 3300047317 | Ga0495604_0143892 | Ga0495604_0143892_896_1366 | 153 |
| 684 | 3300047319 | Ga0495674_0672013 | Ga0495674_0672013_219_758 | 153 |
| 685 | 3300047319 | Ga0495674_0974245 | Ga0495674_0974245_56_529 | 153 |
| 686 | 3300048903 | Ga0496100_0724089 | Ga0496100_0724089_111_632 | 153 |
| 687 | 3300048904 | Ga0496101_0144681 | Ga0496101_0144681_1184_1705 | 153 |
| 688 | 3300048906 | Ga0496103_0270038 | Ga0496103_0270038_244_750 | 153 |
| 689 | 3300048907 | Ga0496104_0132771 | Ga0496104_0132771_21_542 | 153 |
| 690 | 3300048908 | Ga0496105_0369823 | Ga0496105_0369823_164_685 | 153 |
| 691 | 3300048909 | Ga0496106_0120690 | Ga0496106_0120690_378_896 | 153 |
| 692 | 3300048910 | Ga0496107_0195217 | Ga0496107_0195217_462_968 | 153 |
| 693 | 3300048911 | Ga0496108_0012961 | Ga0496108_0012961_1777_2283 | 153 |
| 694 | 3300048911 | Ga0496108_0559543 | Ga0496108_0559543_440_961 | 153 |
| 695 | 3300048911 | Ga0496108_0618193 | Ga0496108_0618193_157_627 | 153 |
| 696 | 3300048912 | Ga0496109_0241984 | Ga0496109_0241984_724_1194 | 153 |
| 697 | 3300048913 | Ga0496110_0100033 | Ga0496110_0100033_436_906 | 153 |
| 698 | 3300048914 | Ga0496111_0656292 | Ga0496111_0656292_145_615 | 153 |
| 699 | 3300048915 | Ga0496112_0049109 | Ga0496112_0049109_1930_2436 | 153 |
| 700 | 3300048915 | Ga0496112_0263438 | Ga0496112_0263438_1074_1598 | 153 |
| 701 | 3300048915 | Ga0496112_1201335 | Ga0496112_1201335_179_640 | 153 |
| 702 | 3300048916 | Ga0496113_0027293 | Ga0496113_0027293_442_948 | 153 |
| 703 | 3300048917 | Ga0496114_0138992 | Ga0496114_0138992_956_1462 | 153 |
| 704 | 3300048917 | Ga0496114_0690913 | Ga0496114_0690913_275_781 | 153 |
| 705 | 3300050507 | nmdc:mga05p37_11396_c1 | nmdc:mga05p37_11396_c1_8950_9420 | 153 |
| 706 | 3300050507 | nmdc:mga05p37_70327_c1 | nmdc:mga05p37_70327_c1_1005_1502 | 153 |
| 707 | 3300050508 | nmdc:mga09592_493833_c1 | nmdc:mga09592_493833_c1_243_755 | 153 |
| 708 | 3300050511 | nmdc:mga08y16_340131_c1 | nmdc:mga08y16_340131_c1_455_967 | 153 |
| 709 | 3300050511 | nmdc:mga08y16_716563_c1 | nmdc:mga08y16_716563_c1_309_776 | 153 |
| 710 | 3300050512 | nmdc:mga0n895_10_c1 | nmdc:mga0n895_10_c1_56553_57059 | 153 |
| 711 | 3300050512 | nmdc:mga0n895_174577_c1 | nmdc:mga0n895_174577_c1_1157_1663 | 153 |
| 712 | 3300050512 | nmdc:mga0n895_439219_c1 | nmdc:mga0n895_439219_c1_261_731 | 153 |
| 713 | 3300050513 | nmdc:mga0rr50_137975_c1 | nmdc:mga0rr50_137975_c1_472_990 | 153 |
| 714 | 3300050513 | nmdc:mga0rr50_1933_c1 | nmdc:mga0rr50_1933_c1_7071_7577 | 153 |
| 715 | 3300050513 | nmdc:mga0rr50_20_c1 | nmdc:mga0rr50_20_c1_107984_108490 | 153 |
| 716 | 3300050513 | nmdc:mga0rr50_299275_c1 | nmdc:mga0rr50_299275_c1_821_1327 | 153 |
| 717 | 3300050514 | nmdc:mga08x19_155532_c1 | nmdc:mga08x19_155532_c1_482_988 | 153 |
| 718 | 3300050514 | nmdc:mga08x19_319_c1 | nmdc:mga08x19_319_c1_13147_13653 | 153 |
| 719 | 3300050514 | nmdc:mga08x19_388156_c1 | nmdc:mga08x19_388156_c1_163_669 | 153 |
| 720 | 3300053077 | Ga0495601_0138533 | Ga0495601_0138533_693_1163 | 153 |
| 721 | 3300053077 | Ga0495601_0148880 | Ga0495601_0148880_356_829 | 153 |
| 722 | 3300053077 | Ga0495601_0455427 | Ga0495601_0455427_85_624 | 153 |
| 723 | 3300053078 | Ga0495612_0319906 | Ga0495612_0319906_81_587 | 153 |
| 724 | 3300053084 | Ga0495595_0056068 | Ga0495595_0056068_547_1053 | 153 |
| 725 | 3300053084 | Ga0495595_0076666 | Ga0495595_0076666_388_912 | 153 |
| 726 | 3300053084 | Ga0495595_0150828 | Ga0495595_0150828_336_806 | 153 |
| 727 | 3300053085 | Ga0495619_0010785 | Ga0495619_0010785_861_1331 | 153 |
| 728 | 3300053085 | Ga0495619_0103811 | Ga0495619_0103811_307_849 | 153 |
| 729 | 3300053134 | Ga0500658_0300173 | Ga0500658_0300173_101_574 | 153 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qao-assembly1.cif.gz_A-2 | the crystal structure of the n-terminal domain of a merr-like transcriptional regulator from listeria monocytogenes egd-e | 0.8344 | 4 | 78 |
| 6jni-assembly4.cif.gz_G | crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna | 0.8131 | 7 | 85 |
| 6jni-assembly3.cif.gz_E | crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna | 0.8121 | 7 | 85 |
| 6jni-assembly4.cif.gz_H | crystal structure of the transcriptional regulator cadr from p. putida in complex with zinc(ii) and dna | 0.8115 | 7 | 85 |
| 1jbg-assembly1.cif.gz_A-2 | crystal structure of mtan, the bacillus subtilis multidrug transporter activator, n-terminus | 0.8114 | 7 | 78 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3d6zA01 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8385 | 6 | 76 | 1.10.1660.10 |
| 1r8dA00 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8338 | 6 | 80 | 1.10.1660.10 |
| af_Q2FVM8_3_134_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.8094 | 6 | 76 | 1.10.1660.10 |
| af_Q2G2L8_2_138_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.7971 | 6 | 85 | 1.10.1660.10 |
| 1exjA02 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.7911 | 4 | 76 | 1.10.1660.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A843SY63-F1-model_v4 | MerR family transcriptional regulator | 0.9609 | 1 | 153 |
GO:0003677
GO:0006355 |
| AF-A0A843SY63-F1-model_v4 | MerR family transcriptional regulator | 0.9552 | 1 | 153 |
GO:0003677
GO:0006355 |
| AF-A0A381S194-F1-model_v4 | HTH merR-type domain-containing protein | 0.952 | 1 | 152 |
GO:0003677
GO:0003700 |
| AF-A0A2E4W978-F1-model_v4 | HTH merR-type domain-containing protein | 0.9419 | 1 | 153 |
GO:0003677
GO:0003700 |
| AF-A0A381S194-F1-model_v4 | HTH merR-type domain-containing protein | 0.94 | 1 | 152 |
GO:0003677
GO:0003700 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar