F477885

General Info

Members Datasets Scaffolds Average Seq Length
729 496 1458 323

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0106268|Ga0496121_0106268_765_1751
Length 328
Sequence MPRAVVCRELGPPESLKLEDVPRAPLAPRQGQGQVRVAIHAAGLNFPDILMAAGEYQLKPPLPFTPGMEAAGEVTEVAGADGVSVGDKVIVKARFGCYADEIVVTPDQLVPLPSAFDYAQGAAFLAAHGTAYHALKDRAQMQPGEVLLVHGAGGGVGLAAVELGKVFGATVIACASSEEKLAVAQQRGADHGVLYGREPFKDAVKRITDGRGVDVVFDPVGGAIFEDSLRCIAWGARLLVIGFTGGIGVAKTNLVLIKGASVLGVRAGEAVRKNPALGVVRQHDLTRLANERRISPNISHRLPLEDYATAMRLLVDRRAIGRVVLTMR

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
53 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
77 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
78 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
79 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
80 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
86 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
129 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
130 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
131 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
140 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
141 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
148 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
181 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
187 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
204 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
210 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
253 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
286 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
287 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
288 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
289 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
290 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
291 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
292 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
293 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
294 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
295 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
296 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
297 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
298 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
299 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
300 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
301 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
302 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
305 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
306 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
309 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
310 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
311 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
312 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
313 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
314 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
315 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
316 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
317 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
318 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
319 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
320 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
321 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
322 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
323 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
324 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
325 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
326 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
327 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
328 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
329 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
330 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
331 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
332 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
333 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
334 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
335 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
336 2643221651 Afipia sp. Root123D2 Isolate Unclassified
337 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
338 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
339 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
340 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
341 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
342 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
343 2791355199
344 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
345 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
346 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
347 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
348 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
349 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
350 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
351 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
352 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
353 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
354 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
355 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
356 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
357 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
358 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
359 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
360 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
361 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
362 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
363 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
364 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
365 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
366 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
367 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
368 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
369 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
370 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
371 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
372 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
373 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
374 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
375 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
376 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
377 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
378 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
379 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
380 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
381 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
382 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
383 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
384 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
385 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
386 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
387 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
388 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
389 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
390 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
391 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
392 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
393 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
394 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
395 2904699407
396 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
397 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
398 2906610324
399 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
400 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
401 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
402 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
403 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
404 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
405 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
406 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
407 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
408 2922368715
409 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
410 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
411 2922425934
412 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
413 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
414 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
415 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
416 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
417 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
418 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
419 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
420 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
421 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
422 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
423 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
424 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
425 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
426 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
427 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
428 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
429 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
430 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
431 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
432 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
433 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
434 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
435 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
436 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
437 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
438 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
439 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
440 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
441 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
442 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
443 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
444 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
445 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
446 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
447 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
448 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
449 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
450 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
451 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
452 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
453 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
454 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
455 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
456 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
457 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
458 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
459 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
460 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
461 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
462 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
463 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
464 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
465 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
466 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
467 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
468 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
469 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
470 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
471 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
472 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
473 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
474 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
475 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
476 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
477 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
478 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
479 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
480 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
481 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
482 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
483 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
484 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
485 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
486 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
487 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
488 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
489 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
490 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
491 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
492 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
493 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
494 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
495 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
496 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.55
Metatranscriptomes 0
Isolates 24.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.76
Nodule 19.75
Rhizoplane 7.13
Rhizosphere 47.19
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0106268 3300048924 Bacteria 2152
2 JGI25153J46596_10006992 3300003215 Bacteria 5622
3 JGI25153J46596_10013502 3300003215 Bacteria 3446
4 JGI25153J46596_10028198 3300003215 Bacteria 1952
5 JGI25160J50197_1003053 3300003354 Bacteria 7635
6 JGI25160J50197_1006569 3300003354 Bacteria 4687
7 JGI25160J50197_1008476 3300003354 Bacteria 3913
8 Ga0055531_10002184 3300003794 Bacteria 13342
9 Ga0055543_1002709 3300004625 Bacteria 5664
10 Ga0055543_1019394 3300004625 Bacteria 1259
11 Ga0065165_1002008 3300005262 Bacteria 19054
12 Ga0065165_1003321 3300005262 Bacteria 11502
13 Ga0065165_1019182 3300005262 Bacteria 2450
14 Ga0070683_100104782 3300005329 Bacteria 2665
15 Ga0070691_10136730 3300005341 Bacteria 1246
16 Ga0070671_100040085 3300005355 Bacteria 3888
17 Ga0070671_100152055 3300005355 Bacteria 1954
18 Ga0070671_100397954 3300005355 Bacteria 1178
19 Ga0070674_100026876 3300005356 Bacteria 3765
20 Ga0070659_100118374 3300005366 Bacteria 2143
21 Ga0070659_100136260 3300005366 Bacteria 1996
22 Ga0070659_100176911 3300005366 Bacteria 1750
23 Ga0070714_100072130 3300005435 Bacteria 2989
24 Ga0070713_100027904 3300005436 Bacteria 4452
25 Ga0070711_100061847 3300005439 Bacteria 2608
26 Ga0070711_100170657 3300005439 Bacteria 1657
27 Ga0070663_100059606 3300005455 Bacteria 2743
28 Ga0070663_100117828 3300005455 Bacteria 2002
29 Ga0070678_100063017 3300005456 Bacteria 2741
30 Ga0070681_10207592 3300005458 Bacteria 1875
31 Ga0068867_100335067 3300005459 Bacteria 1258
32 Ga0070699_100289351 3300005518 Bacteria 1469
33 Ga0070684_100210520 3300005535 Bacteria 1772
34 Ga0068853_100032760 3300005539 Bacteria 4404
35 Ga0068853_100080791 3300005539 Bacteria 2846
36 Ga0068853_100432525 3300005539 Bacteria 1236
37 Ga0070672_100303163 3300005543 Bacteria 1354
38 Ga0070665_100091247 3300005548 Bacteria 3052
39 Ga0070665_100164440 3300005548 Bacteria 2221
40 Ga0070665_100176989 3300005548 Bacteria 2134
41 Ga0070665_100262055 3300005548 Bacteria 1730
42 Ga0068855_100029681 3300005563 Bacteria 6537
43 Ga0068855_100272316 3300005563 Bacteria 1882
44 Ga0068857_100034794 3300005577 Bacteria 4456
45 Ga0068854_100033432 3300005578 Bacteria 3585
46 Ga0068854_100311938 3300005578 Bacteria 1276
47 Ga0068856_100059957 3300005614 Bacteria 3759
48 Ga0068856_100151937 3300005614 Bacteria 2325
49 Ga0068856_100172852 3300005614 Bacteria 2173
50 Ga0068856_100316529 3300005614 Bacteria 1578
51 Ga0068856_100426575 3300005614 Bacteria 1346
52 Ga0068852_100127562 3300005616 Bacteria 2338
53 Ga0068852_100140619 3300005616 Bacteria 2233
54 Ga0068852_100210129 3300005616 Bacteria 1846
55 Ga0068852_100462671 3300005616 Bacteria 1258
56 Ga0068859_100293006 3300005617 Bacteria 1720
57 Ga0068864_100041362 3300005618 Bacteria 3942
58 Ga0068861_100028438 3300005719 Bacteria 4079
59 Ga0068861_100058215 3300005719 Bacteria 2954
60 Ga0068851_10086843 3300005834 Bacteria 1642
61 Ga0068851_10090151 3300005834 Bacteria 1613
62 Ga0068863_100455261 3300005841 Bacteria 1256
63 Ga0068863_100468613 3300005841 Bacteria 1238
64 Ga0068858_100015486 3300005842 Bacteria 7171
65 Ga0068860_100006537 3300005843 Bacteria 11700
66 Ga0068860_100063240 3300005843 Bacteria 3515
67 Ga0068860_100405025 3300005843 Bacteria 1350
68 Ga0068862_100080802 3300005844 Bacteria 2819
69 Ga0068862_100147298 3300005844 Bacteria 2093
70 Ga0068862_100169042 3300005844 Bacteria 1956
71 Ga0081455_10007549 3300005937 Bacteria 11436
72 Ga0081540_1001498 3300005983 Bacteria 20120
73 Ga0081540_1007278 3300005983 Bacteria 7924
74 Ga0081540_1010330 3300005983 Bacteria 6331
75 Ga0081540_1011806 3300005983 Bacteria 5806
76 Ga0081540_1025933 3300005983 Bacteria 3359
77 Ga0081540_1061880 3300005983 Bacteria 1782
78 Ga0081540_1095883 3300005983 Bacteria 1291
79 Ga0081539_10000726 3300005985 Bacteria 66051
80 Ga0081539_10039521 3300005985 Bacteria 2782
81 Ga0081539_10088789 3300005985 Bacteria 1602
82 Ga0075365_10053901 3300006038 Bacteria 2665
83 Ga0075365_10116928 3300006038 Bacteria 1836
84 Ga0075365_10176280 3300006038 Bacteria 1493
85 Ga0075368_10041526 3300006042 Bacteria 1807
86 Ga0075363_100094919 3300006048 Bacteria 1644
87 Ga0075364_10024769 3300006051 Bacteria 3813
88 Ga0070712_100048762 3300006175 Bacteria 2937
89 Ga0075367_10002487 3300006178 Bacteria 8442
90 Ga0075367_10034297 3300006178 Bacteria 2931
91 Ga0075367_10112461 3300006178 Bacteria 1672
92 Ga0097621_100029785 3300006237 Bacteria 4314
93 Ga0097621_100111716 3300006237 Bacteria 2310
94 Ga0068871_100101694 3300006358 Bacteria 2408
95 Ga0075428_100227353 3300006844 Bacteria 2014
96 Ga0075434_100113763 3300006871 Bacteria 2718
97 Ga0068865_100167336 3300006881 Bacteria 1682
98 Ga0068865_100221467 3300006881 Bacteria 1479
99 Ga0097620_100293006 3300006931 Bacteria 1720
100 Ga0099824_1013588 3300006942 Bacteria 8399
101 Ga0099824_1032175 3300006942 Bacteria 1903
102 Ga0099823_1048446 3300006944 Bacteria 2701
103 Ga0075435_100115090 3300007076 Bacteria 2239
104 Ga0105240_10010641 3300009093 Bacteria 12917
105 Ga0105240_10345344 3300009093 Bacteria 1690
106 Ga0105240_10501239 3300009093 Bacteria 1350
107 Ga0111539_10121045 3300009094 Bacteria 3067
108 Ga0105245_10068511 3300009098 Bacteria 3216
109 Ga0105245_10118252 3300009098 Bacteria 2473
110 Ga0114129_10101918 3300009147 Bacteria 3970
111 Ga0105243_10025134 3300009148 Bacteria 4548
112 Ga0105243_10209828 3300009148 Bacteria 1714
113 Ga0105243_10395159 3300009148 Bacteria 1283
114 Ga0105241_10059471 3300009174 Bacteria 2938
115 Ga0105241_10201831 3300009174 Bacteria 1661
116 Ga0105241_10313071 3300009174 Bacteria 1351
117 Ga0105241_10318435 3300009174 Bacteria 1340
118 Ga0105248_10065648 3300009177 Bacteria 4075
119 Ga0105248_10186777 3300009177 Bacteria 2335
120 Ga0105248_10265965 3300009177 Bacteria 1930
121 Ga0105248_10351505 3300009177 Bacteria 1659
122 Ga0105237_10004145 3300009545 Bacteria 16891
123 Ga0105237_10024695 3300009545 Bacteria 6147
124 Ga0105237_10070302 3300009545 Bacteria 3496
125 Ga0105237_10152706 3300009545 Bacteria 2306
126 Ga0105237_10263430 3300009545 Bacteria 1726
127 Ga0105238_10080027 3300009551 Bacteria 3257
128 Ga0099796_10012659 3300010159 Bacteria 2389
129 Ga0105239_10046661 3300010375 Bacteria 4747
130 Ga0105239_10060893 3300010375 Bacteria 4143
131 Ga0105239_10062712 3300010375 Bacteria 4079
132 Ga0105239_10083618 3300010375 Bacteria 3515
133 Ga0105239_10151918 3300010375 Bacteria 2584
134 Ga0105239_10347772 3300010375 Bacteria 1674
135 Ga0105246_10010071 3300011119 Bacteria 5835
136 Ga0157370_10079560 3300013104 Bacteria 3086
137 Ga0157369_10395679 3300013105 Bacteria 1433
138 Ga0157374_10011421 3300013296 Bacteria 7689
139 Ga0157374_10079256 3300013296 Bacteria 3112
140 Ga0157378_10183677 3300013297 Bacteria 1968
141 Ga0163162_10094550 3300013306 Bacteria 3075
142 Ga0163162_10280498 3300013306 Bacteria 1798
143 Ga0157375_10148274 3300013308 Bacteria 2479
144 Ga0157375_10388808 3300013308 Bacteria 1562
145 Ga0163163_10059377 3300014325 Bacteria 3783
146 Ga0163163_10420762 3300014325 Bacteria 1395
147 Ga0157379_10016120 3300014968 Bacteria 6572
148 Ga0157379_10043659 3300014968 Bacteria 4002
149 Ga0157376_10347825 3300014969 Bacteria 1418
150 Ga0214544_1000006 3300021320 Bacteria 380728
151 Ga0214542_1000002 3300021321 Bacteria 720798
152 Ga0214545_1000002 3300021324 Bacteria 727485
153 Ga0214543_1000017 3300021327 Bacteria 290109
154 Ga0213871_10009496 3300021441 Bacteria 2181
155 Ga0209563_101461 3300025230 Bacteria 6240
156 Ga0209677_108682 3300025253 Bacteria 1930
157 Ga0209148_1000447 3300025254 Bacteria 45273
158 Ga0209564_1003910 3300025295 Bacteria 9545
159 Ga0209758_1000065 3300025297 Bacteria 306288
160 Ga0209758_1002429 3300025297 Bacteria 19044
161 Ga0209758_1003622 3300025297 Bacteria 13820
162 Ga0209758_1025282 3300025297 Bacteria 2611
163 Ga0209758_1025863 3300025297 Bacteria 2561
164 Ga0209256_1011253 3300025299 Bacteria 3607
165 Ga0209256_1021691 3300025299 Bacteria 1963
166 Ga0207426_1000554 3300025302 Bacteria 51521
167 Ga0207426_1000561 3300025302 Bacteria 50758
168 Ga0207426_1002946 3300025302 Bacteria 9999
169 Ga0209257_1000833 3300025304 Bacteria 44467
170 Ga0209257_1031441 3300025304 Bacteria 1697
171 Ga0207656_10066356 3300025321 Bacteria 1595
172 Ga0207688_10006431 3300025901 Bacteria 6399
173 Ga0207688_10019196 3300025901 Bacteria 3722
174 Ga0207647_10089740 3300025904 Bacteria 1834
175 Ga0207705_10304071 3300025909 Bacteria 1224
176 Ga0207654_10000803 3300025911 Bacteria 17284
177 Ga0207654_10002540 3300025911 Bacteria 9257
178 Ga0207707_10165102 3300025912 Bacteria 1935
179 Ga0207695_10000029 3300025913 Bacteria 548364
180 Ga0207695_10001543 3300025913 Bacteria 37956
181 Ga0207671_10018788 3300025914 Bacteria 5296
182 Ga0207671_10156511 3300025914 Bacteria 1763
183 Ga0207693_10255227 3300025915 Bacteria 1375
184 Ga0207663_10129358 3300025916 Bacteria 1742
185 Ga0207657_10009798 3300025919 Bacteria 9604
186 Ga0207694_10232227 3300025924 Bacteria 1507
187 Ga0207650_10061111 3300025925 Bacteria 2812
188 Ga0207659_10206460 3300025926 Bacteria 1572
189 Ga0207687_10013194 3300025927 Bacteria 5397
190 Ga0207687_10168295 3300025927 Bacteria 1688
191 Ga0207700_10042530 3300025928 Bacteria 3332
192 Ga0207700_10154985 3300025928 Bacteria 1897
193 Ga0207664_10301067 3300025929 Bacteria 1411
194 Ga0207690_10107884 3300025932 Bacteria 2000
195 Ga0207706_10099577 3300025933 Bacteria 2557
196 Ga0207706_10136104 3300025933 Bacteria 2161
197 Ga0207706_10345983 3300025933 Bacteria 1293
198 Ga0207709_10012963 3300025935 Bacteria 4596
199 Ga0207669_10040409 3300025937 Bacteria 2706
200 Ga0207669_10062176 3300025937 Bacteria 2298
201 Ga0207704_10095030 3300025938 Bacteria 1970
202 Ga0207691_10081307 3300025940 Bacteria 2912
203 Ga0207691_10139582 3300025940 Bacteria 2136
204 Ga0207689_10010305 3300025942 Bacteria 8050
205 Ga0207689_10062250 3300025942 Bacteria 3068
206 Ga0207667_10007604 3300025949 Bacteria 12991
207 Ga0207667_10018352 3300025949 Bacteria 7849
208 Ga0207667_10296277 3300025949 Bacteria 1652
209 Ga0207712_10026160 3300025961 Bacteria 3885
210 Ga0207668_10062476 3300025972 Bacteria 2622
211 Ga0207658_10242860 3300025986 Bacteria 1527
212 Ga0207703_10282370 3300026035 Bacteria 1508
213 Ga0207703_10562422 3300026035 Bacteria 1076
214 Ga0207639_10028861 3300026041 Bacteria 4055
215 Ga0207678_10025273 3300026067 Bacteria 5185
216 Ga0207678_10052363 3300026067 Bacteria 3522
217 Ga0207678_10061520 3300026067 Bacteria 3229
218 Ga0207678_10069743 3300026067 Bacteria 3014
219 Ga0207678_10074580 3300026067 Bacteria 2907
220 Ga0207678_10087953 3300026067 Bacteria 2655
221 Ga0207678_10096275 3300026067 Bacteria 2529
222 Ga0207678_10151195 3300026067 Bacteria 1982
223 Ga0207702_10000005 3300026078 Bacteria 420296
224 Ga0207702_10000081 3300026078 Bacteria 108009
225 Ga0207702_10255519 3300026078 Bacteria 1647
226 Ga0207702_10601286 3300026078 Bacteria 1079
227 Ga0207641_10442313 3300026088 Bacteria 1255
228 Ga0207648_10135637 3300026089 Bacteria 2168
229 Ga0207676_10405879 3300026095 Bacteria 1274
230 Ga0207674_10043098 3300026116 Bacteria 4655
231 Ga0207675_100011579 3300026118 Bacteria 8248
232 Ga0207675_100033023 3300026118 Bacteria 4822
233 Ga0207683_10072768 3300026121 Bacteria 3040
234 Ga0207683_10106285 3300026121 Bacteria 2510
235 Ga0207683_10116567 3300026121 Bacteria 2394
236 Ga0207683_10154195 3300026121 Bacteria 2074
237 Ga0207683_10327657 3300026121 Bacteria 1403
238 Ga0207698_10062290 3300026142 Bacteria 2912
239 Ga0207698_10077585 3300026142 Bacteria 2664
240 Ga0207698_10286857 3300026142 Bacteria 1525
241 Ga0209389_1000011 3300027296 Bacteria 223265
242 Ga0209389_1000025 3300027296 Bacteria 149588
243 Ga0209589_1000009 3300027357 Bacteria 252104
244 Ga0209589_1000066 3300027357 Bacteria 100795
245 Ga0209489_100010 3300027361 Bacteria 252139
246 Ga0209489_100017 3300027361 Bacteria 223265
247 Ga0209489_100030 3300027361 Bacteria 185999
248 Ga0209700_100017 3300027363 Bacteria 252104
249 Ga0209700_100027 3300027363 Bacteria 223462
250 Ga0268266_10001147 3300028379 Bacteria 32898
251 Ga0268266_10008591 3300028379 Bacteria 9072
252 Ga0268266_10014072 3300028379 Bacteria 6886
253 Ga0268266_10033130 3300028379 Bacteria 4393
254 Ga0268266_10066804 3300028379 Bacteria 3111
255 Ga0268266_10426890 3300028379 Bacteria 1257
256 Ga0268265_10044846 3300028380 Bacteria 3295
257 Ga0268265_10082002 3300028380 Bacteria 2549
258 Ga0268265_10156508 3300028380 Bacteria 1929
259 Ga0268264_10000035 3300028381 Bacteria 398196
260 Ga0265326_10002319 3300028558 Bacteria 6427
261 Ga0265319_1001659 3300028563 Bacteria 12877
262 Ga0265334_10000799 3300028573 Bacteria 15763
263 Ga0265318_10010755 3300028577 Bacteria 3971
264 Ga0265323_10003079 3300028653 Bacteria 7427
265 Ga0265322_10002933 3300028654 Bacteria 5194
266 Ga0265336_10000233 3300028666 Bacteria 39706
267 Ga0307517_10000062 3300028786 Bacteria 145054
268 Ga0307515_10063942 3300028794 Bacteria 5154
269 Ga0265338_10000090 3300028800 Bacteria 171540
270 Ga0265324_10006268 3300029957 Bacteria 4993
271 Ga0265330_10036948 3300031235 Bacteria 2175
272 Ga0265340_10001013 3300031247 Bacteria 15991
273 Ga0265331_10100264 3300031250 Bacteria 1333
274 Ga0307509_10015347 3300031507 Bacteria 8940
275 Ga0307509_10287354 3300031507 Bacteria 1401
276 Ga0307509_10358228 3300031507 Bacteria 1179
277 Ga0307508_10000532 3300031616 Bacteria 45338
278 Ga0307508_10007265 3300031616 Bacteria 10313
279 Ga0265314_10043780 3300031711 Bacteria 3179
280 Ga0265342_10154022 3300031712 Bacteria 1274
281 Ga0265342_10188823 3300031712 Bacteria 1125
282 Ga0307516_10012214 3300031730 Bacteria 9273
283 Ga0307516_10012607 3300031730 Bacteria 9094
284 Ga0307516_10097233 3300031730 Bacteria 2764
285 Ga0307516_10192637 3300031730 Bacteria 1764
286 Ga0307516_10310552 3300031730 Bacteria 1250
287 Ga0307413_10279574 3300031824 Bacteria 1255
288 Ga0307412_10075388 3300031911 Bacteria 2314
289 Ga0307409_100462482 3300031995 Bacteria 1227
290 Ga0307415_100061564 3300032126 Bacteria 2599
291 Ga0307415_100324726 3300032126 Bacteria 1285
292 Ga0307507_10023504 3300033179 Bacteria 6764
293 Ga0307510_10018748 3300033180 Bacteria 8132
294 Ga0307510_10075582 3300033180 Bacteria 3320
295 Ga0315911_1000009 3300033442 Bacteria 379354
296 Ga0373928_0008426 3300035084 Bacteria 2002
297 Ga0373939_0031774 3300035114 Bacteria 1529
298 Ga0373946_0028104 3300035171 Bacteria 2229
299 Ga0373931_0228115 3300035691 Bacteria 1124
300 Ga0373927_0082643 3300035695 Bacteria 2083
301 Ga0373927_0237369 3300035695 Bacteria 1198
302 Ga0373933_0000167 3300035724 Bacteria 42851
303 Ga0373947_0108025 3300035725 Bacteria 1755
304 Ga0373925_0087293 3300037068 Bacteria 2381
305 Ga0395899_0034271 3300037312 Bacteria 3812
306 Ga0395900_0019057 3300037418 Bacteria 6996
307 Ga0395898_0188863 3300037466 Bacteria 1969
308 Ga0395898_0222633 3300037466 Bacteria 1800
309 Ga0395905_0233194 3300037471 Bacteria 1721
310 Ga0436364_1156934 3300037853 Bacteria 1570
311 Ga0395901_0034427 3300038443 Bacteria 5231
312 Ga0395901_0152438 3300038443 Bacteria 2429
313 Ga0436360_1060898 3300039438 Bacteria 1415
314 Ga0436361_0152747 3300039447 Bacteria 2046
315 Ga0451853_1980775 3300041512 Bacteria 974
316 Ga0466969_0013180 3300044656 Bacteria 4356
317 Ga0466965_0056339 3300044683 Bacteria 1957
318 Ga0466966_0000148 3300044684 Bacteria 44828
319 Ga0466961_0000045 3300044693 Bacteria 75331
320 Ga0466964_0050790 3300044706 Bacteria 1701
321 Ga0466964_0060246 3300044706 Bacteria 1578
322 Ga0466968_0029823 3300044735 Bacteria 2257
323 Ga0466970_0042331 3300044765 Bacteria 2422
324 Ga0466957_0129504 3300044842 Bacteria 1615
325 Ga0466957_0157108 3300044842 Bacteria 1475
326 Ga0466960_0189599 3300044901 Bacteria 1118
327 Ga0466959_0003014 3300045049 Bacteria 10882
328 Ga0466959_0021412 3300045049 Bacteria 4768
329 Ga0495603_0018889 3300046455 Bacteria 4172
330 Ga0495603_0043688 3300046455 Bacteria 2675
331 Ga0495590_0015098 3300046457 Bacteria 2810
332 Ga0495629_0092111 3300046459 Bacteria 2116
333 Ga0495629_0096403 3300046459 Bacteria 2063
334 Ga0495638_0010390 3300046460 Bacteria 6470
335 Ga0495638_0020052 3300046460 Bacteria 4418
336 Ga0495638_0044353 3300046460 Bacteria 2801
337 Ga0495638_0129249 3300046460 Bacteria 1485
338 Ga0495651_0000472 3300046462 Bacteria 30989
339 Ga0495651_0311975 3300046462 Bacteria 1051
340 Ga0495653_0039871 3300046463 Bacteria 3676
341 Ga0495650_0040691 3300046471 Bacteria 1993
342 Ga0495580_0115154 3300046472 Bacteria 1867
343 Ga0495582_0120896 3300046473 Bacteria 1476
344 Ga0495664_0017778 3300046477 Bacteria 4065
345 Ga0495664_0316803 3300046477 Bacteria 941
346 Ga0495585_0065988 3300046492 Bacteria 1982
347 Ga0495594_0062068 3300046499 Bacteria 2069
348 Ga0495607_0067717 3300046501 Bacteria 2005
349 Ga0495606_0004247 3300046507 Bacteria 14485
350 Ga0495606_0005996 3300046507 Bacteria 11391
351 Ga0495606_0202546 3300046507 Bacteria 1130
352 Ga0495608_0018937 3300046511 Bacteria 4745
353 Ga0495610_0039561 3300046512 Bacteria 2383
354 Ga0495616_0100607 3300046513 Bacteria 1356
355 Ga0495628_0016126 3300046516 Bacteria 6234
356 Ga0495630_0136574 3300046517 Bacteria 1863
357 Ga0495631_0043205 3300046518 Bacteria 1988
358 Ga0495643_0029296 3300046522 Bacteria 3081
359 Ga0495643_0047211 3300046522 Bacteria 2333
360 Ga0495644_0021386 3300046523 Bacteria 2468
361 Ga0495648_0003979 3300046524 Bacteria 12789
362 Ga0495648_0092725 3300046524 Bacteria 1686
363 Ga0495663_0057358 3300046525 Bacteria 1218
364 Ga0495652_0001339 3300046529 Bacteria 27421
365 Ga0495587_0012944 3300046536 Bacteria 5245
366 Ga0495622_0027387 3300046557 Bacteria 2660
367 Ga0495622_0068564 3300046557 Bacteria 1638
368 Ga0495633_0135270 3300046558 Bacteria 1140
369 Ga0495667_0007621 3300046559 Bacteria 7343
370 Ga0495656_0001067 3300046615 Bacteria 8878
371 Ga0495656_0025016 3300046615 Bacteria 2363
372 Ga0495668_0024598 3300046616 Bacteria 3425
373 Ga0495668_0209439 3300046616 Bacteria 1067
374 Ga0495634_0013513 3300046642 Bacteria 5898
375 Ga0495611_0010250 3300046648 Bacteria 3965
376 Ga0495625_0043231 3300046660 Bacteria 3269
377 Ga0495625_0053001 3300046660 Bacteria 2903
378 Ga0495588_0046912 3300046674 Bacteria 2217
379 Ga0495657_0005672 3300046675 Bacteria 9843
380 Ga0495599_0016375 3300046678 Bacteria 4602
381 Ga0495623_0004396 3300046679 Bacteria 9261
382 Ga0495669_0024616 3300046684 Bacteria 2621
383 Ga0495669_0145660 3300046684 Bacteria 1119
384 Ga0495613_0027045 3300046689 Bacteria 4270
385 Ga0495670_0016306 3300046691 Bacteria 3650
386 Ga0495671_0119520 3300046692 Bacteria 1286
387 Ga0495649_0050747 3300046694 Bacteria 2250
388 Ga0495600_0006605 3300046809 Bacteria 7066
389 Ga0495581_0108464 3300047315 Bacteria 1614
390 Ga0495604_0000953 3300047317 Bacteria 24133
391 Ga0495674_0008322 3300047319 Bacteria 9890
392 Ga0495672_0015872 3300047320 Bacteria 5099
393 Ga0495672_0021750 3300047320 Bacteria 4178
394 Ga0495676_0014964 3300047321 Bacteria 6924
395 Ga0495680_0001642 3300047322 Bacteria 23759
396 Ga0495687_042517 3300047443 Bacteria 1985
397 Ga0495686_0128589 3300047472 Bacteria 1504
398 Ga0495686_0179108 3300047472 Bacteria 1229
399 Ga0495593_0041694 3300047673 Bacteria 2467
400 Ga0495602_0019800 3300048088 Bacteria 6667
401 Ga0495615_0039805 3300048090 Bacteria 1168
402 Ga0495615_0042269 3300048090 Bacteria 1143
403 Ga0495615_0049047 3300048090 Bacteria 1081
404 Ga0496100_0136209 3300048903 Bacteria 1735
405 Ga0496100_0150824 3300048903 Bacteria 1658
406 Ga0496101_0179936 3300048904 Bacteria 1628
407 Ga0496101_0289218 3300048904 Bacteria 1282
408 Ga0496102_0009044 3300048905 Bacteria 8548
409 Ga0496102_0057494 3300048905 Bacteria 3552
410 Ga0496102_0244571 3300048905 Bacteria 1692
411 Ga0496102_0285540 3300048905 Bacteria 1555
412 Ga0496102_0316404 3300048905 Bacteria 1470
413 Ga0496103_0015643 3300048906 Bacteria 4521
414 Ga0496103_0106108 3300048906 Bacteria 1781
415 Ga0496104_0004724 3300048907 Bacteria 11857
416 Ga0496104_0078088 3300048907 Bacteria 3154
417 Ga0496104_0194318 3300048907 Bacteria 1941
418 Ga0496104_0322309 3300048907 Bacteria 1458
419 Ga0496105_0011117 3300048908 Bacteria 7100
420 Ga0496105_0106881 3300048908 Bacteria 2310
421 Ga0496106_0027320 3300048909 Bacteria 4250
422 Ga0496106_0046484 3300048909 Bacteria 3264
423 Ga0496106_0063950 3300048909 Bacteria 2798
424 Ga0496106_0129070 3300048909 Bacteria 1981
425 Ga0496106_0216270 3300048909 Bacteria 1527
426 Ga0496106_0318787 3300048909 Bacteria 1248
427 Ga0496107_0065379 3300048910 Bacteria 2636
428 Ga0496107_0065968 3300048910 Bacteria 2624
429 Ga0496108_0015476 3300048911 Bacteria 6222
430 Ga0496108_0138255 3300048911 Bacteria 2098
431 Ga0496109_0019407 3300048912 Bacteria 5995
432 Ga0496109_0020502 3300048912 Bacteria 5839
433 Ga0496109_0112483 3300048912 Bacteria 2532
434 Ga0496110_0072371 3300048913 Bacteria 3058
435 Ga0496110_0074209 3300048913 Bacteria 3020
436 Ga0496111_0091246 3300048914 Bacteria 2232
437 Ga0496111_0296162 3300048914 Bacteria 1199
438 Ga0496112_0004323 3300048915 Bacteria 12012
439 Ga0496112_0088407 3300048915 Bacteria 3066
440 Ga0496112_0127333 3300048915 Bacteria 2517
441 Ga0496112_0214242 3300048915 Bacteria 1883
442 Ga0496113_0028782 3300048916 Bacteria 4000
443 Ga0496113_0063686 3300048916 Bacteria 2787
444 Ga0496113_0132218 3300048916 Bacteria 1959
445 Ga0496114_0031614 3300048917 Bacteria 4354
446 Ga0496114_0187808 3300048917 Bacteria 1807
447 Ga0496114_0221690 3300048917 Bacteria 1660
448 Ga0496115_0011656 3300048918 Bacteria 6598
449 Ga0496115_0050745 3300048918 Bacteria 3325
450 Ga0496115_0057194 3300048918 Bacteria 3136
451 Ga0496115_0063037 3300048918 Bacteria 2991
452 Ga0496115_0067141 3300048918 Bacteria 2900
453 Ga0496115_0129053 3300048918 Bacteria 2083
454 Ga0496116_0003781 3300048919 Bacteria 14794
455 Ga0496117_0077577 3300048920 Bacteria 2198
456 Ga0496117_0083558 3300048920 Bacteria 2087
457 Ga0496118_0021551 3300048921 Bacteria 5667
458 Ga0496118_0046349 3300048921 Bacteria 3383
459 Ga0496120_0166747 3300048923 Bacteria 1093
460 Ga0496121_0001443 3300048924 Bacteria 40145
461 Ga0496121_0001527 3300048924 Bacteria 38742
462 Ga0496121_0006578 3300048924 Bacteria 14342
463 Ga0496121_0032132 3300048924 Bacteria 4777
464 Ga0496121_0056496 3300048924 Bacteria 3260
465 Ga0496121_0102601 3300048924 Bacteria 2203
466 Ga0496121_0106850 3300048924 Bacteria 2145
467 Ga0496122_0026944 3300048925 Bacteria 4934
468 Ga0496124_0002203 3300048927 Bacteria 25990
469 Ga0496124_0244482 3300048927 Bacteria 1332
470 Ga0496124_0249313 3300048927 Bacteria 1315
471 Ga0496125_0000092 3300048928 Bacteria 211050
472 Ga0496125_0009813 3300048928 Bacteria 9756
473 Ga0496125_0090446 3300048928 Bacteria 2297
474 Ga0496125_0097212 3300048928 Bacteria 2182
475 Ga0496125_0101012 3300048928 Bacteria 2124
476 Ga0496126_0006684 3300048929 Bacteria 12815
477 Ga0496126_0039188 3300048929 Bacteria 4399
478 Ga0496126_0077337 3300048929 Bacteria 2950
479 Ga0496126_0257206 3300048929 Bacteria 1453
480 Ga0495682_0010078 3300049460 Bacteria 3670
481 Ga0501042_0276773 3300049578 Bacteria 1212
482 Ga0501047_0050488 3300049581 Bacteria 4017
483 Ga0501068_0201606 3300049584 Bacteria 1262
484 Ga0501070_0185960 3300049586 Bacteria 1709
485 Ga0501044_0233648 3300049823 Bacteria 1785
486 nmdc:mga03n38_124944_c1 3300050490 Bacteria 1269
487 nmdc:mga03n38_83409_c1 3300050490 Bacteria 1507
488 nmdc:mga00v17_202324_c1 3300050491 Bacteria 1284
489 nmdc:mga0yw44_112073_c1 3300050492 Bacteria 1749
490 nmdc:mga0yw44_25249_c2 3300050492 Bacteria 1573
491 nmdc:mga06z11_45600_c1 3300050494 Bacteria 2217
492 nmdc:mga04h51_45470_c1 3300050495 Bacteria 1452
493 nmdc:mga05p37_141697_c1 3300050507 Bacteria 2945
494 nmdc:mga0rr50_174705_c1 3300050513 Bacteria 1752
495 Ga0495601_0042376 3300053077 Bacteria 2856
496 Ga0495601_0286446 3300053077 Bacteria 1074
497 Ga0500635_0028777 3300053080 Bacteria 1778
498 Ga0495595_0062252 3300053084 Bacteria 1749
499 Ga0495619_0028489 3300053085 Bacteria 3603
500 Ga0500643_000019 3300053087 Bacteria 294301
501 Ga0500651_0061733 3300053093 Bacteria 2340
502 Ga0500651_0067270 3300053093 Bacteria 2231
503 Ga0500566_0000693 3300053094 Bacteria 18973
504 Ga0500566_0003060 3300053094 Bacteria 9993
505 Ga0500566_0004708 3300053094 Bacteria 8125
506 Ga0500641_0009503 3300053096 Bacteria 3498
507 Ga0500641_0021737 3300053096 Bacteria 2450
508 Ga0500641_0063799 3300053096 Bacteria 1538
509 Ga0500650_0002857 3300053098 Bacteria 5835
510 Ga0500556_0000024 3300053104 Bacteria 167556
511 Ga0500569_017427 3300053109 Bacteria 1836
512 Ga0500595_000478 3300053119 Bacteria 24694
513 Ga0500595_008096 3300053119 Bacteria 4312
514 Ga0500607_036478 3300053121 Bacteria 2684
515 Ga0500608_001404 3300053122 Bacteria 8620
516 Ga0500618_012076 3300053125 Bacteria 2272
517 Ga0500642_0000035 3300053130 Bacteria 106656
518 Ga0500642_0000096 3300053130 Bacteria 42836
519 Ga0500642_0014156 3300053130 Bacteria 2959
520 Ga0500642_0053040 3300053130 Bacteria 1797
521 Ga0500652_000404 3300053131 Bacteria 15463
522 Ga0500658_0022678 3300053134 Bacteria 2390
523 Ga0500658_0043662 3300053134 Bacteria 1805
524 Ga0500559_0039548 3300053136 Bacteria 2052
525 Ga0500568_0005040 3300053139 Bacteria 6916
526 Ga0500568_0017048 3300053139 Bacteria 3214
527 Ga0500577_0001147 3300053142 Bacteria 6786
528 Ga0500577_0079393 3300053142 Bacteria 1305
529 Ga0500586_001242 3300053145 Bacteria 5328
530 Ga0500604_0001709 3300053151 Bacteria 6155
531 Ga0500604_0045570 3300053151 Bacteria 1338
532 Ga0500616_0000122 3300053153 Bacteria 140228
533 Ga0500622_0000790 3300053156 Bacteria 27440
534 Ga0500634_0161980 3300053161 Bacteria 1031
535 Ga0500638_024000 3300053162 Bacteria 2903
536 Ga0500636_0000410 3300053177 Bacteria 23626
537 Ga0500636_0006371 3300053177 Bacteria 6769
538 Ga0500636_0017882 3300053177 Bacteria 4190
539 Ga0500637_0000245 3300053178 Bacteria 20132
540 Ga0500625_000095 3300053729 Bacteria 16474
541 Ga0500609_003240 3300053731 Bacteria 2303
542 Ga0500596_013260 3300053735 Bacteria 1246
543 Ga0500599_006070 3300053736 Bacteria 1534
544 Ga0500601_000120 3300053737 Bacteria 16487
545 Ga0500661_000938 3300055283 Bacteria 5458
546 Ga0500661_008979 3300055283 Bacteria 1836
547 Ga0500661_011620 3300055283 Bacteria 1591
548 2507509971 2507262055 Bacteria 8048963
549 2509147611 2508501128 Bacteria 8613869
550 2511398902 2511231028 Bacteria 8046582
551 2513627614 2513237092 Bacteria 8341956
552 2513645016 2513237094 Bacteria 8789602
553 2513652261 2513237095 Bacteria 8976980
554 2513659266 2513237096 Bacteria 8722461
555 2513676379 2513237098 Bacteria 9902361
556 2513696092 2513237101 Bacteria 7952346
557 2513862038 2513237137 Bacteria 9558895
558 2513921472 2513237145 Bacteria 8979722
559 2514011273 2513237161 Bacteria 8871253
560 2517103276 2517093001 Bacteria 9002274
561 2517893786 2517572143 Bacteria 9484767
562 2524439004 2524023205 Bacteria 8918781
563 2524469411 2524023210 Bacteria 9029266
564 2524537734 2524023228 Bacteria 10118060
565 2528852738 2528768022 Bacteria 10457665
566 2603861107 2602042107 Bacteria 6226103
567 2617353446 2617270735 Bacteria 9163226
568 2617377997 2617270741 Bacteria 8201522
569 2644287860 2643221651 Bacteria 4798932
570 2671124125 2667528175 Bacteria 7532676
571 2723846327 2721755755 Bacteria 8322773
572 2728752929 2728368998 Bacteria 8720350
573 2745078883 2744054633 Bacteria 8678936
574 2793060041 2791355196 Bacteria 7323613
575 2793070713 2791355197 Bacteria 8420563
576 2793083271
577 2818242486 2816332527 Bacteria 8933356
578 2824605657 2824600985 Bacteria 8488197
579 2824609908 2824609381 Bacteria 8672835
580 2824655693 2824653114 Bacteria 8493680
581 2824666579 2824661429 Bacteria 9877870
582 2824686620 2824679649 Bacteria 8248951
583 2824707786 2824704595 Bacteria 9667483
584 2824751082 2824746037 Bacteria 7911610
585 2824758095 2824753945 Bacteria 9787441
586 2824766233 2824763712 Bacteria 9792355
587 2824774246 2824773399 Bacteria 8360218
588 2838127583 2838122688 Bacteria 8803140
589 2841941466 2841941048 Bacteria 8688029
590 2841952523 2841949485 Bacteria 8680857
591 2841959541 2841957949 Bacteria 8652217
592 2841967607 2841966195 Bacteria 8673214
593 2841979002 2841974524 Bacteria 8931498
594 2841986544 2841983080 Bacteria 8395090
595 2842038312 2842038055 Bacteria 8002051
596 2842048743 2842045827 Bacteria 8006841
597 2844317784 2844315083 Bacteria 8138177
598 2847934570 2847930680 Bacteria 9342022
599 2849080637 2849076700 Bacteria 7039503
600 2857510000 2857509624 Bacteria 7472071
601 2857528764 2857524615 Bacteria 6615449
602 2874610705 2874604998 Bacteria 7834745
603 2874618271 2874612657 Bacteria 8252029
604 2874623261 2874620515 Bacteria 8290088
605 2874635961 2874628541 Bacteria 8630250
606 2874653052 2874645413 Bacteria 8214782
607 2876766642 2876761206 Bacteria 10111113
608 2876811733 2876808645 Bacteria 8824342
609 2879089758 2879083081 Bacteria 8587928
610 2879104036 2879099564 Bacteria 10442239
611 2879118784 2879110137 Bacteria 8907982
612 2879130860 2879127579 Bacteria 8294491
613 2879147550 2879142872 Bacteria 8267021
614 2881671818 2881665667 Bacteria 8175609
615 2885376270 2885374607 Bacteria 8927485
616 2885388003 2885383462 Bacteria 9473874
617 2885411795 2885409591 Bacteria 9235467
618 2888382519 2888378607 Bacteria 9652610
619 2888388179 2888388044 Bacteria 7304136
620 2888423096 2888419890 Bacteria 7857137
621 2889039174 2889033259 Bacteria 9099371
622 2893068959 2893066018 Bacteria 6158120
623 2903735462 2903727486 Bacteria 8281579
624 2903755952 2903748898 Bacteria 9972761
625 2903775947 2903768456 Bacteria 9749579
626 2904670081 2904666416 Bacteria 8226587
627 2904691557 2904690495 Bacteria 9412302
628 2904705055
629 2904718415 2904711408 Bacteria 9771557
630 2906607536 2906602504 Bacteria 8295279
631 2906610671
632 2906634935 2906626472 Bacteria 8826946
633 2906641233 2906635258 Bacteria 8601019
634 2906648971 2906643746 Bacteria 8722424
635 2906665163 2906660503 Bacteria 8595048
636 2908744194 2908739725 Bacteria 8628932
637 2908761632 2908756301 Bacteria 8864324
638 2908778760 2908775508 Bacteria 8092255
639 2919079192 2919073203 Bacteria 6531949
640 2922362133 2922361189 Bacteria 7436256
641 2922375439
642 2922388103 2922386360 Bacteria 7017218
643 2922395036 2922393267 Bacteria 8285685
644 2922428653
645 2929616176 2929615660 Bacteria 9193770
646 2929624920 2929624759 Bacteria 9339455
647 2932787159 2932784394 Bacteria 9704911
648 2932811352 2932809354 Bacteria 9135765
649 2932819775 2932818245 Bacteria 9955613
650 2932835776 2932828146 Bacteria 9745859
651 2933578540 2933577622 Bacteria 9116884
652 2935611124 2935608549 Bacteria 8203142
653 2935618961 2935616580 Bacteria 9032984
654 2935634624 2935630451 Bacteria 8169952
655 2935643222 2935638405 Bacteria 10015038
656 2935669848 2935665750 Bacteria 9571747
657 2935677011 2935675223 Bacteria 9928132
658 2935693052 2935684952 Bacteria 9590419
659 2935695456 2935694250 Bacteria 9291695
660 2935709433 2935703347 Bacteria 10242284
661 2935719660 2935713505 Bacteria 9608509
662 2935729573 2935722832 Bacteria 9608746
663 2935739543 2935732158 Bacteria 9706831
664 2935748581 2935741537 Bacteria 9707219
665 2935756832 2935750917 Bacteria 9590372
666 2935761180 2935760218 Bacteria 9817913
667 2935779214 2935777560 Bacteria 8077691
668 2935807365 2935801545 Bacteria 9301974
669 2935812505 2935810662 Bacteria 9401221
670 2935820609 2935819856 Bacteria 8261050
671 2935832634 2935827899 Bacteria 10038562
672 2935839287 2935837841 Bacteria 9454360
673 2935849382 2935847175 Bacteria 8228321
674 2935857326 2935855204 Bacteria 9035059
675 2935864855 2935864058 Bacteria 9784707
676 2935876633 2935873716 Bacteria 9632195
677 2935885022 2935883170 Bacteria 7964738
678 2935911843 2935908558 Bacteria 8568796
679 2935920523 2935916978 Bacteria 9113783
680 2935928872 2935926038 Bacteria 8601059
681 2935938517 2935934488 Bacteria 8602579
682 2935945591 2935942939 Bacteria 8599779
683 2935954802 2935951376 Bacteria 8602333
684 2935963401 2935959822 Bacteria 7869783
685 2935970689 2935967501 Bacteria 8603075
686 2935999015 2935992306 Bacteria 9802711
687 2936008227 2936002035 Bacteria 9362176
688 2936039098 2936037263 Bacteria 9446081
689 2940562746 2940556831 Bacteria 9590747
690 2941509110 2941507105 Bacteria 8166816
691 2941516939 2941515067 Bacteria 8166720
692 2941524966 2941523033 Bacteria 8169134
693 2941536421 2941531003 Bacteria 7653939
694 2941539977 2941538514 Bacteria 9402094
695 3005478784 3005474847 Bacteria 9259049
696 3005487983 3005483717 Bacteria 7877331
697 3005508685 3005506211 Bacteria 6943378
698 3005590666 3005587118 Bacteria 7794411
699 3005597537 3005594810 Bacteria 8716512
700 3005713559 3005710791 Bacteria 7622528
701 3005720961 3005718088 Bacteria 8283608
702 8006926924 8006926726 Bacteria 6749210
703 8006942561 8006933436 Bacteria 10410654
704 8006964708 8006964411 Bacteria 8966052
705 8006982285 8006973647 Bacteria 10679141
706 8006991940 8006984368 Bacteria 9651211
707 8006999872 8006994254 Bacteria 8309700
708 8016515047 8016511872 Bacteria 9921665
709 8016590901 8016583857 Bacteria 10421953
710 8016612182 8016603502 Bacteria 8731218
711 8016621620 8016613128 Bacteria 8794220
712 8016628340 8016622563 Bacteria 7999408
713 8017061406 8017057580 Bacteria 10023680
714 8019543435 8019538911 Bacteria 7872763
715 8019555419 8019547302 Bacteria 7996444
716 8019558326 8019555841 Bacteria 9642137
717 8019566967 8019565922 Bacteria 9639779
718 8019580881 8019576017 Bacteria 10049540
719 8019588615 8019586578 Bacteria 10212056
720 8019602720 8019597564 Bacteria 10041141
721 8019615839 8019608314 Bacteria 10042931
722 8019656523 8019648815 Bacteria 10014479
723 8019682808 8019678201 Bacteria 8863603
724 8019688496 8019687851 Bacteria 8712826
725 8055747823 8055742211 Bacteria 9226248
726 8056680290 8056673599 Bacteria 7871253
727 8056688392 8056681323 Bacteria 8472857
728 8056695938 8056689827 Bacteria 6712655
729 8056970029 8056967851 Bacteria 9038162
730 Ga0496121_0106268
731 JGI25153J46596_10006992
732 JGI25153J46596_10013502
733 JGI25153J46596_10028198
734 JGI25160J50197_1003053
735 JGI25160J50197_1006569
736 JGI25160J50197_1008476
737 Ga0055531_10002184
738 Ga0055543_1002709
739 Ga0055543_1019394
740 Ga0065165_1002008
741 Ga0065165_1003321
742 Ga0065165_1019182
743 Ga0070683_100104782
744 Ga0070691_10136730
745 Ga0070671_100040085
746 Ga0070671_100152055
747 Ga0070671_100397954
748 Ga0070674_100026876
749 Ga0070659_100118374
750 Ga0070659_100136260
751 Ga0070659_100176911
752 Ga0070714_100072130
753 Ga0070713_100027904
754 Ga0070711_100061847
755 Ga0070711_100170657
756 Ga0070663_100059606
757 Ga0070663_100117828
758 Ga0070678_100063017
759 Ga0070681_10207592
760 Ga0068867_100335067
761 Ga0070699_100289351
762 Ga0070684_100210520
763 Ga0068853_100032760
764 Ga0068853_100080791
765 Ga0068853_100432525
766 Ga0070672_100303163
767 Ga0070665_100091247
768 Ga0070665_100164440
769 Ga0070665_100176989
770 Ga0070665_100262055
771 Ga0068855_100029681
772 Ga0068855_100272316
773 Ga0068857_100034794
774 Ga0068854_100033432
775 Ga0068854_100311938
776 Ga0068856_100059957
777 Ga0068856_100151937
778 Ga0068856_100172852
779 Ga0068856_100316529
780 Ga0068856_100426575
781 Ga0068852_100127562
782 Ga0068852_100140619
783 Ga0068852_100210129
784 Ga0068852_100462671
785 Ga0068859_100293006
786 Ga0068864_100041362
787 Ga0068861_100028438
788 Ga0068861_100058215
789 Ga0068851_10086843
790 Ga0068851_10090151
791 Ga0068863_100455261
792 Ga0068863_100468613
793 Ga0068858_100015486
794 Ga0068860_100006537
795 Ga0068860_100063240
796 Ga0068860_100405025
797 Ga0068862_100080802
798 Ga0068862_100147298
799 Ga0068862_100169042
800 Ga0081455_10007549
801 Ga0081540_1001498
802 Ga0081540_1007278
803 Ga0081540_1010330
804 Ga0081540_1011806
805 Ga0081540_1025933
806 Ga0081540_1061880
807 Ga0081540_1095883
808 Ga0081539_10000726
809 Ga0081539_10039521
810 Ga0081539_10088789
811 Ga0075365_10053901
812 Ga0075365_10116928
813 Ga0075365_10176280
814 Ga0075368_10041526
815 Ga0075363_100094919
816 Ga0075364_10024769
817 Ga0070712_100048762
818 Ga0075367_10002487
819 Ga0075367_10034297
820 Ga0075367_10112461
821 Ga0097621_100029785
822 Ga0097621_100111716
823 Ga0068871_100101694
824 Ga0075428_100227353
825 Ga0075434_100113763
826 Ga0068865_100167336
827 Ga0068865_100221467
828 Ga0097620_100293006
829 Ga0099824_1013588
830 Ga0099824_1032175
831 Ga0099823_1048446
832 Ga0075435_100115090
833 Ga0105240_10010641
834 Ga0105240_10345344
835 Ga0105240_10501239
836 Ga0111539_10121045
837 Ga0105245_10068511
838 Ga0105245_10118252
839 Ga0114129_10101918
840 Ga0105243_10025134
841 Ga0105243_10209828
842 Ga0105243_10395159
843 Ga0105241_10059471
844 Ga0105241_10201831
845 Ga0105241_10313071
846 Ga0105241_10318435
847 Ga0105248_10065648
848 Ga0105248_10186777
849 Ga0105248_10265965
850 Ga0105248_10351505
851 Ga0105237_10004145
852 Ga0105237_10024695
853 Ga0105237_10070302
854 Ga0105237_10152706
855 Ga0105237_10263430
856 Ga0105238_10080027
857 Ga0099796_10012659
858 Ga0105239_10046661
859 Ga0105239_10060893
860 Ga0105239_10062712
861 Ga0105239_10083618
862 Ga0105239_10151918
863 Ga0105239_10347772
864 Ga0105246_10010071
865 Ga0157370_10079560
866 Ga0157369_10395679
867 Ga0157374_10011421
868 Ga0157374_10079256
869 Ga0157378_10183677
870 Ga0163162_10094550
871 Ga0163162_10280498
872 Ga0157375_10148274
873 Ga0157375_10388808
874 Ga0163163_10059377
875 Ga0163163_10420762
876 Ga0157379_10016120
877 Ga0157379_10043659
878 Ga0157376_10347825
879 Ga0214544_1000006
880 Ga0214542_1000002
881 Ga0214545_1000002
882 Ga0214543_1000017
883 Ga0213871_10009496
884 Ga0209563_101461
885 Ga0209677_108682
886 Ga0209148_1000447
887 Ga0209564_1003910
888 Ga0209758_1000065
889 Ga0209758_1002429
890 Ga0209758_1003622
891 Ga0209758_1025282
892 Ga0209758_1025863
893 Ga0209256_1011253
894 Ga0209256_1021691
895 Ga0207426_1000554
896 Ga0207426_1000561
897 Ga0207426_1002946
898 Ga0209257_1000833
899 Ga0209257_1031441
900 Ga0207656_10066356
901 Ga0207688_10006431
902 Ga0207688_10019196
903 Ga0207647_10089740
904 Ga0207705_10304071
905 Ga0207654_10000803
906 Ga0207654_10002540
907 Ga0207707_10165102
908 Ga0207695_10000029
909 Ga0207695_10001543
910 Ga0207671_10018788
911 Ga0207671_10156511
912 Ga0207693_10255227
913 Ga0207663_10129358
914 Ga0207657_10009798
915 Ga0207694_10232227
916 Ga0207650_10061111
917 Ga0207659_10206460
918 Ga0207687_10013194
919 Ga0207687_10168295
920 Ga0207700_10042530
921 Ga0207700_10154985
922 Ga0207664_10301067
923 Ga0207690_10107884
924 Ga0207706_10099577
925 Ga0207706_10136104
926 Ga0207706_10345983
927 Ga0207709_10012963
928 Ga0207669_10040409
929 Ga0207669_10062176
930 Ga0207704_10095030
931 Ga0207691_10081307
932 Ga0207691_10139582
933 Ga0207689_10010305
934 Ga0207689_10062250
935 Ga0207667_10007604
936 Ga0207667_10018352
937 Ga0207667_10296277
938 Ga0207712_10026160
939 Ga0207668_10062476
940 Ga0207658_10242860
941 Ga0207703_10282370
942 Ga0207703_10562422
943 Ga0207639_10028861
944 Ga0207678_10025273
945 Ga0207678_10052363
946 Ga0207678_10061520
947 Ga0207678_10069743
948 Ga0207678_10074580
949 Ga0207678_10087953
950 Ga0207678_10096275
951 Ga0207678_10151195
952 Ga0207702_10000005
953 Ga0207702_10000081
954 Ga0207702_10255519
955 Ga0207702_10601286
956 Ga0207641_10442313
957 Ga0207648_10135637
958 Ga0207676_10405879
959 Ga0207674_10043098
960 Ga0207675_100011579
961 Ga0207675_100033023
962 Ga0207683_10072768
963 Ga0207683_10106285
964 Ga0207683_10116567
965 Ga0207683_10154195
966 Ga0207683_10327657
967 Ga0207698_10062290
968 Ga0207698_10077585
969 Ga0207698_10286857
970 Ga0209389_1000011
971 Ga0209389_1000025
972 Ga0209589_1000009
973 Ga0209589_1000066
974 Ga0209489_100010
975 Ga0209489_100017
976 Ga0209489_100030
977 Ga0209700_100017
978 Ga0209700_100027
979 Ga0268266_10001147
980 Ga0268266_10008591
981 Ga0268266_10014072
982 Ga0268266_10033130
983 Ga0268266_10066804
984 Ga0268266_10426890
985 Ga0268265_10044846
986 Ga0268265_10082002
987 Ga0268265_10156508
988 Ga0268264_10000035
989 Ga0265326_10002319
990 Ga0265319_1001659
991 Ga0265334_10000799
992 Ga0265318_10010755
993 Ga0265323_10003079
994 Ga0265322_10002933
995 Ga0265336_10000233
996 Ga0307517_10000062
997 Ga0307515_10063942
998 Ga0265338_10000090
999 Ga0265324_10006268
1000 Ga0265330_10036948
1001 Ga0265340_10001013
1002 Ga0265331_10100264
1003 Ga0307509_10015347
1004 Ga0307509_10287354
1005 Ga0307509_10358228
1006 Ga0307508_10000532
1007 Ga0307508_10007265
1008 Ga0265314_10043780
1009 Ga0265342_10154022
1010 Ga0265342_10188823
1011 Ga0307516_10012214
1012 Ga0307516_10012607
1013 Ga0307516_10097233
1014 Ga0307516_10192637
1015 Ga0307516_10310552
1016 Ga0307413_10279574
1017 Ga0307412_10075388
1018 Ga0307409_100462482
1019 Ga0307415_100061564
1020 Ga0307415_100324726
1021 Ga0307507_10023504
1022 Ga0307510_10018748
1023 Ga0307510_10075582
1024 Ga0315911_1000009
1025 Ga0373928_0008426
1026 Ga0373939_0031774
1027 Ga0373946_0028104
1028 Ga0373931_0228115
1029 Ga0373927_0082643
1030 Ga0373927_0237369
1031 Ga0373933_0000167
1032 Ga0373947_0108025
1033 Ga0373925_0087293
1034 Ga0395899_0034271
1035 Ga0395900_0019057
1036 Ga0395898_0188863
1037 Ga0395898_0222633
1038 Ga0395905_0233194
1039 Ga0436364_1156934
1040 Ga0395901_0034427
1041 Ga0395901_0152438
1042 Ga0436360_1060898
1043 Ga0436361_0152747
1044 Ga0451853_1980775
1045 Ga0466969_0013180
1046 Ga0466965_0056339
1047 Ga0466966_0000148
1048 Ga0466961_0000045
1049 Ga0466964_0050790
1050 Ga0466964_0060246
1051 Ga0466968_0029823
1052 Ga0466970_0042331
1053 Ga0466957_0129504
1054 Ga0466957_0157108
1055 Ga0466960_0189599
1056 Ga0466959_0003014
1057 Ga0466959_0021412
1058 Ga0495603_0018889
1059 Ga0495603_0043688
1060 Ga0495590_0015098
1061 Ga0495629_0092111
1062 Ga0495629_0096403
1063 Ga0495638_0010390
1064 Ga0495638_0020052
1065 Ga0495638_0044353
1066 Ga0495638_0129249
1067 Ga0495651_0000472
1068 Ga0495651_0311975
1069 Ga0495653_0039871
1070 Ga0495650_0040691
1071 Ga0495580_0115154
1072 Ga0495582_0120896
1073 Ga0495664_0017778
1074 Ga0495664_0316803
1075 Ga0495585_0065988
1076 Ga0495594_0062068
1077 Ga0495607_0067717
1078 Ga0495606_0004247
1079 Ga0495606_0005996
1080 Ga0495606_0202546
1081 Ga0495608_0018937
1082 Ga0495610_0039561
1083 Ga0495616_0100607
1084 Ga0495628_0016126
1085 Ga0495630_0136574
1086 Ga0495631_0043205
1087 Ga0495643_0029296
1088 Ga0495643_0047211
1089 Ga0495644_0021386
1090 Ga0495648_0003979
1091 Ga0495648_0092725
1092 Ga0495663_0057358
1093 Ga0495652_0001339
1094 Ga0495587_0012944
1095 Ga0495622_0027387
1096 Ga0495622_0068564
1097 Ga0495633_0135270
1098 Ga0495667_0007621
1099 Ga0495656_0001067
1100 Ga0495656_0025016
1101 Ga0495668_0024598
1102 Ga0495668_0209439
1103 Ga0495634_0013513
1104 Ga0495611_0010250
1105 Ga0495625_0043231
1106 Ga0495625_0053001
1107 Ga0495588_0046912
1108 Ga0495657_0005672
1109 Ga0495599_0016375
1110 Ga0495623_0004396
1111 Ga0495669_0024616
1112 Ga0495669_0145660
1113 Ga0495613_0027045
1114 Ga0495670_0016306
1115 Ga0495671_0119520
1116 Ga0495649_0050747
1117 Ga0495600_0006605
1118 Ga0495581_0108464
1119 Ga0495604_0000953
1120 Ga0495674_0008322
1121 Ga0495672_0015872
1122 Ga0495672_0021750
1123 Ga0495676_0014964
1124 Ga0495680_0001642
1125 Ga0495687_042517
1126 Ga0495686_0128589
1127 Ga0495686_0179108
1128 Ga0495593_0041694
1129 Ga0495602_0019800
1130 Ga0495615_0039805
1131 Ga0495615_0042269
1132 Ga0495615_0049047
1133 Ga0496100_0136209
1134 Ga0496100_0150824
1135 Ga0496101_0179936
1136 Ga0496101_0289218
1137 Ga0496102_0009044
1138 Ga0496102_0057494
1139 Ga0496102_0244571
1140 Ga0496102_0285540
1141 Ga0496102_0316404
1142 Ga0496103_0015643
1143 Ga0496103_0106108
1144 Ga0496104_0004724
1145 Ga0496104_0078088
1146 Ga0496104_0194318
1147 Ga0496104_0322309
1148 Ga0496105_0011117
1149 Ga0496105_0106881
1150 Ga0496106_0027320
1151 Ga0496106_0046484
1152 Ga0496106_0063950
1153 Ga0496106_0129070
1154 Ga0496106_0216270
1155 Ga0496106_0318787
1156 Ga0496107_0065379
1157 Ga0496107_0065968
1158 Ga0496108_0015476
1159 Ga0496108_0138255
1160 Ga0496109_0019407
1161 Ga0496109_0020502
1162 Ga0496109_0112483
1163 Ga0496110_0072371
1164 Ga0496110_0074209
1165 Ga0496111_0091246
1166 Ga0496111_0296162
1167 Ga0496112_0004323
1168 Ga0496112_0088407
1169 Ga0496112_0127333
1170 Ga0496112_0214242
1171 Ga0496113_0028782
1172 Ga0496113_0063686
1173 Ga0496113_0132218
1174 Ga0496114_0031614
1175 Ga0496114_0187808
1176 Ga0496114_0221690
1177 Ga0496115_0011656
1178 Ga0496115_0050745
1179 Ga0496115_0057194
1180 Ga0496115_0063037
1181 Ga0496115_0067141
1182 Ga0496115_0129053
1183 Ga0496116_0003781
1184 Ga0496117_0077577
1185 Ga0496117_0083558
1186 Ga0496118_0021551
1187 Ga0496118_0046349
1188 Ga0496120_0166747
1189 Ga0496121_0001443
1190 Ga0496121_0001527
1191 Ga0496121_0006578
1192 Ga0496121_0032132
1193 Ga0496121_0056496
1194 Ga0496121_0102601
1195 Ga0496121_0106850
1196 Ga0496122_0026944
1197 Ga0496124_0002203
1198 Ga0496124_0244482
1199 Ga0496124_0249313
1200 Ga0496125_0000092
1201 Ga0496125_0009813
1202 Ga0496125_0090446
1203 Ga0496125_0097212
1204 Ga0496125_0101012
1205 Ga0496126_0006684
1206 Ga0496126_0039188
1207 Ga0496126_0077337
1208 Ga0496126_0257206
1209 Ga0495682_0010078
1210 Ga0501042_0276773
1211 Ga0501047_0050488
1212 Ga0501068_0201606
1213 Ga0501070_0185960
1214 Ga0501044_0233648
1215 nmdc:mga03n38_124944_c1
1216 nmdc:mga03n38_83409_c1
1217 nmdc:mga00v17_202324_c1
1218 nmdc:mga0yw44_112073_c1
1219 nmdc:mga0yw44_25249_c2
1220 nmdc:mga06z11_45600_c1
1221 nmdc:mga04h51_45470_c1
1222 nmdc:mga05p37_141697_c1
1223 nmdc:mga0rr50_174705_c1
1224 Ga0495601_0042376
1225 Ga0495601_0286446
1226 Ga0500635_0028777
1227 Ga0495595_0062252
1228 Ga0495619_0028489
1229 Ga0500643_000019
1230 Ga0500651_0061733
1231 Ga0500651_0067270
1232 Ga0500566_0000693
1233 Ga0500566_0003060
1234 Ga0500566_0004708
1235 Ga0500641_0009503
1236 Ga0500641_0021737
1237 Ga0500641_0063799
1238 Ga0500650_0002857
1239 Ga0500556_0000024
1240 Ga0500569_017427
1241 Ga0500595_000478
1242 Ga0500595_008096
1243 Ga0500607_036478
1244 Ga0500608_001404
1245 Ga0500618_012076
1246 Ga0500642_0000035
1247 Ga0500642_0000096
1248 Ga0500642_0014156
1249 Ga0500642_0053040
1250 Ga0500652_000404
1251 Ga0500658_0022678
1252 Ga0500658_0043662
1253 Ga0500559_0039548
1254 Ga0500568_0005040
1255 Ga0500568_0017048
1256 Ga0500577_0001147
1257 Ga0500577_0079393
1258 Ga0500586_001242
1259 Ga0500604_0001709
1260 Ga0500604_0045570
1261 Ga0500616_0000122
1262 Ga0500622_0000790
1263 Ga0500634_0161980
1264 Ga0500638_024000
1265 Ga0500636_0000410
1266 Ga0500636_0006371
1267 Ga0500636_0017882
1268 Ga0500637_0000245
1269 Ga0500625_000095
1270 Ga0500609_003240
1271 Ga0500596_013260
1272 Ga0500599_006070
1273 Ga0500601_000120
1274 Ga0500661_000938
1275 Ga0500661_008979
1276 Ga0500661_011620
1277 2507509971
1278 2509147611
1279 2511398902
1280 2513627614
1281 2513645016
1282 2513652261
1283 2513659266
1284 2513676379
1285 2513696092
1286 2513862038
1287 2513921472
1288 2514011273
1289 2517103276
1290 2517893786
1291 2524439004
1292 2524469411
1293 2524537734
1294 2528852738
1295 2603861107
1296 2617353446
1297 2617377997
1298 2644287860
1299 2671124125
1300 2723846327
1301 2728752929
1302 2745078883
1303 2793060041
1304 2793070713
1305 2793083271
1306 2818242486
1307 2824605657
1308 2824609908
1309 2824655693
1310 2824666579
1311 2824686620
1312 2824707786
1313 2824751082
1314 2824758095
1315 2824766233
1316 2824774246
1317 2838127583
1318 2841941466
1319 2841952523
1320 2841959541
1321 2841967607
1322 2841979002
1323 2841986544
1324 2842038312
1325 2842048743
1326 2844317784
1327 2847934570
1328 2849080637
1329 2857510000
1330 2857528764
1331 2874610705
1332 2874618271
1333 2874623261
1334 2874635961
1335 2874653052
1336 2876766642
1337 2876811733
1338 2879089758
1339 2879104036
1340 2879118784
1341 2879130860
1342 2879147550
1343 2881671818
1344 2885376270
1345 2885388003
1346 2885411795
1347 2888382519
1348 2888388179
1349 2888423096
1350 2889039174
1351 2893068959
1352 2903735462
1353 2903755952
1354 2903775947
1355 2904670081
1356 2904691557
1357 2904705055
1358 2904718415
1359 2906607536
1360 2906610671
1361 2906634935
1362 2906641233
1363 2906648971
1364 2906665163
1365 2908744194
1366 2908761632
1367 2908778760
1368 2919079192
1369 2922362133
1370 2922375439
1371 2922388103
1372 2922395036
1373 2922428653
1374 2929616176
1375 2929624920
1376 2932787159
1377 2932811352
1378 2932819775
1379 2932835776
1380 2933578540
1381 2935611124
1382 2935618961
1383 2935634624
1384 2935643222
1385 2935669848
1386 2935677011
1387 2935693052
1388 2935695456
1389 2935709433
1390 2935719660
1391 2935729573
1392 2935739543
1393 2935748581
1394 2935756832
1395 2935761180
1396 2935779214
1397 2935807365
1398 2935812505
1399 2935820609
1400 2935832634
1401 2935839287
1402 2935849382
1403 2935857326
1404 2935864855
1405 2935876633
1406 2935885022
1407 2935911843
1408 2935920523
1409 2935928872
1410 2935938517
1411 2935945591
1412 2935954802
1413 2935963401
1414 2935970689
1415 2935999015
1416 2936008227
1417 2936039098
1418 2940562746
1419 2941509110
1420 2941516939
1421 2941524966
1422 2941536421
1423 2941539977
1424 3005478784
1425 3005487983
1426 3005508685
1427 3005590666
1428 3005597537
1429 3005713559
1430 3005720961
1431 8006926924
1432 8006942561
1433 8006964708
1434 8006982285
1435 8006991940
1436 8006999872
1437 8016515047
1438 8016590901
1439 8016612182
1440 8016621620
1441 8016628340
1442 8017061406
1443 8019543435
1444 8019555419
1445 8019558326
1446 8019566967
1447 8019580881
1448 8019588615
1449 8019602720
1450 8019615839
1451 8019656523
1452 8019682808
1453 8019688496
1454 8055747823
1455 8056680290
1456 8056688392
1457 8056695938
1458 8056970029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

155

280

0.94

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

31

114

0.86

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

187

325

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
4eye-assembly2.cif.gz_B crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9253 2 322
4eye-assembly1.cif.gz_A crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.92 2 322
4eye-assembly2.cif.gz_B crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9137 2 322
4eye-assembly1.cif.gz_A crystal structure of a probable oxidoreductase from mycobacterium abscessus solved by iodide ion sad 0.9031 2 322
1iyz-assembly1.cif.gz_A-2 crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9022 3 323
ID Description Score Start End Superfamily
2eihB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9371 124 262 3.40.50.720
af_I1KB52_138_305_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9343 128 290 3.40.50.720
af_A0A286Y901_130_273_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9313 124 260 3.40.50.720
af_O74489_128_266_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.93 128 262 3.40.50.720
af_Q8MNM6_143_282_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9296 130 265 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A850CE27-F1-model_v4 Zinc-binding dehydrogenase 0.9466 76 324 GO:0016491
AF-A0A059DLV1-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.946 82 319 GO:0016491
AF-A0A812KMX0-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9427 2 324 GO:0016020
GO:0016491
AF-A0A355B5N3-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9421 112 324 GO:0008270
GO:0016491
AF-A0A4V2NFX9-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.942 124 236 GO:0016491

Map