F477888

General Info

Members Datasets Scaffolds Average Seq Length
729 371 1458 61

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0141497|Ga0501033_0141497_267_470
Length 67
Sequence MAVQDSKKSRAKRGHRHAHWKNKATAPALSTDPTSGETHRRHHVTADGFYRGKKVIDTSPAAADAGE

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
12 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
15 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
16 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
103 3300012485 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 Metagenome Rhizosphere
104 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
105 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
106 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
107 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
108 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
109 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
125 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
134 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
194 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
195 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
196 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
197 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
200 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
201 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
205 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
206 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
207 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
213 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
218 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
225 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
226 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
227 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
228 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
229 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
230 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
231 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
232 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
233 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
234 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
235 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
236 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
237 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
238 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
239 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
240 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
241 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
242 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
243 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
244 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
245 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
246 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
247 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
248 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
249 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
250 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
251 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
252 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
253 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
254 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
255 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
256 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
257 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
260 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
263 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
266 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
270 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
280 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
281 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
282 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
283 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
284 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
285 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
286 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
317 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
318 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
319 2506520008 Serratia plymuthica AS12 Isolate Unclassified
320 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
321 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
322 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
323 2643221559 Lysobacter sp. Root559 Isolate Unclassified
324 2643221573 Lysobacter sp. Root604 Isolate Unclassified
325 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
326 2643221586 Lysobacter sp. Root667 Isolate Unclassified
327 2643221612 Lysobacter sp. Root76 Isolate Unclassified
328 2643221695 Lysobacter sp. Root494 Isolate Unclassified
329 2643221720 Lysobacter sp. Root916 Isolate Unclassified
330 2643221727 Lysobacter sp. Root96 Isolate Unclassified
331 2643221728 Lysobacter sp. Root983 Isolate Unclassified
332 2648501241 Vibrio splendidus UCD-SED7 Isolate Rhizosphere
333 2651869818 Vibrio splendidus UCD-SED10 Isolate Rhizosphere
334 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
335 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
336 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
337 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
338 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
339 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
340 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
341 2818991457 Xanthomonas translucens 569 Isolate Unclassified
342 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
343 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
344 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
345 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
346 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
347 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
348 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
349 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
350 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
351 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
352 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
353 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
354 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
355 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
356 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
357 2932406140 Serratia sp. 2723 Isolate Rhizosphere
358 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
359 2939577877 Serratia sp. 509 Isolate Rhizosphere
360 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
361 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
362 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
363 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
364 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
365 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
366 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
367 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
368 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
369 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
370 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
371 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.09
Metatranscriptomes 8.5
Isolates 7.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 0.41
Rhizoplane 0.82
Rhizosphere 82.99
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0141497 3300049570 Bacteria 1739
2 JGI25156J39149_1002391 3300002705 Bacteria 6781
3 JGI25156J39149_1004783 3300002705 Bacteria 4047
4 JGI25157J39369_1002228 3300002741 Bacteria 5270
5 JGI25151J46595_10036365 3300003187 Bacteria 1858
6 rootH2_10058115 3300003320 Bacteria 11775
7 Ga0055539_1000930 3300003752 Bacteria 6538
8 Ga0055533_1000474 3300003756 Bacteria 15083
9 Ga0055525_1000097 3300003759 Bacteria 137371
10 Ga0055527_1000198 3300003760 Bacteria 39703
11 Ga0055527_1000344 3300003760 Bacteria 23312
12 Ga0055527_1000513 3300003760 Bacteria 13411
13 Ga0055535_1000795 3300003761 Bacteria 22979
14 Ga0055535_1003536 3300003761 Bacteria 4348
15 Ga0055542_1000441 3300003762 Bacteria 39703
16 Ga0055542_1003400 3300003762 Bacteria 4332
17 Ga0055529_1000591 3300003763 Bacteria 28451
18 Ga0055529_1001024 3300003763 Bacteria 13373
19 Ga0055531_10003401 3300003794 Bacteria 10167
20 Ga0058692_1000017 3300003856 Bacteria 274459
21 Ga0058859_11722583 3300004798 Bacteria 753
22 Ga0058859_11813743 3300004798 Bacteria 781
23 Ga0065703_1024523 3300005272 Bacteria 594
24 Ga0065704_10072102 3300005289 Bacteria 9161
25 Ga0065704_10082305 3300005289 Bacteria 3622
26 Ga0065715_10078237 3300005293 Bacteria 596
27 Ga0065715_11011924 3300005293 Bacteria 542
28 Ga0070676_10025259 3300005328 Bacteria 3355
29 Ga0070676_10474453 3300005328 Bacteria 884
30 Ga0070683_100554473 3300005329 Bacteria 1099
31 Ga0070683_101826633 3300005329 Bacteria 584
32 Ga0070690_100000845 3300005330 Bacteria 15537
33 Ga0070670_100000001 3300005331 Bacteria 728788
34 Ga0070670_100161863 3300005331 Bacteria 1939
35 Ga0070670_100598518 3300005331 Bacteria 986
36 Ga0070670_101439520 3300005331 Bacteria 632
37 Ga0070670_101644392 3300005331 Bacteria 591
38 Ga0070677_10763524 3300005333 Bacteria 549
39 Ga0068869_100002558 3300005334 Bacteria 10978
40 Ga0068869_100004697 3300005334 Bacteria 8524
41 Ga0068869_100017947 3300005334 Bacteria 4809
42 Ga0068869_100384401 3300005334 Bacteria 1151
43 Ga0068869_100727978 3300005334 Bacteria 848
44 Ga0068869_101240323 3300005334 Bacteria 656
45 Ga0070666_10015694 3300005335 Bacteria 4834
46 Ga0070666_10212849 3300005335 Bacteria 1362
47 Ga0070666_10538517 3300005335 Bacteria 849
48 Ga0070680_100300083 3300005336 Bacteria 1362
49 Ga0070680_100359947 3300005336 Bacteria 1237
50 Ga0070682_101194433 3300005337 Bacteria 642
51 Ga0070682_101753694 3300005337 Bacteria 540
52 Ga0068868_100015146 3300005338 Bacteria 5697
53 Ga0068868_100373544 3300005338 Bacteria 1225
54 Ga0070689_100004467 3300005340 Bacteria 9455
55 Ga0070689_100287396 3300005340 Bacteria 1366
56 Ga0070689_101148206 3300005340 Bacteria 696
57 Ga0070691_10143528 3300005341 Bacteria 1219
58 Ga0070687_100322499 3300005343 Bacteria 987
59 Ga0070687_100455327 3300005343 Bacteria 852
60 Ga0070687_101047543 3300005343 Unclassified 594
61 Ga0070692_10006900 3300005345 Bacteria 4963
62 Ga0070668_100044400 3300005347 Bacteria 3410
63 Ga0070668_100702951 3300005347 Bacteria 892
64 Ga0070668_100907594 3300005347 Bacteria 788
65 Ga0070668_101473393 3300005347 Bacteria 622
66 Ga0070668_101765648 3300005347 Bacteria 569
67 Ga0070669_100002161 3300005353 Bacteria 14223
68 Ga0070669_100054718 3300005353 Bacteria 2923
69 Ga0070669_100562965 3300005353 Bacteria 951
70 Ga0070675_100076871 3300005354 Bacteria 2778
71 Ga0070675_100276957 3300005354 Bacteria 1473
72 Ga0070675_100540719 3300005354 Bacteria 1053
73 Ga0070671_100000018 3300005355 Bacteria 147427
74 Ga0070671_100122199 3300005355 Bacteria 2191
75 Ga0070671_100739016 3300005355 Bacteria 855
76 Ga0070674_100107450 3300005356 Bacteria 2043
77 Ga0070674_100285205 3300005356 Bacteria 1310
78 Ga0070674_100450220 3300005356 Bacteria 1062
79 Ga0070674_100689548 3300005356 Bacteria 872
80 Ga0070673_100031734 3300005364 Bacteria 3968
81 Ga0070673_100459992 3300005364 Bacteria 1146
82 Ga0070673_102142887 3300005364 Bacteria 531
83 Ga0070688_100004521 3300005365 Bacteria 7253
84 Ga0070688_100034596 3300005365 Bacteria 3062
85 Ga0070667_100000026 3300005367 Bacteria 183244
86 Ga0070667_100166193 3300005367 Bacteria 1946
87 Ga0070667_100269306 3300005367 Bacteria 1527
88 Ga0070667_100506787 3300005367 Bacteria 1107
89 Ga0070667_100630074 3300005367 Unclassified 989
90 Ga0070667_100683693 3300005367 Bacteria 949
91 Ga0070709_11337362 3300005434 Bacteria 579
92 Ga0070714_100003562 3300005435 Bacteria 11639
93 Ga0070714_100868554 3300005435 Bacteria 875
94 Ga0070701_10002994 3300005438 Bacteria 6610
95 Ga0070701_10194129 3300005438 Bacteria 1196
96 Ga0070701_11400941 3300005438 Bacteria 503
97 Ga0070711_100121481 3300005439 Bacteria 1932
98 Ga0070705_100040767 3300005440 Bacteria 2643
99 Ga0070705_100489570 3300005440 Unclassified 931
100 Ga0070700_100003802 3300005441 Bacteria 7820
101 Ga0070694_100007985 3300005444 Bacteria 6468
102 Ga0070694_100621039 3300005444 Bacteria 872
103 Ga0070663_101850146 3300005455 Bacteria 542
104 Ga0070678_100016566 3300005456 Bacteria 4720
105 Ga0070678_100039342 3300005456 Bacteria 3335
106 Ga0070678_100317971 3300005456 Bacteria 1328
107 Ga0070678_100359450 3300005456 Bacteria 1254
108 Ga0070678_100894115 3300005456 Bacteria 811
109 Ga0070678_102242385 3300005456 Bacteria 518
110 Ga0070662_100316250 3300005457 Bacteria 1272
111 Ga0070662_101583941 3300005457 Bacteria 565
112 Ga0070681_10608043 3300005458 Bacteria 1008
113 Ga0068867_100012057 3300005459 Bacteria 6106
114 Ga0068867_100025912 3300005459 Bacteria 4206
115 Ga0068867_100146165 3300005459 Bacteria 1853
116 Ga0068867_100299989 3300005459 Bacteria 1324
117 Ga0068867_100896092 3300005459 Bacteria 798
118 Ga0070685_10000007 3300005466 Bacteria 180539
119 Ga0070685_10038655 3300005466 Bacteria 2707
120 Ga0070699_100058688 3300005518 Bacteria 3334
121 Ga0070699_100139643 3300005518 Bacteria 2139
122 Ga0070679_101574454 3300005530 Bacteria 605
123 Ga0070684_100963664 3300005535 Bacteria 800
124 Ga0070697_100003415 3300005536 Bacteria 12210
125 Ga0070697_102033512 3300005536 Bacteria 514
126 Ga0068853_100107025 3300005539 Bacteria 2479
127 Ga0068853_100401752 3300005539 Bacteria 1282
128 Ga0068853_100490573 3300005539 Bacteria 1159
129 Ga0070672_100036695 3300005543 Bacteria 3735
130 Ga0070672_100305242 3300005543 Bacteria 1350
131 Ga0070686_100001455 3300005544 Bacteria 13358
132 Ga0070686_100162223 3300005544 Bacteria 1575
133 Ga0070686_101292276 3300005544 Bacteria 609
134 Ga0070695_100105939 3300005545 Bacteria 1901
135 Ga0070696_100013458 3300005546 Bacteria 5489
136 Ga0070693_100018924 3300005547 Bacteria 3603
137 Ga0070693_100022625 3300005547 Bacteria 3345
138 Ga0070693_100130569 3300005547 Bacteria 1570
139 Ga0070665_100013638 3300005548 Bacteria 8175
140 Ga0070665_100057794 3300005548 Bacteria 3889
141 Ga0070665_100112949 3300005548 Bacteria 2719
142 Ga0070665_100230673 3300005548 Bacteria 1851
143 Ga0070665_100319643 3300005548 Bacteria 1556
144 Ga0070665_101040540 3300005548 Bacteria 831
145 Ga0070665_101734318 3300005548 Bacteria 631
146 Ga0070704_100032448 3300005549 Bacteria 3523
147 Ga0070704_101600249 3300005549 Unclassified 601
148 Ga0070704_101994868 3300005549 Bacteria 538
149 Ga0068855_102330383 3300005563 Bacteria 535
150 Ga0068857_100469001 3300005577 Bacteria 1179
151 Ga0068857_101505174 3300005577 Bacteria 656
152 Ga0068857_101882781 3300005577 Bacteria 586
153 Ga0068857_102202928 3300005577 Unclassified 541
154 Ga0068854_101133922 3300005578 Bacteria 698
155 Ga0068854_101304923 3300005578 Unclassified 653
156 Ga0068856_100012880 3300005614 Bacteria 8095
157 Ga0068856_100013948 3300005614 Bacteria 7770
158 Ga0068856_100017128 3300005614 Bacteria 7024
159 Ga0070702_100001220 3300005615 Bacteria 10400
160 Ga0070702_100133509 3300005615 Bacteria 1571
161 Ga0070702_100639653 3300005615 Bacteria 803
162 Ga0070702_101811126 3300005615 Bacteria 510
163 Ga0068852_100404198 3300005616 Bacteria 1344
164 Ga0068852_102523817 3300005616 Bacteria 534
165 Ga0068859_100007685 3300005617 Bacteria 10950
166 Ga0068859_100017029 3300005617 Bacteria 7296
167 Ga0068859_100061758 3300005617 Bacteria 3776
168 Ga0068859_100083014 3300005617 Bacteria 3246
169 Ga0068859_100163932 3300005617 Bacteria 2302
170 Ga0068864_100000012 3300005618 Bacteria 335070
171 Ga0068864_100126667 3300005618 Unclassified 2289
172 Ga0068864_100145020 3300005618 Bacteria 2145
173 Ga0068866_10000235 3300005718 Bacteria 26083
174 Ga0068866_10078039 3300005718 Bacteria 1771
175 Ga0068866_10151511 3300005718 Bacteria 1343
176 Ga0068866_10336904 3300005718 Bacteria 954
177 Ga0068861_100006760 3300005719 Bacteria 7837
178 Ga0068861_100199308 3300005719 Bacteria 1679
179 Ga0068861_100511226 3300005719 Bacteria 1088
180 Ga0068861_101732754 3300005719 Bacteria 618
181 Ga0068851_10436210 3300005834 Bacteria 776
182 Ga0068851_10453043 3300005834 Bacteria 763
183 Ga0068851_10553829 3300005834 Bacteria 695
184 Ga0068870_10165818 3300005840 Bacteria 1314
185 Ga0068870_10271776 3300005840 Bacteria 1059
186 Ga0068870_10778535 3300005840 Bacteria 667
187 Ga0068863_100256127 3300005841 Bacteria 1691
188 Ga0068863_100292140 3300005841 Bacteria 1580
189 Ga0068863_100484640 3300005841 Bacteria 1216
190 Ga0068858_100002549 3300005842 Bacteria 18376
191 Ga0068858_100016226 3300005842 Bacteria 6997
192 Ga0068858_100204401 3300005842 Bacteria 1868
193 Ga0068860_100007326 3300005843 Bacteria 11028
194 Ga0068860_100007832 3300005843 Bacteria 10665
195 Ga0068860_100009873 3300005843 Bacteria 9463
196 Ga0068860_100436870 3300005843 Bacteria 1300
197 Ga0068860_101628041 3300005843 Bacteria 667
198 Ga0068862_100001146 3300005844 Bacteria 25101
199 Ga0068862_100005397 3300005844 Bacteria 10689
200 Ga0068862_100201685 3300005844 Bacteria 1794
201 Ga0068862_100529938 3300005844 Bacteria 1122
202 Ga0070715_10512399 3300006163 Bacteria 689
203 Ga0097621_100002412 3300006237 Bacteria 12795
204 Ga0097621_100004460 3300006237 Bacteria 9751
205 Ga0097621_100021221 3300006237 Bacteria 5019
206 Ga0097621_100079713 3300006237 Bacteria 2722
207 Ga0097621_101609756 3300006237 Bacteria 617
208 Ga0068871_100001034 3300006358 Bacteria 18634
209 Ga0068871_100004954 3300006358 Bacteria 9303
210 Ga0068871_100055319 3300006358 Bacteria 3221
211 Ga0068871_100060853 3300006358 Bacteria 3081
212 Ga0068871_100675654 3300006358 Bacteria 944
213 Ga0075428_102214397 3300006844 Bacteria 567
214 Ga0075434_100468902 3300006871 Bacteria 1280
215 Ga0068865_100000229 3300006881 Bacteria 31243
216 Ga0068865_100002785 3300006881 Bacteria 10385
217 Ga0068865_100015225 3300006881 Bacteria 4902
218 Ga0068865_100081427 3300006881 Bacteria 2325
219 Ga0068865_100135329 3300006881 Bacteria 1851
220 Ga0068865_100283874 3300006881 Bacteria 1319
221 Ga0068865_100494921 3300006881 Bacteria 1018
222 Ga0097620_100007685 3300006931 Bacteria 10950
223 Ga0097620_100017029 3300006931 Bacteria 7296
224 Ga0097620_100061758 3300006931 Bacteria 3776
225 Ga0097620_100083015 3300006931 Bacteria 3246
226 Ga0097620_100163932 3300006931 Bacteria 2302
227 Ga0079104_1027215 3300006946 Bacteria 1468
228 Ga0099794_10046640 3300007265 Bacteria 2076
229 Ga0105240_10029653 3300009093 Bacteria 7122
230 Ga0105240_11905248 3300009093 Bacteria 618
231 Ga0105245_10000613 3300009098 Bacteria 32290
232 Ga0105245_10050419 3300009098 Bacteria 3731
233 Ga0105245_10449010 3300009098 Bacteria 1297
234 Ga0105247_10047349 3300009101 Bacteria 2640
235 Ga0105247_10527103 3300009101 Bacteria 865
236 Ga0105243_10004808 3300009148 Bacteria 10615
237 Ga0105243_10235256 3300009148 Bacteria 1627
238 Ga0105242_10000678 3300009176 Bacteria 26735
239 Ga0105242_10151229 3300009176 Bacteria 2024
240 Ga0105242_11900004 3300009176 Bacteria 636
241 Ga0105248_10007225 3300009177 Bacteria 12184
242 Ga0105248_10075331 3300009177 Bacteria 3793
243 Ga0105248_10189091 3300009177 Bacteria 2320
244 Ga0105237_10533031 3300009545 Bacteria 1181
245 Ga0105237_10770502 3300009545 Bacteria 969
246 Ga0105237_10902234 3300009545 Unclassified 891
247 Ga0105238_11528537 3300009551 Bacteria 697
248 Ga0105249_10089678 3300009553 Bacteria 2874
249 Ga0105249_12371493 3300009553 Bacteria 603
250 Ga0105239_10012321 3300010375 Bacteria 9522
251 Ga0105239_10117512 3300010375 Bacteria 2951
252 Ga0105246_10301499 3300011119 Bacteria 1294
253 Ga0105246_10441943 3300011119 Bacteria 1091
254 Ga0157328_1003518 3300012478 Bacteria 822
255 Ga0157325_1008442 3300012485 Bacteria 715
256 Ga0157343_1006429 3300012488 Bacteria 792
257 Ga0157319_1023389 3300012497 Bacteria 618
258 Ga0157345_1006098 3300012498 Bacteria 951
259 Ga0157314_1009914 3300012500 Bacteria 814
260 Ga0157316_1025939 3300012510 Bacteria 677
261 Ga0157316_1062919 3300012510 Bacteria 542
262 Ga0157327_1006828 3300012512 Bacteria 975
263 Ga0157373_10825838 3300013100 Bacteria 684
264 Ga0157370_11208342 3300013104 Bacteria 682
265 Ga0157369_11680401 3300013105 Bacteria 645
266 Ga0157374_10174704 3300013296 Bacteria 2097
267 Ga0157374_10193075 3300013296 Unclassified 1992
268 Ga0157378_10001171 3300013297 Bacteria 23874
269 Ga0157378_10086750 3300013297 Bacteria 2838
270 Ga0157378_10089286 3300013297 Bacteria 2799
271 Ga0157378_10267675 3300013297 Bacteria 1642
272 Ga0163162_10223404 3300013306 Bacteria 2013
273 Ga0163162_10363914 3300013306 Bacteria 1579
274 Ga0163162_10471192 3300013306 Bacteria 1387
275 Ga0157375_10010588 3300013308 Bacteria 8119
276 Ga0157375_10180149 3300013308 Bacteria 2264
277 Ga0157375_10255335 3300013308 Bacteria 1914
278 Ga0163163_10000051 3300014325 Bacteria 128275
279 Ga0163163_10060169 3300014325 Bacteria 3760
280 Ga0157380_10001394 3300014326 Bacteria 15775
281 Ga0157380_13493985 3300014326 Bacteria 503
282 Ga0157379_10129320 3300014968 Bacteria 2272
283 Ga0157379_10180018 3300014968 Bacteria 1910
284 Ga0157376_10006054 3300014969 Bacteria 8505
285 Ga0157376_10043903 3300014969 Bacteria 3671
286 Ga0157376_10514750 3300014969 Bacteria 1178
287 Ga0157376_12101220 3300014969 Bacteria 603
288 Ga0157376_13005034 3300014969 Bacteria 511
289 Ga0163161_10784124 3300017792 Bacteria 800
290 Ga0163161_11173943 3300017792 Bacteria 663
291 Ga0213872_10405218 3300021361 Bacteria 552
292 Ga0213876_10681524 3300021384 Bacteria 547
293 Ga0213875_10245939 3300021388 Bacteria 843
294 Ga0256720_155306 3300023438 Bacteria 833
295 Ga0209674_100506 3300025226 Bacteria 16062
296 Ga0209672_100007 3300025228 Bacteria 959482
297 Ga0209672_100078 3300025228 Bacteria 156926
298 Ga0209563_100079 3300025230 Bacteria 203017
299 Ga0209258_100012 3300025242 Bacteria 825544
300 Ga0209258_100046 3300025242 Bacteria 369794
301 Ga0209026_1000285 3300025250 Bacteria 58221
302 Ga0209677_101982 3300025253 Bacteria 8133
303 Ga0209148_1000014 3300025254 Bacteria 925277
304 Ga0209148_1000098 3300025254 Bacteria 233172
305 Ga0209759_1000460 3300025256 Bacteria 46256
306 Ga0209455_1000010 3300025272 Bacteria 959482
307 Ga0209455_1000126 3300025272 Bacteria 165771
308 Ga0207697_10424226 3300025315 Unclassified 590
309 Ga0207656_10334120 3300025321 Bacteria 754
310 Ga0207656_10676664 3300025321 Bacteria 528
311 Ga0207653_10331922 3300025885 Bacteria 592
312 Ga0207682_10342778 3300025893 Bacteria 703
313 Ga0207642_10001272 3300025899 Bacteria 7804
314 Ga0207642_10172119 3300025899 Bacteria 1173
315 Ga0207642_10489262 3300025899 Bacteria 751
316 Ga0207642_10528222 3300025899 Bacteria 726
317 Ga0207710_10031118 3300025900 Bacteria 2332
318 Ga0207680_10004217 3300025903 Bacteria 6806
319 Ga0207680_10071444 3300025903 Bacteria 2152
320 Ga0207680_10195442 3300025903 Bacteria 1376
321 Ga0207680_10399268 3300025903 Bacteria 971
322 Ga0207699_10609128 3300025906 Bacteria 796
323 Ga0207645_10008655 3300025907 Bacteria 7089
324 Ga0207645_10175099 3300025907 Bacteria 1407
325 Ga0207645_10250990 3300025907 Bacteria 1170
326 Ga0207645_10375117 3300025907 Bacteria 954
327 Ga0207643_10006831 3300025908 Bacteria 6125
328 Ga0207643_10039399 3300025908 Bacteria 2658
329 Ga0207643_10336579 3300025908 Bacteria 945
330 Ga0207705_10689888 3300025909 Unclassified 794
331 Ga0207654_10064120 3300025911 Bacteria 2159
332 Ga0207654_10708572 3300025911 Bacteria 723
333 Ga0207707_10351118 3300025912 Bacteria 1271
334 Ga0207707_11232643 3300025912 Bacteria 604
335 Ga0207695_10001746 3300025913 Bacteria 34535
336 Ga0207695_10382796 3300025913 Bacteria 1292
337 Ga0207671_10001938 3300025914 Bacteria 22902
338 Ga0207671_10264747 3300025914 Bacteria 1353
339 Ga0207671_10344282 3300025914 Bacteria 1181
340 Ga0207671_10401038 3300025914 Bacteria 1091
341 Ga0207660_10038780 3300025917 Bacteria 3327
342 Ga0207660_10222935 3300025917 Bacteria 1480
343 Ga0207662_10183621 3300025918 Bacteria 1347
344 Ga0207662_10329071 3300025918 Bacteria 1022
345 Ga0207662_10335686 3300025918 Bacteria 1012
346 Ga0207681_10001878 3300025923 Bacteria 13447
347 Ga0207681_10129882 3300025923 Bacteria 1861
348 Ga0207681_10823772 3300025923 Bacteria 776
349 Ga0207694_10000627 3300025924 Bacteria 32068
350 Ga0207694_10016648 3300025924 Bacteria 5555
351 Ga0207694_11168254 3300025924 Bacteria 651
352 Ga0207650_10000002 3300025925 Bacteria 1439222
353 Ga0207650_10049228 3300025925 Bacteria 3111
354 Ga0207659_10330157 3300025926 Bacteria 1260
355 Ga0207687_10003513 3300025927 Bacteria 10547
356 Ga0207687_10042035 3300025927 Bacteria 3141
357 Ga0207687_10795396 3300025927 Bacteria 806
358 Ga0207687_11449792 3300025927 Bacteria 590
359 Ga0207664_10748583 3300025929 Bacteria 879
360 Ga0207644_10000026 3300025931 Bacteria 147255
361 Ga0207644_10165775 3300025931 Bacteria 1721
362 Ga0207644_10671696 3300025931 Bacteria 863
363 Ga0207706_10334312 3300025933 Bacteria 1318
364 Ga0207706_10423252 3300025933 Bacteria 1154
365 Ga0207686_10000895 3300025934 Bacteria 17985
366 Ga0207686_10007132 3300025934 Bacteria 6013
367 Ga0207686_10232270 3300025934 Bacteria 1338
368 Ga0207686_10390735 3300025934 Bacteria 1057
369 Ga0207686_10829667 3300025934 Bacteria 743
370 Ga0207709_10027431 3300025935 Bacteria 3281
371 Ga0207709_10395512 3300025935 Bacteria 1055
372 Ga0207670_10004995 3300025936 Bacteria 7226
373 Ga0207670_10254969 3300025936 Bacteria 1357
374 Ga0207669_10337081 3300025937 Bacteria 1160
375 Ga0207669_10353411 3300025937 Bacteria 1136
376 Ga0207669_10547520 3300025937 Bacteria 933
377 Ga0207704_10000551 3300025938 Bacteria 16714
378 Ga0207704_10053746 3300025938 Bacteria 2451
379 Ga0207704_10158932 3300025938 Bacteria 1605
380 Ga0207704_10487180 3300025938 Bacteria 991
381 Ga0207704_10514258 3300025938 Bacteria 967
382 Ga0207704_11451412 3300025938 Bacteria 588
383 Ga0207665_11027731 3300025939 Bacteria 656
384 Ga0207691_10018155 3300025940 Bacteria 6664
385 Ga0207691_10019550 3300025940 Bacteria 6408
386 Ga0207691_10355343 3300025940 Bacteria 1253
387 Ga0207711_10000279 3300025941 Bacteria 55112
388 Ga0207711_10021208 3300025941 Bacteria 5426
389 Ga0207711_10042177 3300025941 Bacteria 3888
390 Ga0207711_10080793 3300025941 Bacteria 2840
391 Ga0207689_10000136 3300025942 Bacteria 62820
392 Ga0207689_10002117 3300025942 Bacteria 18668
393 Ga0207689_10172903 3300025942 Bacteria 1781
394 Ga0207689_10194656 3300025942 Bacteria 1673
395 Ga0207667_10222068 3300025949 Bacteria 1936
396 Ga0207651_10350869 3300025960 Bacteria 1242
397 Ga0207651_10455422 3300025960 Bacteria 1098
398 Ga0207651_10934605 3300025960 Unclassified 773
399 Ga0207712_10187403 3300025961 Bacteria 1630
400 Ga0207712_10299585 3300025961 Bacteria 1319
401 Ga0207712_10523795 3300025961 Bacteria 1016
402 Ga0207668_10050976 3300025972 Bacteria 2856
403 Ga0207668_10566720 3300025972 Bacteria 986
404 Ga0207640_10372839 3300025981 Bacteria 1154
405 Ga0207640_10448249 3300025981 Bacteria 1063
406 Ga0207640_11140991 3300025981 Bacteria 691
407 Ga0207658_10000001 3300025986 Bacteria 1439333
408 Ga0207658_10043506 3300025986 Bacteria 3265
409 Ga0207658_10155909 3300025986 Bacteria 1866
410 Ga0207658_10186518 3300025986 Bacteria 1721
411 Ga0207658_10999171 3300025986 Bacteria 763
412 Ga0207658_11009648 3300025986 Bacteria 759
413 Ga0207677_10052958 3300026023 Bacteria 2760
414 Ga0207677_10473799 3300026023 Bacteria 1077
415 Ga0207677_10735967 3300026023 Bacteria 878
416 Ga0207703_10006745 3300026035 Bacteria 9158
417 Ga0207703_10026533 3300026035 Bacteria 4560
418 Ga0207703_10194547 3300026035 Unclassified 1798
419 Ga0207703_12312324 3300026035 Bacteria 513
420 Ga0207639_10130378 3300026041 Bacteria 2080
421 Ga0207639_10297488 3300026041 Bacteria 1425
422 Ga0207639_10735962 3300026041 Unclassified 916
423 Ga0207639_11372766 3300026041 Unclassified 663
424 Ga0207639_11430050 3300026041 Bacteria 649
425 Ga0207639_11572289 3300026041 Bacteria 617
426 Ga0207708_10001168 3300026075 Bacteria 19751
427 Ga0207702_10009097 3300026078 Bacteria 8361
428 Ga0207702_10031237 3300026078 Bacteria 4438
429 Ga0207702_10178517 3300026078 Bacteria 1953
430 Ga0207641_10226320 3300026088 Bacteria 1736
431 Ga0207641_10264976 3300026088 Bacteria 1610
432 Ga0207641_10337426 3300026088 Bacteria 1433
433 Ga0207641_10390777 3300026088 Bacteria 1334
434 Ga0207648_10000485 3300026089 Bacteria 44215
435 Ga0207648_10050348 3300026089 Bacteria 3642
436 Ga0207648_10084228 3300026089 Bacteria 2773
437 Ga0207648_10372947 3300026089 Bacteria 1289
438 Ga0207648_10525858 3300026089 Bacteria 1084
439 Ga0207676_10000001 3300026095 Bacteria 1439222
440 Ga0207676_10107818 3300026095 Bacteria 2324
441 Ga0207676_10399217 3300026095 Bacteria 1284
442 Ga0207674_10711716 3300026116 Bacteria 969
443 Ga0207674_11165729 3300026116 Bacteria 740
444 Ga0207675_100000213 3300026118 Bacteria 54289
445 Ga0207675_100026284 3300026118 Bacteria 5418
446 Ga0207675_100277204 3300026118 Bacteria 1628
447 Ga0207683_10007796 3300026121 Bacteria 9160
448 Ga0207683_10012473 3300026121 Bacteria 7251
449 Ga0207683_10028497 3300026121 Bacteria 4829
450 Ga0207683_10080612 3300026121 Bacteria 2888
451 Ga0207683_10129572 3300026121 Bacteria 2268
452 Ga0207683_10974922 3300026121 Bacteria 787
453 Ga0207698_10195509 3300026142 Bacteria 1806
454 Ga0207698_11395982 3300026142 Bacteria 715
455 Ga0209281_1017235 3300027111 Bacteria 1469
456 Ga0268266_10004153 3300028379 Bacteria 13973
457 Ga0268266_10034465 3300028379 Bacteria 4306
458 Ga0268266_10100747 3300028379 Bacteria 2545
459 Ga0268266_10119001 3300028379 Bacteria 2349
460 Ga0268266_10297762 3300028379 Bacteria 1504
461 Ga0268266_10409104 3300028379 Bacteria 1284
462 Ga0268265_10001823 3300028380 Bacteria 17029
463 Ga0268265_10105660 3300028380 Bacteria 2285
464 Ga0268265_10192601 3300028380 Bacteria 1762
465 Ga0268265_10521751 3300028380 Bacteria 1123
466 Ga0268265_11514842 3300028380 Bacteria 674
467 Ga0268264_10000061 3300028381 Bacteria 303123
468 Ga0268264_10003726 3300028381 Bacteria 13096
469 Ga0268264_10739785 3300028381 Bacteria 979
470 Ga0268264_10996088 3300028381 Bacteria 844
471 Ga0268264_11212373 3300028381 Bacteria 764
472 Ga0265326_10069355 3300028558 Unclassified 997
473 Ga0265338_10002059 3300028800 Bacteria 31074
474 Ga0265338_10896290 3300028800 Unclassified 604
475 Ga0265327_10000014 3300031251 Bacteria 506288
476 Ga0265327_10000112 3300031251 Bacteria 175878
477 Ga0316575_10004381 3300031665 Bacteria 4965
478 Ga0316575_10005135 3300031665 Bacteria 4650
479 Ga0316579_10059399 3300031691 Bacteria 1797
480 Ga0316579_10160210 3300031691 Bacteria 1087
481 Ga0316579_10214753 3300031691 Bacteria 930
482 Ga0316579_10295928 3300031691 Bacteria 782
483 Ga0316576_10017223 3300031727 Bacteria 4904
484 Ga0316576_10068103 3300031727 Bacteria 2622
485 Ga0316576_11075512 3300031727 Bacteria 571
486 Ga0316578_10027557 3300031728 Bacteria 3212
487 Ga0307516_10103849 3300031730 Bacteria 2655
488 Ga0307516_10176813 3300031730 Bacteria 1870
489 Ga0307516_10236670 3300031730 Bacteria 1527
490 Ga0316577_10005478 3300031733 Bacteria 6655
491 Ga0316577_10005970 3300031733 Bacteria 6416
492 Ga0316577_10144901 3300031733 Bacteria 1338
493 Ga0307413_10464157 3300031824 Bacteria 1008
494 Ga0307406_11938690 3300031901 Unclassified 526
495 Ga0307409_101310740 3300031995 Bacteria 749
496 Ga0307411_10983644 3300032005 Bacteria 754
497 Ga0316583_10062951 3300032133 Bacteria 1300
498 Ga0316583_10157765 3300032133 Bacteria 790
499 Ga0316585_10040995 3300032137 Bacteria 1475
500 Ga0316585_10090875 3300032137 Unclassified 998
501 Ga0316585_10181481 3300032137 Bacteria 695
502 Ga0316580_10006198 3300032139 Bacteria 3525
503 Ga0316580_10067414 3300032139 Bacteria 1097
504 Ga0316593_10000661 3300032168 Bacteria 6646
505 Ga0316593_10000778 3300032168 Bacteria 6331
506 Ga0316593_10005665 3300032168 Bacteria 3315
507 Ga0316593_10006604 3300032168 Bacteria 3141
508 Ga0316593_10052998 3300032168 Bacteria 1374
509 Ga0316593_10055697 3300032168 Unclassified 1344
510 Ga0316593_10065497 3300032168 Bacteria 1249
511 Ga0316593_10081373 3300032168 Bacteria 1131
512 Ga0316593_10082476 3300032168 Bacteria 1124
513 Ga0316593_10195575 3300032168 Bacteria 746
514 Ga0316592_1032534 3300033524 Bacteria 1138
515 Ga0316592_1085366 3300033524 Bacteria 720
516 Ga0316588_1027082 3300033528 Unclassified 1330
517 Ga0316588_1030060 3300033528 Bacteria 1272
518 Ga0316587_1043055 3300033529 Bacteria 818
519 Ga0316587_1043065 3300033529 Bacteria 818
520 Ga0316587_1048715 3300033529 Bacteria 774
521 Ga0316587_1058203 3300033529 Unclassified 714
522 Ga0316587_1060947 3300033529 Unclassified 699
523 Ga0316587_1074827 3300033529 Bacteria 636
524 Ga0316596_1001400 3300033541 Bacteria 4848
525 Ga0316596_1027166 3300033541 Bacteria 1477
526 Ga0316596_1029341 3300033541 Bacteria 1424
527 Ga0316596_1039533 3300033541 Bacteria 1237
528 Ga0316596_1079008 3300033541 Bacteria 884
529 Ga0316596_1210040 3300033541 Bacteria 543
530 Ga0373929_0250667 3300035085 Bacteria 513
531 Ga0373952_0195494 3300035092 Unclassified 590
532 Ga0373942_0198013 3300035207 Unclassified 665
533 Ga0316574_0068386 3300035398 Bacteria 2240
534 Ga0316574_0199288 3300035398 Bacteria 1286
535 Ga0316574_0408235 3300035398 Bacteria 855
536 Ga0316574_0835399 3300035398 Unclassified 559
537 Ga0316574_0942254 3300035398 Unclassified 521
538 Ga0373931_0339273 3300035691 Bacteria 938
539 Ga0316582_0004572 3300036647 Bacteria 7010
540 Ga0316582_0027446 3300036647 Bacteria 3439
541 Ga0316582_0211511 3300036647 Bacteria 1325
542 Ga0316584_0005066 3300036712 Bacteria 8784
543 Ga0316584_0008148 3300036712 Bacteria 7203
544 Ga0316584_0027572 3300036712 Bacteria 4182
545 Ga0316584_0101289 3300036712 Bacteria 2157
546 Ga0316584_0878276 3300036712 Bacteria 605
547 Ga0395899_0000319 3300037312 Bacteria 61296
548 Ga0395900_0000061 3300037418 Bacteria 202483
549 Ga0395900_0000894 3300037418 Bacteria 39143
550 Ga0395898_0000034 3300037466 Bacteria 356745
551 Ga0436364_1060220 3300037853 Unclassified 1194
552 Ga0395901_0077195 3300038443 Bacteria 3476
553 Ga0400484_32124 3300038725 Bacteria 5681
554 Ga0400490_20117 3300038726 Bacteria 25705
555 Ga0400490_31688 3300038726 Bacteria 17721
556 Ga0400491_20800 3300038727 Bacteria 10066
557 Ga0400491_21758 3300038727 Unclassified 1050
558 Ga0400485_12746 3300038735 Bacteria 3954
559 Ga0400488_18372 3300038741 Bacteria 11596
560 Ga0400488_38656 3300038741 Bacteria 1205
561 Ga0400488_46405 3300038741 Unclassified 1373
562 Ga0400488_50084 3300038741 Bacteria 1600
563 Ga0400486_06219 3300038742 Bacteria 2854
564 Ga0400483_006822 3300039062 Bacteria 2957
565 Ga0400483_078683 3300039062 Unclassified 1133
566 Ga0400483_085407 3300039062 Bacteria 1482
567 Ga0400483_085605 3300039062 Bacteria 18729
568 Ga0400483_129431 3300039062 Bacteria 1067
569 Ga0400483_170867 3300039062 Bacteria 8559
570 Ga0400483_248196 3300039062 Bacteria 7053
571 Ga0400483_254656 3300039062 Unclassified 2017
572 Ga0400489_11346 3300039093 Bacteria 1782
573 Ga0400489_58554 3300039093 Bacteria 1025
574 Ga0400487_07419 3300039110 Bacteria 1547
575 Ga0400487_24791 3300039110 Bacteria 81428
576 Ga0400487_41427 3300039110 Bacteria 4185
577 Ga0400487_43791 3300039110 Bacteria 24362
578 Ga0436365_0840042 3300039437 Bacteria 782
579 Ga0436365_1664988 3300039437 Bacteria 1993
580 Ga0436361_0665703 3300039447 Bacteria 552
581 Ga0436361_0944033 3300039447 Bacteria 636
582 Ga0436363_1117066 3300039450 Bacteria 1033
583 Ga0436363_1191204 3300039450 Unclassified 561
584 Ga0436362_0226625 3300039453 Bacteria 962
585 Ga0439439_0007861 3300041406 Bacteria 2505
586 Ga0451789_0793241 3300041443 Bacteria 760
587 Ga0451790_31258 3300041444 Bacteria 1045
588 Ga0451839_0741211 3300041496 Bacteria 765
589 Ga0451847_0662423 3300041503 Bacteria 970
590 Ga0451854_17261 3300041510 Bacteria 520
591 Ga0451853_3376051 3300041512 Bacteria 1269
592 Ga0439441_000553 3300042001 Bacteria 4140
593 Ga0451577_0296099 3300042876 Bacteria 1466
594 Ga0451577_0423063 3300042876 Bacteria 1210
595 Ga0451577_0434525 3300042876 Bacteria 1192
596 Ga0466969_0036984 3300044656 Bacteria 2463
597 Ga0466966_0057286 3300044684 Bacteria 2463
598 Ga0466961_0004766 3300044693 Bacteria 8537
599 Ga0466961_0027892 3300044693 Bacteria 3630
600 Ga0466964_0003032 3300044706 Bacteria 6092
601 Ga0453684_1185901 3300044712 Bacteria 802
602 Ga0453684_1361098 3300044712 Bacteria 738
603 Ga0466971_0149901 3300044719 Bacteria 1088
604 Ga0466968_0028966 3300044735 Bacteria 2287
605 Ga0466970_0011634 3300044765 Bacteria 4488
606 Ga0466957_0012640 3300044842 Bacteria 4889
607 Ga0466959_0000258 3300045049 Bacteria 32514
608 Ga0451576_0001131 3300045051 Bacteria 48320
609 Ga0451576_2415862 3300045051 Bacteria 538
610 Ga0466958_0383431 3300045836 Bacteria 906
611 Ga0495592_0567489 3300046454 Bacteria 696
612 Ga0495659_0090797 3300046664 Bacteria 1172
613 Ga0495623_0421842 3300046679 Bacteria 715
614 Ga0495604_0305648 3300047317 Bacteria 1067
615 Ga0495674_0474784 3300047319 Bacteria 1003
616 Ga0495677_0396098 3300047445 Unclassified 546
617 Ga0496108_1287625 3300048911 Bacteria 615
618 Ga0496114_0209806 3300048917 Bacteria 1708
619 Ga0496114_0705029 3300048917 Bacteria 885
620 Ga0496115_0000065 3300048918 Bacteria 98148
621 Ga0496117_0516975 3300048920 Bacteria 575
622 Ga0496118_0029968 3300048921 Bacteria 4553
623 Ga0496124_0003292 3300048927 Bacteria 19912
624 Ga0496124_0111130 3300048927 Bacteria 2205
625 Ga0496125_0085562 3300048928 Bacteria 2388
626 Ga0496126_0000185 3300048929 Bacteria 140051
627 Ga0496126_1369376 3300048929 Bacteria 512
628 Ga0501325_012123 3300049541 Bacteria 807
629 Ga0501034_0239998 3300049571 Bacteria 1759
630 Ga0501037_0102200 3300049573 Bacteria 2068
631 Ga0501037_0465188 3300049573 Bacteria 861
632 Ga0501039_1264232 3300049575 Bacteria 570
633 Ga0501047_0117022 3300049581 Bacteria 2547
634 Ga0501035_0007793 3300049822 Bacteria 10006
635 Ga0501035_0568797 3300049822 Bacteria 927
636 Ga0501045_0321852 3300049824 Bacteria 1151
637 Ga0500650_0000034 3300053098 Bacteria 52582
638 Ga0500554_257634 3300053102 Unclassified 573
639 Ga0500595_025222 3300053119 Bacteria 2064
640 Ga0500597_231227 3300053120 Bacteria 764
641 Ga0500590_339989 3300053148 Bacteria 542
642 Ga0500636_0070190 3300053177 Bacteria 2033
643 Ga0500661_004201 3300055283 Bacteria 2695
644 Ga0587084_052553 3300059477 Bacteria 726
645 Ga0587093_075567 3300059478 Bacteria 573
646 Ga0587070_054776 3300059491 Bacteria 807
647 Ga0587077_087858 3300059493 Unclassified 725
648 Ga0587080_114324 3300059503 Unclassified 592
649 Ga0587083_0221326 3300059505 Bacteria 551
650 Ga0587085_015437 3300059506 Bacteria 1091
651 Ga0587086_049489 3300059507 Unclassified 674
652 Ga0587088_047633 3300059508 Unclassified 829
653 Ga0587090_026977 3300059510 Unclassified 937
654 Ga0587091_051032 3300059511 Unclassified 849
655 Ga0587094_073400 3300059513 Unclassified 620
656 Ga0587095_023410 3300059514 Unclassified 606
657 Ga0587125_011724 3300059607 Unclassified 924
658 Ga0587129_028744 3300059608 Unclassified 526
659 Ga0587101_091602 3300059623 Bacteria 592
660 Ga0587109_056737 3300059624 Unclassified 815
661 Ga0587117_014876 3300059627 Unclassified 1016
662 Ga0587128_141479 3300059630 Unclassified 541
663 Ga0587130_033675 3300059631 Bacteria 598
664 Ga0587062_057243 3300059639 Unclassified 675
665 Ga0587068_026769 3300059641 Unclassified 978
666 Ga0587069_136651 3300059642 Bacteria 533
667 Ga0587072_075379 3300059643 Bacteria 720
668 Ga0587076_078552 3300059645 Unclassified 699
669 Ga0587079_184519 3300059647 Unclassified 560
670 Ga0587100_022084 3300059648 Unclassified 628
671 Ga0587108_022809 3300059653 Bacteria 604
672 Ga0587118_25044 3300059657 Bacteria 509
673 Ga0587111_0029070 3300060346 Unclassified 1117
674 Ga0501082_1408576 3300060353 Bacteria 609
675 Ga0466962_0012161 3300061719 Bacteria 4138
676 2506577911 2506520007 Bacteria 5442880
677 2506583049 2506520008 Bacteria 5443009
678 2547503452 2547132130 Bacteria 4660562
679 2566038296 2565956521 Bacteria 4468993
680 2572255282 2571042365 Bacteria 3289345
681 2643818717 2643221559 Bacteria 4424915
682 2643878372 2643221573 Bacteria 4784121
683 2643908166 2643221579 Bacteria 4443405
684 2643940968 2643221586 Bacteria 4446529
685 2644079990 2643221612 Bacteria 4361984
686 2644529935 2643221695 Bacteria 3441323
687 2644659676 2643221720 Bacteria 4694283
688 2644695585 2643221727 Bacteria 4415595
689 2644700579 2643221728 Bacteria 4797149
690 2649120980 2648501241 Bacteria 5312320
691 2652974926 2651869818 Bacteria 5864031
692 2656275457 2654587920 Bacteria 5475511
693 2687582671 2687453130 Bacteria 4227172
694 2689444436 2687453601 Bacteria 5546041
695 2691330632 2690315857 Bacteria 4396207
696 2747947843 2747842428 Bacteria 4689383
697 2765577915 2765235840 Bacteria 4663337
698 2816515985 2816332141 Bacteria 4436036
699 2819660509 2818991457 Bacteria 5323295
700 2842394295 2842391507 Bacteria 4486072
701 2842759880 2842757796 Bacteria 3981385
702 2842781418 2842780639 Bacteria 4337790
703 2852688958 2852684882 Bacteria 5463342
704 2869553787 2869551831 Bacteria 5474685
705 2874220537 2874220319 Bacteria 4594709
706 2881715303 2881714928 Bacteria 2469486
707 2919093259 2919089067 Bacteria 4560942
708 2919130217 2919130084 Bacteria 5301837
709 2919134807 2919134579 Bacteria 4480386
710 2919535655 2919534386 Bacteria 4577686
711 2923518839 2923516293 Bacteria 3716336
712 2928498603 2928496128 Bacteria 4631123
713 2929198783 2929195423 Bacteria 5325372
714 2931381830 2931380184 Bacteria 4455911
715 2932409707 2932406140 Bacteria 5134491
716 2937611403 2937610967 Bacteria 4618818
717 2939578825 2939577877 Bacteria 5132791
718 2939629840 2939626828 Bacteria 4695272
719 2941493421 2941489479 Bacteria 6313767
720 2961047302 2961047084 Bacteria 4594415
721 2961068653 2961064222 Bacteria 4749990
722 2995952484 2995948881 Bacteria 6358104
723 8002749439 8002745576 Bacteria 4840272
724 8002872436 8002869464 Bacteria 3588529
725 8003016329 8003014200 Bacteria 4059994
726 8021622377 8021622325 Bacteria 4844743
727 8021626898 8021626552 Bacteria 4665214
728 8021648163 8021648035 Bacteria 4772378
729 8054360172 8054357960 Bacteria 2867777
730 Ga0501033_0141497
731 JGI25156J39149_1002391
732 JGI25156J39149_1004783
733 JGI25157J39369_1002228
734 JGI25151J46595_10036365
735 rootH2_10058115
736 Ga0055539_1000930
737 Ga0055533_1000474
738 Ga0055525_1000097
739 Ga0055527_1000198
740 Ga0055527_1000344
741 Ga0055527_1000513
742 Ga0055535_1000795
743 Ga0055535_1003536
744 Ga0055542_1000441
745 Ga0055542_1003400
746 Ga0055529_1000591
747 Ga0055529_1001024
748 Ga0055531_10003401
749 Ga0058692_1000017
750 Ga0058859_11722583
751 Ga0058859_11813743
752 Ga0065703_1024523
753 Ga0065704_10072102
754 Ga0065704_10082305
755 Ga0065715_10078237
756 Ga0065715_11011924
757 Ga0070676_10025259
758 Ga0070676_10474453
759 Ga0070683_100554473
760 Ga0070683_101826633
761 Ga0070690_100000845
762 Ga0070670_100000001
763 Ga0070670_100161863
764 Ga0070670_100598518
765 Ga0070670_101439520
766 Ga0070670_101644392
767 Ga0070677_10763524
768 Ga0068869_100002558
769 Ga0068869_100004697
770 Ga0068869_100017947
771 Ga0068869_100384401
772 Ga0068869_100727978
773 Ga0068869_101240323
774 Ga0070666_10015694
775 Ga0070666_10212849
776 Ga0070666_10538517
777 Ga0070680_100300083
778 Ga0070680_100359947
779 Ga0070682_101194433
780 Ga0070682_101753694
781 Ga0068868_100015146
782 Ga0068868_100373544
783 Ga0070689_100004467
784 Ga0070689_100287396
785 Ga0070689_101148206
786 Ga0070691_10143528
787 Ga0070687_100322499
788 Ga0070687_100455327
789 Ga0070687_101047543
790 Ga0070692_10006900
791 Ga0070668_100044400
792 Ga0070668_100702951
793 Ga0070668_100907594
794 Ga0070668_101473393
795 Ga0070668_101765648
796 Ga0070669_100002161
797 Ga0070669_100054718
798 Ga0070669_100562965
799 Ga0070675_100076871
800 Ga0070675_100276957
801 Ga0070675_100540719
802 Ga0070671_100000018
803 Ga0070671_100122199
804 Ga0070671_100739016
805 Ga0070674_100107450
806 Ga0070674_100285205
807 Ga0070674_100450220
808 Ga0070674_100689548
809 Ga0070673_100031734
810 Ga0070673_100459992
811 Ga0070673_102142887
812 Ga0070688_100004521
813 Ga0070688_100034596
814 Ga0070667_100000026
815 Ga0070667_100166193
816 Ga0070667_100269306
817 Ga0070667_100506787
818 Ga0070667_100630074
819 Ga0070667_100683693
820 Ga0070709_11337362
821 Ga0070714_100003562
822 Ga0070714_100868554
823 Ga0070701_10002994
824 Ga0070701_10194129
825 Ga0070701_11400941
826 Ga0070711_100121481
827 Ga0070705_100040767
828 Ga0070705_100489570
829 Ga0070700_100003802
830 Ga0070694_100007985
831 Ga0070694_100621039
832 Ga0070663_101850146
833 Ga0070678_100016566
834 Ga0070678_100039342
835 Ga0070678_100317971
836 Ga0070678_100359450
837 Ga0070678_100894115
838 Ga0070678_102242385
839 Ga0070662_100316250
840 Ga0070662_101583941
841 Ga0070681_10608043
842 Ga0068867_100012057
843 Ga0068867_100025912
844 Ga0068867_100146165
845 Ga0068867_100299989
846 Ga0068867_100896092
847 Ga0070685_10000007
848 Ga0070685_10038655
849 Ga0070699_100058688
850 Ga0070699_100139643
851 Ga0070679_101574454
852 Ga0070684_100963664
853 Ga0070697_100003415
854 Ga0070697_102033512
855 Ga0068853_100107025
856 Ga0068853_100401752
857 Ga0068853_100490573
858 Ga0070672_100036695
859 Ga0070672_100305242
860 Ga0070686_100001455
861 Ga0070686_100162223
862 Ga0070686_101292276
863 Ga0070695_100105939
864 Ga0070696_100013458
865 Ga0070693_100018924
866 Ga0070693_100022625
867 Ga0070693_100130569
868 Ga0070665_100013638
869 Ga0070665_100057794
870 Ga0070665_100112949
871 Ga0070665_100230673
872 Ga0070665_100319643
873 Ga0070665_101040540
874 Ga0070665_101734318
875 Ga0070704_100032448
876 Ga0070704_101600249
877 Ga0070704_101994868
878 Ga0068855_102330383
879 Ga0068857_100469001
880 Ga0068857_101505174
881 Ga0068857_101882781
882 Ga0068857_102202928
883 Ga0068854_101133922
884 Ga0068854_101304923
885 Ga0068856_100012880
886 Ga0068856_100013948
887 Ga0068856_100017128
888 Ga0070702_100001220
889 Ga0070702_100133509
890 Ga0070702_100639653
891 Ga0070702_101811126
892 Ga0068852_100404198
893 Ga0068852_102523817
894 Ga0068859_100007685
895 Ga0068859_100017029
896 Ga0068859_100061758
897 Ga0068859_100083014
898 Ga0068859_100163932
899 Ga0068864_100000012
900 Ga0068864_100126667
901 Ga0068864_100145020
902 Ga0068866_10000235
903 Ga0068866_10078039
904 Ga0068866_10151511
905 Ga0068866_10336904
906 Ga0068861_100006760
907 Ga0068861_100199308
908 Ga0068861_100511226
909 Ga0068861_101732754
910 Ga0068851_10436210
911 Ga0068851_10453043
912 Ga0068851_10553829
913 Ga0068870_10165818
914 Ga0068870_10271776
915 Ga0068870_10778535
916 Ga0068863_100256127
917 Ga0068863_100292140
918 Ga0068863_100484640
919 Ga0068858_100002549
920 Ga0068858_100016226
921 Ga0068858_100204401
922 Ga0068860_100007326
923 Ga0068860_100007832
924 Ga0068860_100009873
925 Ga0068860_100436870
926 Ga0068860_101628041
927 Ga0068862_100001146
928 Ga0068862_100005397
929 Ga0068862_100201685
930 Ga0068862_100529938
931 Ga0070715_10512399
932 Ga0097621_100002412
933 Ga0097621_100004460
934 Ga0097621_100021221
935 Ga0097621_100079713
936 Ga0097621_101609756
937 Ga0068871_100001034
938 Ga0068871_100004954
939 Ga0068871_100055319
940 Ga0068871_100060853
941 Ga0068871_100675654
942 Ga0075428_102214397
943 Ga0075434_100468902
944 Ga0068865_100000229
945 Ga0068865_100002785
946 Ga0068865_100015225
947 Ga0068865_100081427
948 Ga0068865_100135329
949 Ga0068865_100283874
950 Ga0068865_100494921
951 Ga0097620_100007685
952 Ga0097620_100017029
953 Ga0097620_100061758
954 Ga0097620_100083015
955 Ga0097620_100163932
956 Ga0079104_1027215
957 Ga0099794_10046640
958 Ga0105240_10029653
959 Ga0105240_11905248
960 Ga0105245_10000613
961 Ga0105245_10050419
962 Ga0105245_10449010
963 Ga0105247_10047349
964 Ga0105247_10527103
965 Ga0105243_10004808
966 Ga0105243_10235256
967 Ga0105242_10000678
968 Ga0105242_10151229
969 Ga0105242_11900004
970 Ga0105248_10007225
971 Ga0105248_10075331
972 Ga0105248_10189091
973 Ga0105237_10533031
974 Ga0105237_10770502
975 Ga0105237_10902234
976 Ga0105238_11528537
977 Ga0105249_10089678
978 Ga0105249_12371493
979 Ga0105239_10012321
980 Ga0105239_10117512
981 Ga0105246_10301499
982 Ga0105246_10441943
983 Ga0157328_1003518
984 Ga0157325_1008442
985 Ga0157343_1006429
986 Ga0157319_1023389
987 Ga0157345_1006098
988 Ga0157314_1009914
989 Ga0157316_1025939
990 Ga0157316_1062919
991 Ga0157327_1006828
992 Ga0157373_10825838
993 Ga0157370_11208342
994 Ga0157369_11680401
995 Ga0157374_10174704
996 Ga0157374_10193075
997 Ga0157378_10001171
998 Ga0157378_10086750
999 Ga0157378_10089286
1000 Ga0157378_10267675
1001 Ga0163162_10223404
1002 Ga0163162_10363914
1003 Ga0163162_10471192
1004 Ga0157375_10010588
1005 Ga0157375_10180149
1006 Ga0157375_10255335
1007 Ga0163163_10000051
1008 Ga0163163_10060169
1009 Ga0157380_10001394
1010 Ga0157380_13493985
1011 Ga0157379_10129320
1012 Ga0157379_10180018
1013 Ga0157376_10006054
1014 Ga0157376_10043903
1015 Ga0157376_10514750
1016 Ga0157376_12101220
1017 Ga0157376_13005034
1018 Ga0163161_10784124
1019 Ga0163161_11173943
1020 Ga0213872_10405218
1021 Ga0213876_10681524
1022 Ga0213875_10245939
1023 Ga0256720_155306
1024 Ga0209674_100506
1025 Ga0209672_100007
1026 Ga0209672_100078
1027 Ga0209563_100079
1028 Ga0209258_100012
1029 Ga0209258_100046
1030 Ga0209026_1000285
1031 Ga0209677_101982
1032 Ga0209148_1000014
1033 Ga0209148_1000098
1034 Ga0209759_1000460
1035 Ga0209455_1000010
1036 Ga0209455_1000126
1037 Ga0207697_10424226
1038 Ga0207656_10334120
1039 Ga0207656_10676664
1040 Ga0207653_10331922
1041 Ga0207682_10342778
1042 Ga0207642_10001272
1043 Ga0207642_10172119
1044 Ga0207642_10489262
1045 Ga0207642_10528222
1046 Ga0207710_10031118
1047 Ga0207680_10004217
1048 Ga0207680_10071444
1049 Ga0207680_10195442
1050 Ga0207680_10399268
1051 Ga0207699_10609128
1052 Ga0207645_10008655
1053 Ga0207645_10175099
1054 Ga0207645_10250990
1055 Ga0207645_10375117
1056 Ga0207643_10006831
1057 Ga0207643_10039399
1058 Ga0207643_10336579
1059 Ga0207705_10689888
1060 Ga0207654_10064120
1061 Ga0207654_10708572
1062 Ga0207707_10351118
1063 Ga0207707_11232643
1064 Ga0207695_10001746
1065 Ga0207695_10382796
1066 Ga0207671_10001938
1067 Ga0207671_10264747
1068 Ga0207671_10344282
1069 Ga0207671_10401038
1070 Ga0207660_10038780
1071 Ga0207660_10222935
1072 Ga0207662_10183621
1073 Ga0207662_10329071
1074 Ga0207662_10335686
1075 Ga0207681_10001878
1076 Ga0207681_10129882
1077 Ga0207681_10823772
1078 Ga0207694_10000627
1079 Ga0207694_10016648
1080 Ga0207694_11168254
1081 Ga0207650_10000002
1082 Ga0207650_10049228
1083 Ga0207659_10330157
1084 Ga0207687_10003513
1085 Ga0207687_10042035
1086 Ga0207687_10795396
1087 Ga0207687_11449792
1088 Ga0207664_10748583
1089 Ga0207644_10000026
1090 Ga0207644_10165775
1091 Ga0207644_10671696
1092 Ga0207706_10334312
1093 Ga0207706_10423252
1094 Ga0207686_10000895
1095 Ga0207686_10007132
1096 Ga0207686_10232270
1097 Ga0207686_10390735
1098 Ga0207686_10829667
1099 Ga0207709_10027431
1100 Ga0207709_10395512
1101 Ga0207670_10004995
1102 Ga0207670_10254969
1103 Ga0207669_10337081
1104 Ga0207669_10353411
1105 Ga0207669_10547520
1106 Ga0207704_10000551
1107 Ga0207704_10053746
1108 Ga0207704_10158932
1109 Ga0207704_10487180
1110 Ga0207704_10514258
1111 Ga0207704_11451412
1112 Ga0207665_11027731
1113 Ga0207691_10018155
1114 Ga0207691_10019550
1115 Ga0207691_10355343
1116 Ga0207711_10000279
1117 Ga0207711_10021208
1118 Ga0207711_10042177
1119 Ga0207711_10080793
1120 Ga0207689_10000136
1121 Ga0207689_10002117
1122 Ga0207689_10172903
1123 Ga0207689_10194656
1124 Ga0207667_10222068
1125 Ga0207651_10350869
1126 Ga0207651_10455422
1127 Ga0207651_10934605
1128 Ga0207712_10187403
1129 Ga0207712_10299585
1130 Ga0207712_10523795
1131 Ga0207668_10050976
1132 Ga0207668_10566720
1133 Ga0207640_10372839
1134 Ga0207640_10448249
1135 Ga0207640_11140991
1136 Ga0207658_10000001
1137 Ga0207658_10043506
1138 Ga0207658_10155909
1139 Ga0207658_10186518
1140 Ga0207658_10999171
1141 Ga0207658_11009648
1142 Ga0207677_10052958
1143 Ga0207677_10473799
1144 Ga0207677_10735967
1145 Ga0207703_10006745
1146 Ga0207703_10026533
1147 Ga0207703_10194547
1148 Ga0207703_12312324
1149 Ga0207639_10130378
1150 Ga0207639_10297488
1151 Ga0207639_10735962
1152 Ga0207639_11372766
1153 Ga0207639_11430050
1154 Ga0207639_11572289
1155 Ga0207708_10001168
1156 Ga0207702_10009097
1157 Ga0207702_10031237
1158 Ga0207702_10178517
1159 Ga0207641_10226320
1160 Ga0207641_10264976
1161 Ga0207641_10337426
1162 Ga0207641_10390777
1163 Ga0207648_10000485
1164 Ga0207648_10050348
1165 Ga0207648_10084228
1166 Ga0207648_10372947
1167 Ga0207648_10525858
1168 Ga0207676_10000001
1169 Ga0207676_10107818
1170 Ga0207676_10399217
1171 Ga0207674_10711716
1172 Ga0207674_11165729
1173 Ga0207675_100000213
1174 Ga0207675_100026284
1175 Ga0207675_100277204
1176 Ga0207683_10007796
1177 Ga0207683_10012473
1178 Ga0207683_10028497
1179 Ga0207683_10080612
1180 Ga0207683_10129572
1181 Ga0207683_10974922
1182 Ga0207698_10195509
1183 Ga0207698_11395982
1184 Ga0209281_1017235
1185 Ga0268266_10004153
1186 Ga0268266_10034465
1187 Ga0268266_10100747
1188 Ga0268266_10119001
1189 Ga0268266_10297762
1190 Ga0268266_10409104
1191 Ga0268265_10001823
1192 Ga0268265_10105660
1193 Ga0268265_10192601
1194 Ga0268265_10521751
1195 Ga0268265_11514842
1196 Ga0268264_10000061
1197 Ga0268264_10003726
1198 Ga0268264_10739785
1199 Ga0268264_10996088
1200 Ga0268264_11212373
1201 Ga0265326_10069355
1202 Ga0265338_10002059
1203 Ga0265338_10896290
1204 Ga0265327_10000014
1205 Ga0265327_10000112
1206 Ga0316575_10004381
1207 Ga0316575_10005135
1208 Ga0316579_10059399
1209 Ga0316579_10160210
1210 Ga0316579_10214753
1211 Ga0316579_10295928
1212 Ga0316576_10017223
1213 Ga0316576_10068103
1214 Ga0316576_11075512
1215 Ga0316578_10027557
1216 Ga0307516_10103849
1217 Ga0307516_10176813
1218 Ga0307516_10236670
1219 Ga0316577_10005478
1220 Ga0316577_10005970
1221 Ga0316577_10144901
1222 Ga0307413_10464157
1223 Ga0307406_11938690
1224 Ga0307409_101310740
1225 Ga0307411_10983644
1226 Ga0316583_10062951
1227 Ga0316583_10157765
1228 Ga0316585_10040995
1229 Ga0316585_10090875
1230 Ga0316585_10181481
1231 Ga0316580_10006198
1232 Ga0316580_10067414
1233 Ga0316593_10000661
1234 Ga0316593_10000778
1235 Ga0316593_10005665
1236 Ga0316593_10006604
1237 Ga0316593_10052998
1238 Ga0316593_10055697
1239 Ga0316593_10065497
1240 Ga0316593_10081373
1241 Ga0316593_10082476
1242 Ga0316593_10195575
1243 Ga0316592_1032534
1244 Ga0316592_1085366
1245 Ga0316588_1027082
1246 Ga0316588_1030060
1247 Ga0316587_1043055
1248 Ga0316587_1043065
1249 Ga0316587_1048715
1250 Ga0316587_1058203
1251 Ga0316587_1060947
1252 Ga0316587_1074827
1253 Ga0316596_1001400
1254 Ga0316596_1027166
1255 Ga0316596_1029341
1256 Ga0316596_1039533
1257 Ga0316596_1079008
1258 Ga0316596_1210040
1259 Ga0373929_0250667
1260 Ga0373952_0195494
1261 Ga0373942_0198013
1262 Ga0316574_0068386
1263 Ga0316574_0199288
1264 Ga0316574_0408235
1265 Ga0316574_0835399
1266 Ga0316574_0942254
1267 Ga0373931_0339273
1268 Ga0316582_0004572
1269 Ga0316582_0027446
1270 Ga0316582_0211511
1271 Ga0316584_0005066
1272 Ga0316584_0008148
1273 Ga0316584_0027572
1274 Ga0316584_0101289
1275 Ga0316584_0878276
1276 Ga0395899_0000319
1277 Ga0395900_0000061
1278 Ga0395900_0000894
1279 Ga0395898_0000034
1280 Ga0436364_1060220
1281 Ga0395901_0077195
1282 Ga0400484_32124
1283 Ga0400490_20117
1284 Ga0400490_31688
1285 Ga0400491_20800
1286 Ga0400491_21758
1287 Ga0400485_12746
1288 Ga0400488_18372
1289 Ga0400488_38656
1290 Ga0400488_46405
1291 Ga0400488_50084
1292 Ga0400486_06219
1293 Ga0400483_006822
1294 Ga0400483_078683
1295 Ga0400483_085407
1296 Ga0400483_085605
1297 Ga0400483_129431
1298 Ga0400483_170867
1299 Ga0400483_248196
1300 Ga0400483_254656
1301 Ga0400489_11346
1302 Ga0400489_58554
1303 Ga0400487_07419
1304 Ga0400487_24791
1305 Ga0400487_41427
1306 Ga0400487_43791
1307 Ga0436365_0840042
1308 Ga0436365_1664988
1309 Ga0436361_0665703
1310 Ga0436361_0944033
1311 Ga0436363_1117066
1312 Ga0436363_1191204
1313 Ga0436362_0226625
1314 Ga0439439_0007861
1315 Ga0451789_0793241
1316 Ga0451790_31258
1317 Ga0451839_0741211
1318 Ga0451847_0662423
1319 Ga0451854_17261
1320 Ga0451853_3376051
1321 Ga0439441_000553
1322 Ga0451577_0296099
1323 Ga0451577_0423063
1324 Ga0451577_0434525
1325 Ga0466969_0036984
1326 Ga0466966_0057286
1327 Ga0466961_0004766
1328 Ga0466961_0027892
1329 Ga0466964_0003032
1330 Ga0453684_1185901
1331 Ga0453684_1361098
1332 Ga0466971_0149901
1333 Ga0466968_0028966
1334 Ga0466970_0011634
1335 Ga0466957_0012640
1336 Ga0466959_0000258
1337 Ga0451576_0001131
1338 Ga0451576_2415862
1339 Ga0466958_0383431
1340 Ga0495592_0567489
1341 Ga0495659_0090797
1342 Ga0495623_0421842
1343 Ga0495604_0305648
1344 Ga0495674_0474784
1345 Ga0495677_0396098
1346 Ga0496108_1287625
1347 Ga0496114_0209806
1348 Ga0496114_0705029
1349 Ga0496115_0000065
1350 Ga0496117_0516975
1351 Ga0496118_0029968
1352 Ga0496124_0003292
1353 Ga0496124_0111130
1354 Ga0496125_0085562
1355 Ga0496126_0000185
1356 Ga0496126_1369376
1357 Ga0501325_012123
1358 Ga0501034_0239998
1359 Ga0501037_0102200
1360 Ga0501037_0465188
1361 Ga0501039_1264232
1362 Ga0501047_0117022
1363 Ga0501035_0007793
1364 Ga0501035_0568797
1365 Ga0501045_0321852
1366 Ga0500650_0000034
1367 Ga0500554_257634
1368 Ga0500595_025222
1369 Ga0500597_231227
1370 Ga0500590_339989
1371 Ga0500636_0070190
1372 Ga0500661_004201
1373 Ga0587084_052553
1374 Ga0587093_075567
1375 Ga0587070_054776
1376 Ga0587077_087858
1377 Ga0587080_114324
1378 Ga0587083_0221326
1379 Ga0587085_015437
1380 Ga0587086_049489
1381 Ga0587088_047633
1382 Ga0587090_026977
1383 Ga0587091_051032
1384 Ga0587094_073400
1385 Ga0587095_023410
1386 Ga0587125_011724
1387 Ga0587129_028744
1388 Ga0587101_091602
1389 Ga0587109_056737
1390 Ga0587117_014876
1391 Ga0587128_141479
1392 Ga0587130_033675
1393 Ga0587062_057243
1394 Ga0587068_026769
1395 Ga0587069_136651
1396 Ga0587072_075379
1397 Ga0587076_078552
1398 Ga0587079_184519
1399 Ga0587100_022084
1400 Ga0587108_022809
1401 Ga0587118_25044
1402 Ga0587111_0029070
1403 Ga0501082_1408576
1404 Ga0466962_0012161
1405 2506577911
1406 2506583049
1407 2547503452
1408 2566038296
1409 2572255282
1410 2643818717
1411 2643878372
1412 2643908166
1413 2643940968
1414 2644079990
1415 2644529935
1416 2644659676
1417 2644695585
1418 2644700579
1419 2649120980
1420 2652974926
1421 2656275457
1422 2687582671
1423 2689444436
1424 2691330632
1425 2747947843
1426 2765577915
1427 2816515985
1428 2819660509
1429 2842394295
1430 2842759880
1431 2842781418
1432 2852688958
1433 2869553787
1434 2874220537
1435 2881715303
1436 2919093259
1437 2919130217
1438 2919134807
1439 2919535655
1440 2923518839
1441 2928498603
1442 2929198783
1443 2931381830
1444 2932409707
1445 2937611403
1446 2939578825
1447 2939629840
1448 2941493421
1449 2961047302
1450 2961068653
1451 2995952484
1452 8002749439
1453 8002872436
1454 8003016329
1455 8021622377
1456 8021626898
1457 8021648163
1458 8054360172

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01783

Ribosomal_L32p

Ribosomal L32p protein family

2

58

0.97

Map