F477889

General Info

Members Datasets Scaffolds Average Seq Length
729 622 1458 393

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0096130|Ga0501037_0096130_880_2079
Length 399
Sequence MSDMTETRLPAASPPRGSLLTDPRTRSILIQGTVLVLVCVALWFFISNGRANLAARNIQTGFGFLDQQAGFDISQTLIDYNDNASYGRVFLIGLLNTLLVSGLGVIFATIIGFGVGIARLSQNWLVSKLAEVYVEVIRNLPLLFQILFWYLGVLAAMPAARQSLSFFGLAYFNNRGAVLARPVFGEGSGIVALALLAGIVLAWIVGRWAHRRQMQTGQPFPTIKTALALIFGLPLAAFIATGFPVSLEWPVLRGFNFAGGIRVIPEFVALLIALSTYTGGFIAEIVRAGIQSVNRGQSEAAGSLGLRPGATLRFVVVPQALRVIIPPLTSQYLNLIKNSSLAVAIGYPDFFALFAGTTLNQTGQAIEIIAITMAVYLCISLLTAAFMNWYNRVVALKGA

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
55 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
56 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
57 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
58 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
59 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
60 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
64 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
65 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
73 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
77 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
79 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
91 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
96 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
97 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
98 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
99 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
104 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
105 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
106 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
107 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
108 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
109 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
110 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
111 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
116 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
117 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
121 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
127 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
128 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
129 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
130 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
138 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
139 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
140 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
143 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
144 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
145 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
146 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
147 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
148 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
149 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
150 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
155 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
156 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
159 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
160 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
161 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
162 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
163 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
164 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
165 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
166 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
169 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
189 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
190 2509276019 Ensifer aridi TW10 Isolate Nodule
191 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
192 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
193 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
194 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
195 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
196 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
197 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
198 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
199 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
200 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
201 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
202 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
203 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
204 2516143018 Ensifer sp. BR816 Isolate Nodule
205 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
206 2519899620 Rhizobium sp. Pop5 Isolate Nodule
207 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
208 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
209 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
210 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
211 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
212 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
213 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
214 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
215 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
216 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
217 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
218 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
219 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
220 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
221 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
222 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
223 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
224 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
225 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
226 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
227 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
228 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
229 2643221557 Ensifer sp. Root558 Isolate Unclassified
230 2643221558 Rhizobium sp. Root149 Isolate Unclassified
231 2643221607 Rhizobium sp. Root73 Isolate Unclassified
232 2643221610 Ensifer sp. Root74 Isolate Unclassified
233 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
234 2643221668 Ensifer sp. Root423 Isolate Unclassified
235 2643221675 Ensifer sp. Root1298 Isolate Unclassified
236 2643221680 Ensifer sp. Root1312 Isolate Unclassified
237 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
238 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
239 2643221723 Ensifer sp. Root278 Isolate Unclassified
240 2643221726 Ensifer sp. Root954 Isolate Unclassified
241 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
242 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
243 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
244 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
245 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
246 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
247 2718217882 Rhizobium sp. N741 Isolate Nodule
248 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
249 2718218009 Rhizobium sp. N561 Isolate Nodule
250 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
251 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
252 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
253 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
254 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
255 2718218363 Rhizobium sp. N113 Isolate Nodule
256 2718218365 Rhizobium sp. N731 Isolate Nodule
257 2718218366 Rhizobium sp. N621 Isolate Nodule
258 2721755514 Rhizobium sp. N6212 Isolate Nodule
259 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
260 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
261 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
262 2721755810 Rhizobium sp. N871 Isolate Nodule
263 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
264 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
265 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
266 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
267 2728369365 Rhizobium sp. N1341 Isolate Nodule
268 2728369397 Rhizobium sp. N1314 Isolate Nodule
269 2738543024 Aminobacter sp. AP02 Isolate Unclassified
270 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
271 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
272 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
273 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
274 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
275 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
276 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
277 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
278 2791355256 Rhizobium sp. M10 Isolate Nodule
279 2791355260 Rhizobium sp. L9 Isolate Nodule
280 2791355261 Rhizobium sp. J15 Isolate Nodule
281 2791355262 Rhizobium sp. M1 Isolate Nodule
282 2791355264 Rhizobium sp. S9 Isolate Nodule
283 2791355265 Rhizobium sp. H4 Isolate Nodule
284 2791355267 Rhizobium sp. L18 Isolate Nodule
285 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
286 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
287 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
288 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
289 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
290 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
291 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
292 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
293 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
294 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
295 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
296 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
297 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
298 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
299 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
300 2838048938 Rhizobium pisi 27/80 Isolate Nodule
301 2838061910 Rhizobium phaseoli L15 Isolate Nodule
302 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
303 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
304 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
305 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
306 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
307 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
308 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
309 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
310 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
311 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
312 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
313 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
314 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
315 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
316 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
317 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
318 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
319 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
320 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
321 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
322 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
323 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
324 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
325 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
326 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
327 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
328 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
329 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
330 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
331 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
332 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
333 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
334 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
335 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
336 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
337 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
338 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
339 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
340 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
341 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
342 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
343 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
344 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
345 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
346 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
347 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
348 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
349 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
350 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
351 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
352 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
353 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
354 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
355 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
356 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
357 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
358 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
359 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
360 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
361 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
362 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
363 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
364 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
365 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
366 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
367 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
368 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
369 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
370 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
371 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
372 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
373 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
374 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
375 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
376 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
377 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
378 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
379 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
380 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
381 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
382 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
383 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
384 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
385 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
386 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
387 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
388 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
389 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
390 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
391 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
392 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
393 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
394 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
395 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
396 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
397 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
398 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
399 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
400 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
401 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
402 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
403 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
404 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
405 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
406 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
407 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
408 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
409 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
410 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
411 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
412 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
413 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
414 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
415 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
416 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
417 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
418 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
419 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
420 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
421 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
422 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
423 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
424 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
425 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
426 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
427 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
428 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
429 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
430 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
431 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
432 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
433 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
434 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
435 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
436 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
437 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
438 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
439 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
440 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
441 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
442 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
443 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
444 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
445 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
446 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
447 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
448 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
449 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
450 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
451 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
452 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
453 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
454 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
455 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
456 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
457 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
458 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
459 2933599457 Rhizobium phaseoli M3 Isolate Nodule
460 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
461 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
462 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
463 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
464 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
465 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
466 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
467 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
468 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
469 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
470 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
471 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
472 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
473 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
474 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
475 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
476 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
477 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
478 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
479 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
480 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
481 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
482 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
483 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
484 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
485 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
486 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
487 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
488 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
489 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
490 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
491 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
492 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
493 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
494 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
495 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
496 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
497 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
498 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
499 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
500 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
501 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
502 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
503 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
504 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
505 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
506 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
507 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
508 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
509 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
510 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
511 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
512 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
513 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
514 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
515 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
516 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
517 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
518 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
519 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
520 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
521 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
522 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
523 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
524 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
525 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
526 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
527 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
528 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
529 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
530 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
531 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
532 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
533 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
534 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
535 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
536 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
537 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
538 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
539 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
540 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
541 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
542 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
543 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
544 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
545 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
546 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
547 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
548 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
549 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
550 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
551 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
552 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
553 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
554 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
555 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
556 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
557 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
558 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
559 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
560 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
561 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
562 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
563 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
564 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
565 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
566 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
567 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
568 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
569 2996893221 Rhizobium sp. R635 Isolate Nodule
570 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
571 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
572 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
573 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
574 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
575 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
576 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
577 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
578 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
579 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
580 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
581 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
582 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
583 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
584 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
585 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
586 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
587 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
588 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
589 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
590 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
591 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
592 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
593 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
594 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
595 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
596 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
597 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
598 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
599 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
600 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
601 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
602 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
603 8005382845 Rhizobium sp. R634 Isolate Nodule
604 8005395548 Rhizobium sp. R339 Isolate Nodule
605 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
606 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
607 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
608 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
609 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
610 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
611 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
612 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
613 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
614 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
615 8024501048 Rhizobium sp. H4 Isolate Nodule
616 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
617 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
618 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
619 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
620 8056382006 Rhizobium croatiense 13T Isolate Nodule
621 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
622 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 37.17
Metatranscriptomes 3.02
Isolates 59.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.19
Nodule 48.7
Rhizoplane 2.61
Rhizosphere 17.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0096130 3300049573 Bacteria 2141
2 JGI24740J21852_10000001 3300001979 Bacteria 168537
3 JGI25155J39150_1000011 3300002704 Bacteria 207685
4 JGI25156J39149_1000027 3300002705 Bacteria 127396
5 JGI25156J39149_1001106 3300002705 Bacteria 12297
6 JGI25162J39368_1000923 3300002737 Bacteria 18856
7 JGI25162J39368_1001104 3300002737 Bacteria 16375
8 JGI25162J39368_1001271 3300002737 Bacteria 14357
9 JGI25154J39366_1000368 3300002738 Bacteria 25167
10 JGI25158J39367_1000227 3300002739 Bacteria 13209
11 JGI25157J39369_1000010 3300002741 Bacteria 207685
12 JGI25157J39369_1000299 3300002741 Bacteria 35959
13 JGI25152J39213_1001188 3300002773 Bacteria 11978
14 JGI25152J39213_1003859 3300002773 Bacteria 4939
15 JGI25159J45721_1000969 3300002987 Bacteria 12464
16 JGI25151J46595_10015802 3300003187 Bacteria 3315
17 JGI25151J46595_10047795 3300003187 Bacteria 1485
18 JGI25165J46597_1001156 3300003214 Bacteria 16375
19 JGI25165J46597_1001175 3300003214 Bacteria 16084
20 JGI25165J46597_1008031 3300003214 Bacteria 1692
21 JGI25153J46596_10022338 3300003215 Bacteria 2335
22 rootH2_10000482 3300003320 Bacteria 2731
23 rootL2_10018552 3300003322 Bacteria 8455
24 JGI25160J50197_1000004 3300003354 Bacteria 419797
25 JGI25160J50197_1000019 3300003354 Bacteria 233980
26 JGI25160J50197_1005572 3300003354 Bacteria 5218
27 JGI25161J50226_1000003 3300003374 Bacteria 413345
28 JGI25161J50226_1000053 3300003374 Bacteria 106635
29 JGI25161J50226_1000291 3300003374 Bacteria 28212
30 Ga0055526_1000382 3300003771 Bacteria 35903
31 Ga0055524_1006759 3300003775 Bacteria 4950
32 Ga0055524_1007562 3300003775 Bacteria 4596
33 Ga0055524_1009040 3300003775 Bacteria 4089
34 Ga0055536_1007245 3300003781 Bacteria 4997
35 Ga0055528_1002265 3300003790 Bacteria 10440
36 Ga0055528_1004558 3300003790 Bacteria 6645
37 Ga0055528_1010885 3300003790 Bacteria 3657
38 Ga0055528_1011347 3300003790 Bacteria 3547
39 Ga0055530_10007617 3300003791 Bacteria 4520
40 Ga0055540_1000748 3300003792 Bacteria 22053
41 Ga0055540_1012025 3300003792 Bacteria 2745
42 Ga0055531_10003009 3300003794 Bacteria 10939
43 Ga0055543_1000001 3300004625 Bacteria 419949
44 Ga0055543_1000019 3300004625 Bacteria 161035
45 Ga0055543_1000147 3300004625 Bacteria 58621
46 Ga0065165_1000049 3300005262 Bacteria 195588
47 Ga0065165_1000180 3300005262 Bacteria 111768
48 Ga0065165_1003917 3300005262 Bacteria 9822
49 Ga0065165_1008871 3300005262 Bacteria 4614
50 Ga0070671_100037621 3300005355 Bacteria 4014
51 Ga0068853_100026608 3300005539 Bacteria 4858
52 Ga0070665_100096905 3300005548 Bacteria 2954
53 Ga0068855_100052616 3300005563 Bacteria 4793
54 Ga0068857_100221397 3300005577 Bacteria 1729
55 Ga0068854_100046600 3300005578 Bacteria 3087
56 Ga0068856_100086205 3300005614 Bacteria 3120
57 Ga0068852_100084082 3300005616 Bacteria 2831
58 Ga0075365_10001752 3300006038 Bacteria 10096
59 Ga0075368_10005708 3300006042 Bacteria 4301
60 Ga0075368_10065527 3300006042 Bacteria 1459
61 Ga0075363_100018095 3300006048 Bacteria 3504
62 Ga0075364_10001917 3300006051 Bacteria 11580
63 Ga0075364_10025309 3300006051 Bacteria 3777
64 Ga0075367_10007130 3300006178 Bacteria 5702
65 Ga0075367_10032271 3300006178 Bacteria 3013
66 Ga0075369_10000352 3300006186 Bacteria 13738
67 Ga0075369_10003075 3300006186 Bacteria 6043
68 Ga0075369_10086772 3300006186 Bacteria 1393
69 Ga0075366_10146110 3300006195 Bacteria 1431
70 Ga0079104_1000187 3300006946 Bacteria 86957
71 Ga0105240_10000005 3300009093 Bacteria 702630
72 Ga0105240_10162849 3300009093 Bacteria 2648
73 Ga0105248_10071845 3300009177 Bacteria 3888
74 Ga0105237_10007348 3300009545 Bacteria 12073
75 Ga0105237_10103174 3300009545 Bacteria 2843
76 Ga0105238_10000856 3300009551 Bacteria 31384
77 Ga0123342_1019295 3300009766 Bacteria 5237
78 Ga0105239_10007427 3300010375 Bacteria 12573
79 Ga0105239_10034847 3300010375 Bacteria 5529
80 Ga0105239_10519926 3300010375 Bacteria 1354
81 Ga0157373_10019309 3300013100 Bacteria 4964
82 Ga0157370_10002129 3300013104 Bacteria 24176
83 Ga0157369_10023767 3300013105 Bacteria 6823
84 Ga0157369_10115546 3300013105 Bacteria 2850
85 Ga0171463_1011 3300013249 Bacteria 230603
86 Ga0157374_10073432 3300013296 Bacteria 3229
87 Ga0182007_10001634 3300015262 Bacteria 11880
88 Ga0214544_1009612 3300021320 Bacteria 14991
89 Ga0214542_1000015 3300021321 Bacteria 227912
90 Ga0214542_1015309 3300021321 Bacteria 8073
91 Ga0214543_1000011 3300021327 Bacteria 344093
92 Ga0214543_1000032 3300021327 Bacteria 200766
93 Ga0228710_1000006 3300022740 Bacteria 209134
94 Ga0209435_100022 3300025206 Bacteria 207766
95 Ga0209436_100155 3300025208 Bacteria 32910
96 Ga0209436_100410 3300025208 Bacteria 19312
97 Ga0209437_100153 3300025233 Bacteria 154068
98 Ga0209437_100577 3300025233 Bacteria 23562
99 Ga0207425_1002020 3300025245 Bacteria 7561
100 Ga0209646_1000078 3300025246 Bacteria 207766
101 Ga0209646_1005791 3300025246 Bacteria 2123
102 Ga0209026_1000002 3300025250 Bacteria 1136158
103 Ga0209026_1000065 3300025250 Bacteria 207766
104 Ga0209677_100355 3300025253 Bacteria 28569
105 Ga0209148_1000056 3300025254 Bacteria 363380
106 Ga0209759_1000055 3300025256 Bacteria 207766
107 Ga0209759_1000445 3300025256 Bacteria 48065
108 Ga0209129_1000329 3300025258 Bacteria 41319
109 Ga0209129_1006396 3300025258 Bacteria 3819
110 Ga0209233_1000053 3300025261 Bacteria 444909
111 Ga0209233_1000175 3300025261 Bacteria 144221
112 Ga0209233_1000248 3300025261 Bacteria 87812
113 Ga0209233_1000676 3300025261 Bacteria 16375
114 Ga0209233_1016312 3300025261 Bacteria 2048
115 Ga0209455_1000214 3300025272 Bacteria 81374
116 Ga0209673_1000456 3300025273 Bacteria 69267
117 Ga0209673_1001837 3300025273 Bacteria 17367
118 Ga0209673_1002251 3300025273 Bacteria 13913
119 Ga0209673_1003459 3300025273 Bacteria 9294
120 Ga0209130_1000007 3300025284 Bacteria 591584
121 Ga0209130_1000012 3300025284 Bacteria 421329
122 Ga0209130_1000097 3300025284 Bacteria 143750
123 Ga0209676_1002523 3300025292 Bacteria 12770
124 Ga0209025_1000033 3300025294 Bacteria 414511
125 Ga0209025_1001164 3300025294 Bacteria 37261
126 Ga0209025_1009454 3300025294 Bacteria 6789
127 Ga0209564_1000140 3300025295 Bacteria 179856
128 Ga0209564_1000453 3300025295 Bacteria 69474
129 Ga0209564_1000549 3300025295 Bacteria 60609
130 Ga0209564_1006104 3300025295 Bacteria 6612
131 Ga0209758_1006966 3300025297 Bacteria 7879
132 Ga0209758_1008681 3300025297 Bacteria 6514
133 Ga0209758_1019212 3300025297 Bacteria 3308
134 Ga0209758_1023133 3300025297 Bacteria 2821
135 Ga0209050_1003179 3300025298 Bacteria 12484
136 Ga0209256_1000319 3300025299 Bacteria 82827
137 Ga0209256_1000836 3300025299 Bacteria 38702
138 Ga0209256_1001576 3300025299 Bacteria 22391
139 Ga0209256_1008248 3300025299 Bacteria 4878
140 Ga0207426_1000003 3300025302 Bacteria 1063212
141 Ga0207426_1000010 3300025302 Bacteria 796003
142 Ga0207426_1000111 3300025302 Bacteria 234032
143 Ga0207426_1006470 3300025302 Bacteria 5092
144 Ga0209051_1001055 3300025303 Bacteria 25767
145 Ga0209051_1006833 3300025303 Bacteria 6348
146 Ga0209051_1012281 3300025303 Bacteria 4153
147 Ga0209257_1002064 3300025304 Bacteria 21210
148 Ga0209257_1002957 3300025304 Bacteria 15582
149 Ga0207705_10023219 3300025909 Bacteria 4425
150 Ga0207695_10000011 3300025913 Bacteria 910221
151 Ga0207671_10000276 3300025914 Bacteria 76490
152 Ga0207671_10011771 3300025914 Bacteria 7084
153 Ga0207694_10002342 3300025924 Bacteria 15489
154 Ga0207650_10003278 3300025925 Bacteria 11157
155 Ga0207644_10012427 3300025931 Bacteria 5654
156 Ga0207667_10031202 3300025949 Bacteria 5754
157 Ga0207674_10084096 3300026116 Bacteria 3181
158 Ga0209281_1000310 3300027111 Bacteria 87212
159 Ga0209281_1008408 3300027111 Bacteria 2510
160 Ga0209282_1047494 3300027666 Bacteria 2494
161 Ga0307515_10000274 3300028794 Bacteria 126011
162 Ga0268256_1002827 3300030500 Bacteria 8372
163 Ga0307513_10008569 3300031456 Bacteria 13066
164 Ga0315914_1000008 3300031967 Bacteria 209133
165 Ga0315913_1000093 3300033430 Bacteria 51180
166 Ga0315915_1000014 3300033464 Bacteria 171068
167 Ga0373927_0002703 3300035695 Bacteria 12925
168 Ga0373925_0001344 3300037068 Bacteria 21480
169 Ga0395900_0011930 3300037418 Bacteria 8885
170 Ga0395900_0172337 3300037418 Bacteria 2202
171 Ga0395905_0000658 3300037471 Bacteria 45924
172 Ga0395905_0144509 3300037471 Bacteria 2238
173 Ga0395905_0229872 3300037471 Bacteria 1734
174 Ga0395901_0039637 3300038443 Bacteria 4876
175 Ga0436361_0672524 3300039447 Bacteria 11474
176 Ga0439439_0004710 3300041406 Bacteria 3084
177 Ga0439465_0001450 3300041413 Bacteria 7677
178 Ga0451849_1487026 3300041505 Bacteria 1708
179 Ga0439449_0000949 3300042007 Bacteria 11352
180 Ga0439449_0005415 3300042007 Bacteria 4890
181 Ga0466972_0010828 3300044658 Bacteria 4578
182 Ga0466972_0025233 3300044658 Bacteria 2947
183 Ga0466960_0014442 3300044901 Bacteria 3380
184 Ga0495627_017855 3300046453 Bacteria 2403
185 Ga0495629_0083323 3300046459 Bacteria 2232
186 Ga0495650_0049445 3300046471 Bacteria 1746
187 Ga0495662_0062303 3300046476 Bacteria 1802
188 Ga0495607_0048239 3300046501 Bacteria 2491
189 Ga0495583_0028673 3300046506 Bacteria 2734
190 Ga0495606_0040790 3300046507 Bacteria 3118
191 Ga0495610_0030323 3300046512 Bacteria 2836
192 Ga0495620_0048348 3300046515 Bacteria 1826
193 Ga0495643_0028659 3300046522 Bacteria 3119
194 Ga0495654_0040368 3300046530 Bacteria 2326
195 Ga0495609_0024212 3300046538 Bacteria 2786
196 Ga0495625_0056412 3300046660 Bacteria 2796
197 Ga0495661_0058253 3300046665 Bacteria 2303
198 Ga0495588_0025726 3300046674 Bacteria 2934
199 Ga0495649_0053694 3300046694 Bacteria 2181
200 Ga0495600_0025862 3300046809 Bacteria 3784
201 Ga0495687_038452 3300047443 Bacteria 2123
202 Ga0495681_0034123 3300047470 Bacteria 2538
203 Ga0495686_0004635 3300047472 Bacteria 11180
204 Ga0496100_0063699 3300048903 Bacteria 2437
205 Ga0496102_0098337 3300048905 Bacteria 2715
206 Ga0496102_0171185 3300048905 Bacteria 2044
207 Ga0496103_0051880 3300048906 Bacteria 2539
208 Ga0496105_0005765 3300048908 Bacteria 9441
209 Ga0496106_0004905 3300048909 Bacteria 9902
210 Ga0496108_0170797 3300048911 Bacteria 1881
211 Ga0496110_0027950 3300048913 Bacteria 4839
212 Ga0496110_0143993 3300048913 Bacteria 2155
213 Ga0496111_0004113 3300048914 Bacteria 9134
214 Ga0496113_0093139 3300048916 Bacteria 2325
215 Ga0496116_0062990 3300048919 Bacteria 2391
216 Ga0496116_0067768 3300048919 Bacteria 2278
217 Ga0496117_0002626 3300048920 Bacteria 22299
218 Ga0496117_0043264 3300048920 Bacteria 3277
219 Ga0496117_0057747 3300048920 Bacteria 2692
220 Ga0496118_0002908 3300048921 Bacteria 22263
221 Ga0496118_0042118 3300048921 Bacteria 3606
222 Ga0496119_0025984 3300048922 Bacteria 4074
223 Ga0496119_0036010 3300048922 Bacteria 3235
224 Ga0496120_0057963 3300048923 Bacteria 2177
225 Ga0496121_0007292 3300048924 Bacteria 13377
226 Ga0496121_0008324 3300048924 Bacteria 12253
227 Ga0496121_0084189 3300048924 Bacteria 2508
228 Ga0496121_0215458 3300048924 Bacteria 1357
229 Ga0496122_0008207 3300048925 Bacteria 11343
230 Ga0496122_0025035 3300048925 Bacteria 5201
231 Ga0496122_0031441 3300048925 Bacteria 4417
232 Ga0496122_0050529 3300048925 Bacteria 3170
233 Ga0496123_0005835 3300048926 Bacteria 12209
234 Ga0496123_0009755 3300048926 Bacteria 8587
235 Ga0496123_0017343 3300048926 Bacteria 5798
236 Ga0496124_0024674 3300048927 Bacteria 5461
237 Ga0496124_0026748 3300048927 Bacteria 5197
238 Ga0496124_0028934 3300048927 Bacteria 4946
239 Ga0496124_0046075 3300048927 Bacteria 3736
240 Ga0496124_0102047 3300048927 Bacteria 2322
241 Ga0496125_0010044 3300048928 Bacteria 9610
242 Ga0496125_0032451 3300048928 Bacteria 4639
243 Ga0496125_0070111 3300048928 Bacteria 2746
244 Ga0496125_0071856 3300048928 Bacteria 2700
245 Ga0496126_0034356 3300048929 Bacteria 4761
246 Ga0496126_0068711 3300048929 Bacteria 3162
247 Ga0496126_0080017 3300048929 Bacteria 2892
248 Ga0501032_0016650 3300049569 Bacteria 5169
249 Ga0501036_0040632 3300049572 Bacteria 3934
250 Ga0501039_0181956 3300049575 Bacteria 1653
251 Ga0501043_0011795 3300049579 Bacteria 6845
252 Ga0501047_0058717 3300049581 Bacteria 3716
253 nmdc:mga03n38_36185_c1 3300050490 Bacteria 2121
254 nmdc:mga00v17_7305_c1 3300050491 Bacteria 5887
255 nmdc:mga00v17_74_c2 3300050491 Bacteria 26063
256 nmdc:mga0yw44_15730_c1 3300050492 Bacteria 4064
257 nmdc:mga06z11_63575_c1 3300050494 Bacteria 1931
258 nmdc:mga07m45_26334_c1 3300050496 Bacteria 3196
259 nmdc:mga0sz30_11282_c1 3300050516 Bacteria 3447
260 nmdc:mga0sz30_59402_c1 3300050516 Bacteria 1631
261 Ga0500618_000192 3300053125 Bacteria 50229
262 Ga0500618_009208 3300053125 Bacteria 2707
263 Ga0500655_008442 3300053133 Bacteria 1854
264 Ga0500559_0006820 3300053136 Bacteria 5121
265 Ga0500568_0009612 3300053139 Bacteria 4581
266 Ga0500590_004631 3300053148 Bacteria 6517
267 Ga0500604_0024311 3300053151 Bacteria 1733
268 Ga0500604_0073007 3300053151 Bacteria 1097
269 Ga0500622_0001030 3300053156 Bacteria 23359
270 Ga0500622_0001940 3300053156 Bacteria 15583
271 Ga0500636_0046805 3300053177 Bacteria 2549
272 Ga0587070_001040 3300059491 Bacteria 2696
273 Ga0587073_0000513 3300059492 Bacteria 3627
274 Ga0587077_000632 3300059493 Bacteria 3198
275 Ga0587080_000416 3300059503 Bacteria 3546
276 Ga0587082_000171 3300059504 Bacteria 4295
277 Ga0587083_0000216 3300059505 Bacteria 4318
278 Ga0587083_0001825 3300059505 Bacteria 2502
279 Ga0587083_0010241 3300059505 Bacteria 1515
280 Ga0587088_000213 3300059508 Bacteria 4030
281 Ga0587091_015685 3300059511 Bacteria 1254
282 Ga0587106_000351 3300059605 Bacteria 3060
283 Ga0587099_001090 3300059622 Bacteria 1847
284 Ga0587109_005497 3300059624 Bacteria 1822
285 Ga0587067_000445 3300059640 Bacteria 3583
286 Ga0587067_004935 3300059640 Bacteria 1773
287 Ga0587069_000766 3300059642 Bacteria 2644
288 Ga0587072_000730 3300059643 Bacteria 3585
289 Ga0587075_000486 3300059644 Bacteria 3199
290 Ga0587079_000518 3300059647 Bacteria 3507
291 Ga0587114_005974 3300059655 Bacteria 1341
292 Ga0587116_00580 3300059656 Bacteria 1507
293 Ga0587071_001228 3300060344 Bacteria 3102
294 2509107848 2508501122 Bacteria 6292184
295 2509116467 2508501123 Bacteria 6283661
296 2509376245 2509276019 Bacteria 6802256
297 2509397634 2509276022 Bacteria 6200534
298 2510318835 2510065059 Bacteria 6847884
299 2511182717 2510917028 Bacteria 6185411
300 2511200578 2510917030 Bacteria 7460662
301 2511392567 2511231027 Bacteria 5013807
302 2512930003 2512875016 Bacteria 6529530
303 2512971865 2512875026 Bacteria 6861065
304 2513599267 2513237088 Bacteria 6927906
305 2513607521 2513237089 Bacteria 6553624
306 2513614217 2513237090 Bacteria 7096802
307 2513988405 2513237156 Bacteria 6402557
308 2514005416 2513237160 Bacteria 6650282
309 2514033211 2513237164 Bacteria 7563725
310 2516209259 2516143018 Bacteria 6951533
311 2517569477 2517487022 Bacteria 7227575
312 2520379491 2519899620 Bacteria 6499161
313 2524452890 2524023207 Bacteria 6813453
314 2524462632 2524023209 Bacteria 6679728
315 2558863113 2558860100 Bacteria 8458965
316 2561466259 2558860983 Bacteria 4133860
317 2585168317 2582581283 Bacteria 6030556
318 2585225931 2582581298 Bacteria 7315509
319 2585276893 2582581308 Bacteria 7413247
320 2585324103 2582581315 Bacteria 7318924
321 2585333501 2582581316 Bacteria 7774528
322 2585393917 2582581866 Bacteria 6859583
323 2585534801 2585427527 Bacteria 7273426
324 2585546891 2585427529 Bacteria 7395659
325 2585551753 2585427530 Bacteria 7383882
326 2585897650 2585427608 Bacteria 6544331
327 2588515603 2588253730 Bacteria 6881675
328 2599721988 2599185236 Bacteria 6875203
329 2599939229 2599185301 Bacteria 6161860
330 2600192346 2599185352 Bacteria 7228948
331 2600375616 2600254933 Bacteria 4750527
332 2616292844 2615840624 Bacteria 6557588
333 2616556673 2615840698 Bacteria 7319877
334 2617381620 2617270742 Bacteria 6808054
335 2643808428 2643221557 Bacteria 7184309
336 2643811794 2643221558 Bacteria 5460675
337 2644049545 2643221607 Bacteria 6314006
338 2644066479 2643221610 Bacteria 7480339
339 2644204047 2643221636 Bacteria 6583769
340 2644378067 2643221668 Bacteria 7306521
341 2644415308 2643221675 Bacteria 7473456
342 2644450291 2643221680 Bacteria 7473610
343 2644482579 2643221686 Bacteria 6310811
344 2644499081 2643221689 Bacteria 6042950
345 2644677922 2643221723 Bacteria 7095460
346 2644687843 2643221726 Bacteria 7455827
347 2657683692 2657244999 Bacteria 5946535
348 2671115668 2667528174 Bacteria 6435400
349 2688600043 2687453392 Bacteria 6880454
350 2692316417 2690316117 Bacteria 6800650
351 2694631342 2693429783 Bacteria 7019804
352 2694639120 2693429784 Bacteria 7241525
353 2719180746 2718217882 Bacteria 6556348
354 2719665211 2718217997 Bacteria 6740740
355 2719731495 2718218009 Bacteria 6478651
356 2720491631 2718218199 Bacteria 6740745
357 2720612884 2718218232 Bacteria 6720332
358 2720619745 2718218233 Bacteria 6662049
359 2720631176 2718218235 Bacteria 6630699
360 2720774903 2718218269 Bacteria 6906114
361 2721146840 2718218363 Bacteria 6524337
362 2721158367 2718218365 Bacteria 6274507
363 2721163719 2718218366 Bacteria 6425255
364 2722839889 2721755514 Bacteria 6424414
365 2723026540 2721755556 Bacteria 6745503
366 2723560144 2721755684 Bacteria 6859907
367 2723566702 2721755685 Bacteria 6704835
368 2724044251 2721755810 Bacteria 6479005
369 2724089510 2721755819 Bacteria 6906405
370 2724103967 2721755822 Bacteria 6726041
371 2724109804 2721755823 Bacteria 6752556
372 2730107476 2728369352 Bacteria 6745171
373 2730163983 2728369365 Bacteria 6555560
374 2730297999 2728369397 Bacteria 6274511
375 2739306393 2738543024 Bacteria 5603683
376 2765465280 2765235802 Bacteria 5618596
377 2770197423 2767802442 Bacteria 5747986
378 2776271875 2775506902 Bacteria 6208009
379 2776279609 2775506904 Bacteria 5954060
380 2778176407 2775507266 Bacteria 7392367
381 2792581184 2791355082 Bacteria 5973319
382 2792642616 2791355094 Bacteria 7011481
383 2792749029 2791355123 Bacteria 8049106
384 2793297123 2791355256 Bacteria 6798008
385 2793321272 2791355260 Bacteria 6598818
386 2793331187 2791355261 Bacteria 6661293
387 2793337315 2791355262 Bacteria 6774204
388 2793347792 2791355264 Bacteria 6429314
389 2793352225 2791355265 Bacteria 6539969
390 2793366382 2791355267 Bacteria 7222458
391 2802718861 2802428858 Bacteria 6636079
392 2802726472 2802428859 Bacteria 6667919
393 2802738370 2802428861 Bacteria 6534206
394 2802744702 2802428862 Bacteria 6633353
395 2802751092 2802428863 Bacteria 6410669
396 2804751871 2802429268 Bacteria 6094027
397 2805927554 2802429605 Bacteria 6875453
398 2805936028 2802429606 Bacteria 6346811
399 2819610475 2818991448 Bacteria 6772224
400 2819638219 2818991453 Bacteria 7181617
401 2819687461 2818991461 Bacteria 7026071
402 2821127660 2821123053 Bacteria 7836056
403 2838018739 2838016132 Bacteria 6577831
404 2838025552 2838022645 Bacteria 6494267
405 2838032197 2838029111 Bacteria 6603031
406 2838052189 2838048938 Bacteria 6044578
407 2838067894 2838061910 Bacteria 6794874
408 2838071306 2838068647 Bacteria 6208656
409 2838079338 2838074704 Bacteria 6785777
410 2838669995 2838668709 Bacteria 6671819
411 2838702367 2838701080 Bacteria 6669771
412 2838738084 2838736955 Bacteria 5760694
413 2839995831 2839993093 Bacteria 5512535
414 2840769764 2840764183 Bacteria 6358399
415 2841841547 2841840854 Bacteria 5761912
416 2842141325 2842140634 Bacteria 5759631
417 2842147088 2842146304 Bacteria 5957337
418 2842197085 2842192696 Bacteria 6147454
419 2842201121 2842198810 Bacteria 6608673
420 2842206485 2842205361 Bacteria 6340321
421 2842252153 2842250916 Bacteria 6579627
422 2842267588 2842264693 Bacteria 6472963
423 2842279942 2842278818 Bacteria 6340002
424 2842287571 2842285085 Bacteria 6011953
425 2842301909 2842298080 Bacteria 6123127
426 2842315363 2842311132 Bacteria 6616990
427 2842318334 2842317721 Bacteria 6793725
428 2842362293 2842357229 Bacteria 6485165
429 2842404900 2842402390 Bacteria 6681310
430 2842411482 2842409023 Bacteria 6687331
431 2842418067 2842415677 Bacteria 6596907
432 2842425037 2842422224 Bacteria 6239196
433 2842431834 2842428310 Bacteria 6767288
434 2842437947 2842434925 Bacteria 6502746
435 2842444761 2842441272 Bacteria 6769273
436 2842451677 2842447887 Bacteria 6754142
437 2842465862 2842462802 Bacteria 6588055
438 2842472564 2842469257 Bacteria 6752936
439 2842479174 2842475841 Bacteria 6603183
440 2842487203 2842482326 Bacteria 7212537
441 2842492685 2842489311 Bacteria 6620893
442 2842500692 2842495871 Bacteria 6820686
443 2842506106 2842502639 Bacteria 6604161
444 2842510138 2842509118 Bacteria 6850950
445 2842874431 2842871566 Bacteria 4827117
446 2844015362 2844009547 Bacteria 6728125
447 2847418514 2847417321 Bacteria 6913799
448 2847671307 2847670302 Bacteria 6165597
449 2847687456 2847686936 Bacteria 6278406
450 2848993492 2848992105 Bacteria 6810864
451 2850080815 2850079185 Bacteria 6848280
452 2852389546 2852387548 Bacteria 8025568
453 2855873323 2855872281 Bacteria 6964271
454 2856315658 2856314179 Bacteria 6477897
455 2856324503 2856320880 Bacteria 7263508
456 2856333295 2856328259 Bacteria 6528202
457 2856341409 2856334872 Bacteria 7037011
458 2856352467 2856349417 Bacteria 6230045
459 2856370815 2856364286 Bacteria 6939991
460 2857356440 2857349434 Bacteria 7926032
461 2857369351 2857367948 Bacteria 6965560
462 2857534678 2857531043 Bacteria 6754041
463 2869167009 2869162929 Bacteria 6399702
464 2869171079 2869169390 Bacteria 6659796
465 2869238349 2869234852 Bacteria 6654993
466 2869252146 2869249662 Bacteria 6868783
467 2869261895 2869256925 Bacteria 6981691
468 2869277078 2869271264 Bacteria 6908218
469 2869281501 2869278585 Bacteria 7077053
470 2869292292 2869285874 Bacteria 6901219
471 2871435499 2871429161 Bacteria 6547891
472 2871447515 2871444079 Bacteria 6423508
473 2871454271 2871451962 Bacteria 7336357
474 2871486256 2871481445 Bacteria 6700002
475 2871489395 2871488783 Bacteria 6929816
476 2871497578 2871495908 Bacteria 6935695
477 2874103419 2874102143 Bacteria 6342645
478 2874123538 2874116593 Bacteria 6674494
479 2874140836 2874139085 Bacteria 7021506
480 2874155201 2874146452 Bacteria 7533118
481 2874161519 2874155637 Bacteria 6724144
482 2874167707 2874162495 Bacteria 6174670
483 2874175586 2874168670 Bacteria 8062617
484 2876366435 2876363079 Bacteria 6544991
485 2876374976 2876369609 Bacteria 6807521
486 2876383685 2876377896 Bacteria 6565995
487 2876386549 2876386047 Bacteria 6698674
488 2876395697 2876392853 Bacteria 6660880
489 2876401193 2876399893 Bacteria 6927900
490 2876410371 2876406927 Bacteria 6191900
491 2876420655 2876413966 Bacteria 6831344
492 2876425106 2876420981 Bacteria 6687741
493 2878036409 2878035449 Bacteria 6555736
494 2878737243 2878730984 Bacteria 6380721
495 2878742615 2878738818 Bacteria 7136951
496 2878752635 2878745973 Bacteria 6867388
497 2878753929 2878753008 Bacteria 6922523
498 2878761801 2878760144 Bacteria 6823465
499 2878768869 2878767105 Bacteria 6898628
500 2878774814 2878774303 Bacteria 6108671
501 2878785451 2878781027 Bacteria 6834456
502 2881153093 2881147464 Bacteria 7779814
503 2881156848 2881155292 Bacteria 6461656
504 2881162284 2881161766 Bacteria 7127907
505 2881850788 2881845957 Bacteria 6611900
506 2881855006 2881853255 Bacteria 6698367
507 2881864539 2881861095 Bacteria 7128710
508 2882913545 2882912400 Bacteria 6801539
509 2885311112 2885305155 Bacteria 7348390
510 2885319553 2885318864 Bacteria 6729568
511 2885328621 2885326080 Bacteria 7134805
512 2885337404 2885334103 Bacteria 7216818
513 2885345552 2885342637 Bacteria 7011821
514 2885351389 2885350715 Bacteria 6787678
515 2888357430 2888350351 Bacteria 7372807
516 2889012375 2889010040 Bacteria 6749192
517 2889022717 2889016732 Bacteria 6700763
518 2894654801 2894652903 Bacteria 4587256
519 2896387005 2896384573 Bacteria 7700774
520 2903452691 2903448605 Bacteria 7357801
521 2903497274 2903492973 Bacteria 13473544
522 2903502941 2903492973 Bacteria 13473544
523 2903524303 2903521522 Bacteria 6525694
524 2903533514 2903528002 Bacteria 6586099
525 2903542376 2903540706 Bacteria 7062119
526 2904581444 2904578770 Bacteria 5302906
527 2904662328 2904659560 Bacteria 6685615
528 2906315028 2906308376 Bacteria 6841989
529 2906328200 2906321335 Bacteria 6579571
530 2906332533 2906328253 Bacteria 6585166
531 2906360116 2906354277 Bacteria 6991324
532 2906364801 2906363423 Bacteria 6856682
533 2906374805 2906370794 Bacteria 6881062
534 2906388346 2906386501 Bacteria 5977019
535 2906397630 2906393657 Bacteria 6790866
536 2906407751 2906401398 Bacteria 6693206
537 2906411777 2906408224 Bacteria 6162342
538 2906415797 2906414383 Bacteria 6580790
539 2906433177 2906427513 Bacteria 6375796
540 2913300459 2913295892 Bacteria 6333755
541 2915985218 2915980308 Bacteria 6624279
542 2916033485 2916028427 Bacteria 6748433
543 2916060176 2916055098 Bacteria 6758838
544 2919107739 2919100787 Bacteria 7710546
545 2919122679 2919119836 Bacteria 5208557
546 2919409720 2919408235 Bacteria 6149349
547 2920824233 2920822456 Bacteria 6897201
548 2921253025 2921250672 Bacteria 6677771
549 2921269070 2921263974 Bacteria 6864552
550 2922136279 2922130491 Bacteria 7173936
551 2922158414 2922151315 Bacteria 6902399
552 2922159407 2922158528 Bacteria 6573167
553 2922176955 2922172374 Bacteria 6167644
554 2922179089 2922178524 Bacteria 6025201
555 2922189920 2922185730 Bacteria 7113964
556 2923558197 2923556063 Bacteria 6793593
557 2924178279 2924172951 Bacteria 6749356
558 2924717663 2924710171 Bacteria 6752351
559 2924732017 2924726620 Bacteria 6271473
560 2924735295 2924733363 Bacteria 7574837
561 2924742099 2924741084 Bacteria 6661321
562 2924753163 2924748358 Bacteria 6154725
563 2924780415 2924776078 Bacteria 7492003
564 2924791819 2924784321 Bacteria 7416538
565 2928524609 2928521798 Bacteria 4960112
566 2933602105 2933599457 Bacteria 5858799
567 2936997745 2936996657 Bacteria 6298727
568 2937031193 2937029754 Bacteria 6424026
569 2937040861 2937036028 Bacteria 6846469
570 2937049586 2937042894 Bacteria 6741576
571 2937079987 2937078374 Bacteria 6610289
572 2937821427 2937813078 Bacteria 7783518
573 2937851515 2937848649 Bacteria 6983481
574 2937873503 2937868953 Bacteria 6639878
575 2937882937 2937877337 Bacteria 7246526
576 2937896145 2937891427 Bacteria 6357007
577 2937973692 2937972304 Bacteria 7532020
578 2937984545 2937980651 Bacteria 6517427
579 2937996330 2937994558 Bacteria 7036190
580 2938019968 2938014810 Bacteria 6700592
581 2954015198 2954011201 Bacteria 4762601
582 2957376514 2957375807 Bacteria 6425588
583 2957437892 2957437181 Bacteria 6568994
584 2957482970 2957478035 Bacteria 6756658
585 2958037463 2958034702 Bacteria 6989922
586 2958047175 2958041894 Bacteria 13082850
587 2958068764 2958064165 Bacteria 7158582
588 2958090062 2958084443 Bacteria 7312792
589 2958095793 2958092219 Bacteria 6861151
590 2958107035 2958100919 Bacteria 6800575
591 2958114521 2958108152 Bacteria 6681128
592 2958117561 2958115193 Bacteria 6923548
593 2958123703 2958122699 Bacteria 7280457
594 2958136692 2958130278 Bacteria 6897202
595 2958140804 2958137437 Bacteria 6050276
596 2958159600 2958158011 Bacteria 6058449
597 2958166800 2958165035 Bacteria 6906348
598 2958172657 2958172287 Bacteria 6716688
599 2958186185 2958179912 Bacteria 6874908
600 2960596153 2960591022 Bacteria 6622873
601 2960686849 2960680706 Bacteria 6624464
602 2961084667 2961077736 Bacteria 7079850
603 2961117481 2961114664 Bacteria 6680456
604 2961132087 2961127735 Bacteria 7196641
605 2961139451 2961136820 Bacteria 6775228
606 2961165270 2961163497 Bacteria 6901077
607 2961171464 2961170736 Bacteria 7072258
608 2961186713 2961183825 Bacteria 6688536
609 2963649231 2963644680 Bacteria 6530403
610 2965020092 2965018300 Bacteria 6883036
611 2965030567 2965025482 Bacteria 6532201
612 2965038686 2965032056 Bacteria 6887443
613 2965040909 2965040258 Bacteria 6855979
614 2965049547 2965047637 Bacteria 6623551
615 2965064983 2965062239 Bacteria 7412989
616 2965093976 2965089291 Bacteria 6866420
617 2965105555 2965102966 Bacteria 6800987
618 2965116782 2965110997 Bacteria 6693150
619 2967734290 2967728569 Bacteria 6641507
620 2967778792 2967775926 Bacteria 6738189
621 2967996461 2967996073 Bacteria 6787468
622 2968004693 2968003550 Bacteria 6929263
623 2968019701 2968016561 Bacteria 7022047
624 2968084472 2968083720 Bacteria 7351627
625 2968094203 2968091066 Bacteria 6052692
626 2968099778 2968097103 Bacteria 6107094
627 2968113389 2968110612 Bacteria 6814636
628 2968124197 2968117919 Bacteria 6536078
629 2968131629 2968128360 Bacteria 6270294
630 2968146728 2968138860 Bacteria 6605449
631 2968173569 2968171901 Bacteria 6894245
632 2970030966 2970026789 Bacteria 6785236
633 2970124716 2970122695 Bacteria 6625855
634 2970145529 2970143518 Bacteria 6446480
635 2970473022 2970469710 Bacteria 6969209
636 2970492168 2970489779 Bacteria 6517260
637 2970504158 2970503327 Bacteria 7099517
638 2970514035 2970510686 Bacteria 7006402
639 2970535886 2970532167 Bacteria 6553173
640 2970550333 2970547951 Bacteria 6931819
641 2970556656 2970554993 Bacteria 6814252
642 2970596105 2970593180 Bacteria 7073582
643 2970622041 2970619444 Bacteria 6986144
644 2970630444 2970627176 Bacteria 6680862
645 2977533850 2977530762 Bacteria 6951399
646 2977823147 2977821940 Bacteria 6906439
647 2977836057 2977828996 Bacteria 7007971
648 2977849374 2977843712 Bacteria 6753583
649 2977852436 2977851361 Bacteria 6694324
650 2977862378 2977858184 Bacteria 6215359
651 2977871820 2977864932 Bacteria 7534097
652 2977878974 2977872689 Bacteria 7270173
653 2977914361 2977907340 Bacteria 6577984
654 2977919532 2977915119 Bacteria 6829656
655 2977927053 2977922695 Bacteria 6956781
656 2977939002 2977935797 Bacteria 6252826
657 2977945850 2977942078 Bacteria 7570577
658 2977956440 2977950692 Bacteria 6893264
659 2977959789 2977957713 Bacteria 6877875
660 2977977852 2977971508 Bacteria 7472917
661 2977989890 2977986579 Bacteria 6581278
662 2979713611 2979710463 Bacteria 6785254
663 2979768208 2979764755 Bacteria 6610066
664 2979773754 2979772303 Bacteria 6618277
665 2979780623 2979779861 Bacteria 6219781
666 2979796789 2979793036 Bacteria 6808957
667 2979808794 2979808191 Bacteria 7179355
668 2987640252 2987636660 Bacteria 8088555
669 2987648264 2987645492 Bacteria 6117018
670 2987653748 2987652177 Bacteria 6969023
671 2987661277 2987659509 Bacteria 6966464
672 2987674585 2987673487 Bacteria 6884027
673 2996345681 2996341866 Bacteria 6643098
674 2996351856 2996348954 Bacteria 7239054
675 2996391534 2996386984 Bacteria 6978667
676 2996893812 2996893221 Bacteria 5823108
677 3000141754 3000135777 Bacteria 6891109
678 3002143432 3002141150 Bacteria 5254435
679 3003933533 3003930520 Bacteria 5667563
680 3004190326 3004188549 Bacteria 6952365
681 3004199512 3004195979 Bacteria 6776956
682 3004207823 3004203850 Bacteria 7307914
683 3004214731 3004211236 Bacteria 7417683
684 3004219414 3004218560 Bacteria 7421728
685 3004234882 3004232784 Bacteria 6662140
686 3004272249 3004268573 Bacteria 7043476
687 3004278555 3004275668 Bacteria 7114440
688 3004295050 3004289098 Bacteria 6135450
689 3004339514 3004334049 Bacteria 8449246
690 3005409700 3005409236 Bacteria 7188837
691 3005420418 3005416602 Bacteria 7064308
692 3005447195 3005445848 Bacteria 6906074
693 637079783 637000159 Bacteria 7596297
694 649874518 649633066 Bacteria 6690028
695 8004000606 8003999396 Bacteria 7063185
696 8004318691 8004312739 Bacteria 7444653
697 8004366450 8004361976 Bacteria 6858373
698 8004375503 8004374579 Bacteria 6898112
699 8004394726 8004387939 Bacteria 7049250
700 8004447153 8004445564 Bacteria 6322258
701 8004642423 8004640170 Bacteria 6723001
702 8004703043 8004695233 Bacteria 6731676
703 8004711446 8004703790 Bacteria 8006957
704 8004721288 8004714634 Bacteria 6776161
705 8004730819 8004727605 Bacteria 6643904
706 8005288222 8005282627 Bacteria 6675747
707 8005294735 8005289223 Bacteria 6634003
708 8005307089 8005301065 Bacteria 6614431
709 8005317369 8005314921 Bacteria 7072929
710 8005384988 8005382845 Bacteria 6732062
711 8005397088 8005395548 Bacteria 6806915
712 8005436162 8005430974 Bacteria 6689030
713 8005486564 8005484373 Bacteria 6297373
714 8005499843 8005497431 Bacteria 6477605
715 8005621212 8005619151 Bacteria 7030230
716 8005631488 8005626139 Bacteria 6534237
717 8005646287 8005645114 Bacteria 6950293
718 8005671261 8005668836 Bacteria 6953162
719 8005686426 8005682033 Bacteria 6726518
720 8005695003 8005688590 Bacteria 6610080
721 8018129509 8018127388 Bacteria 7351159
722 8024505149 8024501048 Bacteria 6427847
723 8046770274 8046767195 Bacteria 7547379
724 8049294405 8049293176 Bacteria 6128433
725 8054562849 8054558443 Bacteria 5204801
726 8056380093 8056375014 Bacteria 7006639
727 8056387618 8056382006 Bacteria 6408074
728 8056877442 8056875544 Bacteria 4355797
729 8057578202 8057575449 Bacteria 7367519
730 Ga0501037_0096130
731 JGI24740J21852_10000001
732 JGI25155J39150_1000011
733 JGI25156J39149_1000027
734 JGI25156J39149_1001106
735 JGI25162J39368_1000923
736 JGI25162J39368_1001104
737 JGI25162J39368_1001271
738 JGI25154J39366_1000368
739 JGI25158J39367_1000227
740 JGI25157J39369_1000010
741 JGI25157J39369_1000299
742 JGI25152J39213_1001188
743 JGI25152J39213_1003859
744 JGI25159J45721_1000969
745 JGI25151J46595_10015802
746 JGI25151J46595_10047795
747 JGI25165J46597_1001156
748 JGI25165J46597_1001175
749 JGI25165J46597_1008031
750 JGI25153J46596_10022338
751 rootH2_10000482
752 rootL2_10018552
753 JGI25160J50197_1000004
754 JGI25160J50197_1000019
755 JGI25160J50197_1005572
756 JGI25161J50226_1000003
757 JGI25161J50226_1000053
758 JGI25161J50226_1000291
759 Ga0055526_1000382
760 Ga0055524_1006759
761 Ga0055524_1007562
762 Ga0055524_1009040
763 Ga0055536_1007245
764 Ga0055528_1002265
765 Ga0055528_1004558
766 Ga0055528_1010885
767 Ga0055528_1011347
768 Ga0055530_10007617
769 Ga0055540_1000748
770 Ga0055540_1012025
771 Ga0055531_10003009
772 Ga0055543_1000001
773 Ga0055543_1000019
774 Ga0055543_1000147
775 Ga0065165_1000049
776 Ga0065165_1000180
777 Ga0065165_1003917
778 Ga0065165_1008871
779 Ga0070671_100037621
780 Ga0068853_100026608
781 Ga0070665_100096905
782 Ga0068855_100052616
783 Ga0068857_100221397
784 Ga0068854_100046600
785 Ga0068856_100086205
786 Ga0068852_100084082
787 Ga0075365_10001752
788 Ga0075368_10005708
789 Ga0075368_10065527
790 Ga0075363_100018095
791 Ga0075364_10001917
792 Ga0075364_10025309
793 Ga0075367_10007130
794 Ga0075367_10032271
795 Ga0075369_10000352
796 Ga0075369_10003075
797 Ga0075369_10086772
798 Ga0075366_10146110
799 Ga0079104_1000187
800 Ga0105240_10000005
801 Ga0105240_10162849
802 Ga0105248_10071845
803 Ga0105237_10007348
804 Ga0105237_10103174
805 Ga0105238_10000856
806 Ga0123342_1019295
807 Ga0105239_10007427
808 Ga0105239_10034847
809 Ga0105239_10519926
810 Ga0157373_10019309
811 Ga0157370_10002129
812 Ga0157369_10023767
813 Ga0157369_10115546
814 Ga0171463_1011
815 Ga0157374_10073432
816 Ga0182007_10001634
817 Ga0214544_1009612
818 Ga0214542_1000015
819 Ga0214542_1015309
820 Ga0214543_1000011
821 Ga0214543_1000032
822 Ga0228710_1000006
823 Ga0209435_100022
824 Ga0209436_100155
825 Ga0209436_100410
826 Ga0209437_100153
827 Ga0209437_100577
828 Ga0207425_1002020
829 Ga0209646_1000078
830 Ga0209646_1005791
831 Ga0209026_1000002
832 Ga0209026_1000065
833 Ga0209677_100355
834 Ga0209148_1000056
835 Ga0209759_1000055
836 Ga0209759_1000445
837 Ga0209129_1000329
838 Ga0209129_1006396
839 Ga0209233_1000053
840 Ga0209233_1000175
841 Ga0209233_1000248
842 Ga0209233_1000676
843 Ga0209233_1016312
844 Ga0209455_1000214
845 Ga0209673_1000456
846 Ga0209673_1001837
847 Ga0209673_1002251
848 Ga0209673_1003459
849 Ga0209130_1000007
850 Ga0209130_1000012
851 Ga0209130_1000097
852 Ga0209676_1002523
853 Ga0209025_1000033
854 Ga0209025_1001164
855 Ga0209025_1009454
856 Ga0209564_1000140
857 Ga0209564_1000453
858 Ga0209564_1000549
859 Ga0209564_1006104
860 Ga0209758_1006966
861 Ga0209758_1008681
862 Ga0209758_1019212
863 Ga0209758_1023133
864 Ga0209050_1003179
865 Ga0209256_1000319
866 Ga0209256_1000836
867 Ga0209256_1001576
868 Ga0209256_1008248
869 Ga0207426_1000003
870 Ga0207426_1000010
871 Ga0207426_1000111
872 Ga0207426_1006470
873 Ga0209051_1001055
874 Ga0209051_1006833
875 Ga0209051_1012281
876 Ga0209257_1002064
877 Ga0209257_1002957
878 Ga0207705_10023219
879 Ga0207695_10000011
880 Ga0207671_10000276
881 Ga0207671_10011771
882 Ga0207694_10002342
883 Ga0207650_10003278
884 Ga0207644_10012427
885 Ga0207667_10031202
886 Ga0207674_10084096
887 Ga0209281_1000310
888 Ga0209281_1008408
889 Ga0209282_1047494
890 Ga0307515_10000274
891 Ga0268256_1002827
892 Ga0307513_10008569
893 Ga0315914_1000008
894 Ga0315913_1000093
895 Ga0315915_1000014
896 Ga0373927_0002703
897 Ga0373925_0001344
898 Ga0395900_0011930
899 Ga0395900_0172337
900 Ga0395905_0000658
901 Ga0395905_0144509
902 Ga0395905_0229872
903 Ga0395901_0039637
904 Ga0436361_0672524
905 Ga0439439_0004710
906 Ga0439465_0001450
907 Ga0451849_1487026
908 Ga0439449_0000949
909 Ga0439449_0005415
910 Ga0466972_0010828
911 Ga0466972_0025233
912 Ga0466960_0014442
913 Ga0495627_017855
914 Ga0495629_0083323
915 Ga0495650_0049445
916 Ga0495662_0062303
917 Ga0495607_0048239
918 Ga0495583_0028673
919 Ga0495606_0040790
920 Ga0495610_0030323
921 Ga0495620_0048348
922 Ga0495643_0028659
923 Ga0495654_0040368
924 Ga0495609_0024212
925 Ga0495625_0056412
926 Ga0495661_0058253
927 Ga0495588_0025726
928 Ga0495649_0053694
929 Ga0495600_0025862
930 Ga0495687_038452
931 Ga0495681_0034123
932 Ga0495686_0004635
933 Ga0496100_0063699
934 Ga0496102_0098337
935 Ga0496102_0171185
936 Ga0496103_0051880
937 Ga0496105_0005765
938 Ga0496106_0004905
939 Ga0496108_0170797
940 Ga0496110_0027950
941 Ga0496110_0143993
942 Ga0496111_0004113
943 Ga0496113_0093139
944 Ga0496116_0062990
945 Ga0496116_0067768
946 Ga0496117_0002626
947 Ga0496117_0043264
948 Ga0496117_0057747
949 Ga0496118_0002908
950 Ga0496118_0042118
951 Ga0496119_0025984
952 Ga0496119_0036010
953 Ga0496120_0057963
954 Ga0496121_0007292
955 Ga0496121_0008324
956 Ga0496121_0084189
957 Ga0496121_0215458
958 Ga0496122_0008207
959 Ga0496122_0025035
960 Ga0496122_0031441
961 Ga0496122_0050529
962 Ga0496123_0005835
963 Ga0496123_0009755
964 Ga0496123_0017343
965 Ga0496124_0024674
966 Ga0496124_0026748
967 Ga0496124_0028934
968 Ga0496124_0046075
969 Ga0496124_0102047
970 Ga0496125_0010044
971 Ga0496125_0032451
972 Ga0496125_0070111
973 Ga0496125_0071856
974 Ga0496126_0034356
975 Ga0496126_0068711
976 Ga0496126_0080017
977 Ga0501032_0016650
978 Ga0501036_0040632
979 Ga0501039_0181956
980 Ga0501043_0011795
981 Ga0501047_0058717
982 nmdc:mga03n38_36185_c1
983 nmdc:mga00v17_7305_c1
984 nmdc:mga00v17_74_c2
985 nmdc:mga0yw44_15730_c1
986 nmdc:mga06z11_63575_c1
987 nmdc:mga07m45_26334_c1
988 nmdc:mga0sz30_11282_c1
989 nmdc:mga0sz30_59402_c1
990 Ga0500618_000192
991 Ga0500618_009208
992 Ga0500655_008442
993 Ga0500559_0006820
994 Ga0500568_0009612
995 Ga0500590_004631
996 Ga0500604_0024311
997 Ga0500604_0073007
998 Ga0500622_0001030
999 Ga0500622_0001940
1000 Ga0500636_0046805
1001 Ga0587070_001040
1002 Ga0587073_0000513
1003 Ga0587077_000632
1004 Ga0587080_000416
1005 Ga0587082_000171
1006 Ga0587083_0000216
1007 Ga0587083_0001825
1008 Ga0587083_0010241
1009 Ga0587088_000213
1010 Ga0587091_015685
1011 Ga0587106_000351
1012 Ga0587099_001090
1013 Ga0587109_005497
1014 Ga0587067_000445
1015 Ga0587067_004935
1016 Ga0587069_000766
1017 Ga0587072_000730
1018 Ga0587075_000486
1019 Ga0587079_000518
1020 Ga0587114_005974
1021 Ga0587116_00580
1022 Ga0587071_001228
1023 2509107848
1024 2509116467
1025 2509376245
1026 2509397634
1027 2510318835
1028 2511182717
1029 2511200578
1030 2511392567
1031 2512930003
1032 2512971865
1033 2513599267
1034 2513607521
1035 2513614217
1036 2513988405
1037 2514005416
1038 2514033211
1039 2516209259
1040 2517569477
1041 2520379491
1042 2524452890
1043 2524462632
1044 2558863113
1045 2561466259
1046 2585168317
1047 2585225931
1048 2585276893
1049 2585324103
1050 2585333501
1051 2585393917
1052 2585534801
1053 2585546891
1054 2585551753
1055 2585897650
1056 2588515603
1057 2599721988
1058 2599939229
1059 2600192346
1060 2600375616
1061 2616292844
1062 2616556673
1063 2617381620
1064 2643808428
1065 2643811794
1066 2644049545
1067 2644066479
1068 2644204047
1069 2644378067
1070 2644415308
1071 2644450291
1072 2644482579
1073 2644499081
1074 2644677922
1075 2644687843
1076 2657683692
1077 2671115668
1078 2688600043
1079 2692316417
1080 2694631342
1081 2694639120
1082 2719180746
1083 2719665211
1084 2719731495
1085 2720491631
1086 2720612884
1087 2720619745
1088 2720631176
1089 2720774903
1090 2721146840
1091 2721158367
1092 2721163719
1093 2722839889
1094 2723026540
1095 2723560144
1096 2723566702
1097 2724044251
1098 2724089510
1099 2724103967
1100 2724109804
1101 2730107476
1102 2730163983
1103 2730297999
1104 2739306393
1105 2765465280
1106 2770197423
1107 2776271875
1108 2776279609
1109 2778176407
1110 2792581184
1111 2792642616
1112 2792749029
1113 2793297123
1114 2793321272
1115 2793331187
1116 2793337315
1117 2793347792
1118 2793352225
1119 2793366382
1120 2802718861
1121 2802726472
1122 2802738370
1123 2802744702
1124 2802751092
1125 2804751871
1126 2805927554
1127 2805936028
1128 2819610475
1129 2819638219
1130 2819687461
1131 2821127660
1132 2838018739
1133 2838025552
1134 2838032197
1135 2838052189
1136 2838067894
1137 2838071306
1138 2838079338
1139 2838669995
1140 2838702367
1141 2838738084
1142 2839995831
1143 2840769764
1144 2841841547
1145 2842141325
1146 2842147088
1147 2842197085
1148 2842201121
1149 2842206485
1150 2842252153
1151 2842267588
1152 2842279942
1153 2842287571
1154 2842301909
1155 2842315363
1156 2842318334
1157 2842362293
1158 2842404900
1159 2842411482
1160 2842418067
1161 2842425037
1162 2842431834
1163 2842437947
1164 2842444761
1165 2842451677
1166 2842465862
1167 2842472564
1168 2842479174
1169 2842487203
1170 2842492685
1171 2842500692
1172 2842506106
1173 2842510138
1174 2842874431
1175 2844015362
1176 2847418514
1177 2847671307
1178 2847687456
1179 2848993492
1180 2850080815
1181 2852389546
1182 2855873323
1183 2856315658
1184 2856324503
1185 2856333295
1186 2856341409
1187 2856352467
1188 2856370815
1189 2857356440
1190 2857369351
1191 2857534678
1192 2869167009
1193 2869171079
1194 2869238349
1195 2869252146
1196 2869261895
1197 2869277078
1198 2869281501
1199 2869292292
1200 2871435499
1201 2871447515
1202 2871454271
1203 2871486256
1204 2871489395
1205 2871497578
1206 2874103419
1207 2874123538
1208 2874140836
1209 2874155201
1210 2874161519
1211 2874167707
1212 2874175586
1213 2876366435
1214 2876374976
1215 2876383685
1216 2876386549
1217 2876395697
1218 2876401193
1219 2876410371
1220 2876420655
1221 2876425106
1222 2878036409
1223 2878737243
1224 2878742615
1225 2878752635
1226 2878753929
1227 2878761801
1228 2878768869
1229 2878774814
1230 2878785451
1231 2881153093
1232 2881156848
1233 2881162284
1234 2881850788
1235 2881855006
1236 2881864539
1237 2882913545
1238 2885311112
1239 2885319553
1240 2885328621
1241 2885337404
1242 2885345552
1243 2885351389
1244 2888357430
1245 2889012375
1246 2889022717
1247 2894654801
1248 2896387005
1249 2903452691
1250 2903497274
1251 2903502941
1252 2903524303
1253 2903533514
1254 2903542376
1255 2904581444
1256 2904662328
1257 2906315028
1258 2906328200
1259 2906332533
1260 2906360116
1261 2906364801
1262 2906374805
1263 2906388346
1264 2906397630
1265 2906407751
1266 2906411777
1267 2906415797
1268 2906433177
1269 2913300459
1270 2915985218
1271 2916033485
1272 2916060176
1273 2919107739
1274 2919122679
1275 2919409720
1276 2920824233
1277 2921253025
1278 2921269070
1279 2922136279
1280 2922158414
1281 2922159407
1282 2922176955
1283 2922179089
1284 2922189920
1285 2923558197
1286 2924178279
1287 2924717663
1288 2924732017
1289 2924735295
1290 2924742099
1291 2924753163
1292 2924780415
1293 2924791819
1294 2928524609
1295 2933602105
1296 2936997745
1297 2937031193
1298 2937040861
1299 2937049586
1300 2937079987
1301 2937821427
1302 2937851515
1303 2937873503
1304 2937882937
1305 2937896145
1306 2937973692
1307 2937984545
1308 2937996330
1309 2938019968
1310 2954015198
1311 2957376514
1312 2957437892
1313 2957482970
1314 2958037463
1315 2958047175
1316 2958068764
1317 2958090062
1318 2958095793
1319 2958107035
1320 2958114521
1321 2958117561
1322 2958123703
1323 2958136692
1324 2958140804
1325 2958159600
1326 2958166800
1327 2958172657
1328 2958186185
1329 2960596153
1330 2960686849
1331 2961084667
1332 2961117481
1333 2961132087
1334 2961139451
1335 2961165270
1336 2961171464
1337 2961186713
1338 2963649231
1339 2965020092
1340 2965030567
1341 2965038686
1342 2965040909
1343 2965049547
1344 2965064983
1345 2965093976
1346 2965105555
1347 2965116782
1348 2967734290
1349 2967778792
1350 2967996461
1351 2968004693
1352 2968019701
1353 2968084472
1354 2968094203
1355 2968099778
1356 2968113389
1357 2968124197
1358 2968131629
1359 2968146728
1360 2968173569
1361 2970030966
1362 2970124716
1363 2970145529
1364 2970473022
1365 2970492168
1366 2970504158
1367 2970514035
1368 2970535886
1369 2970550333
1370 2970556656
1371 2970596105
1372 2970622041
1373 2970630444
1374 2977533850
1375 2977823147
1376 2977836057
1377 2977849374
1378 2977852436
1379 2977862378
1380 2977871820
1381 2977878974
1382 2977914361
1383 2977919532
1384 2977927053
1385 2977939002
1386 2977945850
1387 2977956440
1388 2977959789
1389 2977977852
1390 2977989890
1391 2979713611
1392 2979768208
1393 2979773754
1394 2979780623
1395 2979796789
1396 2979808794
1397 2987640252
1398 2987648264
1399 2987653748
1400 2987661277
1401 2987674585
1402 2996345681
1403 2996351856
1404 2996391534
1405 2996893812
1406 3000141754
1407 3002143432
1408 3003933533
1409 3004190326
1410 3004199512
1411 3004207823
1412 3004214731
1413 3004219414
1414 3004234882
1415 3004272249
1416 3004278555
1417 3004295050
1418 3004339514
1419 3005409700
1420 3005420418
1421 3005447195
1422 637079783
1423 649874518
1424 8004000606
1425 8004318691
1426 8004366450
1427 8004375503
1428 8004394726
1429 8004447153
1430 8004642423
1431 8004703043
1432 8004711446
1433 8004721288
1434 8004730819
1435 8005288222
1436 8005294735
1437 8005307089
1438 8005317369
1439 8005384988
1440 8005397088
1441 8005436162
1442 8005486564
1443 8005499843
1444 8005621212
1445 8005631488
1446 8005646287
1447 8005671261
1448 8005686426
1449 8005695003
1450 8018129509
1451 8024505149
1452 8046770274
1453 8049294405
1454 8054562849
1455 8056380093
1456 8056387618
1457 8056877442
1458 8057578202

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

108

396

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6551 86 372
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6198 86 372
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.4697 86 372
3rlf-assembly1.cif.gz_F crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.4511 85 325
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.4438 86 372
ID Description Score Start End Superfamily
4ymsD00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6537 86 372 1.10.3720.10
4ymsD00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.616 86 372 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.6067 85 378 1.10.3720.10
af_P0AER5_2_224_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5964 85 372 1.10.3720.10
af_P0AEU3_9_230_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.5933 90 367 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A1J5JDA6-F1-model_v4 CobB/CobQ-like glutamine amidotransferase domain-containing protein 0.7493 1 186 GO:0006541
GO:0009236
GO:0022857
GO:0042242
GO:0043190
AF-A0A7Y0R2V8-F1-model_v4 Amino acid ABC transporter permease 0.739 147 271 GO:0016020
AF-A0A3D2P336-F1-model_v4 Amino acid ABC transporter permease 0.7233 160 293 GO:0005886
GO:0006865
GO:0055085
AF-A0A7V7XG32-F1-model_v4 ABC transporter permease subunit 0.7187 3 372 GO:0006865
GO:0022857
GO:0043190
AF-C8NBF8-F1-model_v4 ABC transporter, permease protein 0.7085 20 378 GO:0006865
GO:0022857
GO:0043190

Map