F477976

General Info

Members Datasets Scaffolds Average Seq Length
731 244 722 192

Family's Representative Sequence

Representative Sequence 3300031712|Ga0265342_10131632|Ga0265342_101316321
Length 196
Sequence MTQHDDKKMKKIITPLTDDVLKTLRAGDEVLLSGTVYTARDAAHKRMVKCLPAAGCRVAELPFVLNGAVIYYTGPSPEKPRQVIGSCGPTSSYRMDKYTSVLLEHGLKATIGKGTRSEEVKKAMKKNKAIYFAATGGAGALISKRVIKSEVIAYYELGCEAIRKLEVKDFPLVVINDIYGNDFYIDGRRQVTGNRQ

Samples

Sample ID Description Type Environment
1 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
2 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
3 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
4 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
5 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
6 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
7 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
167 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
170 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
171 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
172 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
181 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
182 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
183 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
184 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
185 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
186 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
194 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
214 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
215 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
216 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
243 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
244 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.77
Metatranscriptomes 0
Isolates 1.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.14
Rhizoplane 0.41
Rhizosphere 98.91
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10017390 3300003203 Bacteria 2974
2 rootH1_10183144 3300003316 Bacteria 1480
3 rootL2_10180209 3300003322 Bacteria 1139
4 JGI26129J50193_1000967 3300003349 Bacteria 1893
5 Ga0065707_10390632 3300005295 Bacteria 865
6 Ga0070676_10001402 3300005328 Bacteria 12171
7 Ga0070683_100234008 3300005329 Bacteria 1747
8 Ga0070690_100086393 3300005330 Bacteria 2059
9 Ga0070670_100001558 3300005331 Bacteria 18473
10 Ga0068869_100000795 3300005334 Bacteria 18019
11 Ga0070680_100002409 3300005336 Bacteria 13849
12 Ga0070682_100000179 3300005337 Bacteria 47429
13 Ga0070660_100000476 3300005339 Bacteria 26750
14 Ga0070689_100073029 3300005340 Bacteria 2682
15 Ga0070691_10203984 3300005341 Bacteria 1040
16 Ga0070661_100000876 3300005344 Bacteria 21630
17 Ga0070692_10000828 3300005345 Bacteria 10344
18 Ga0070692_10046023 3300005345 Bacteria 2253
19 Ga0070692_10105200 3300005345 Bacteria 1553
20 Ga0070669_100277262 3300005353 Bacteria 1342
21 Ga0070675_100282656 3300005354 Bacteria 1458
22 Ga0070659_100153974 3300005366 Bacteria 1876
23 Ga0070703_10042571 3300005406 Bacteria 1420
24 Ga0070709_10910594 3300005434 Unclassified 696
25 Ga0070711_100109745 3300005439 Bacteria 2023
26 Ga0070705_100000333 3300005440 Bacteria 27695
27 Ga0070705_100101787 3300005440 Bacteria 1815
28 Ga0070705_100122966 3300005440 Bacteria 1679
29 Ga0070705_100438821 3300005440 Bacteria 977
30 Ga0070705_101146624 3300005440 Unclassified 638
31 Ga0070694_100008838 3300005444 Bacteria 6171
32 Ga0070694_100022054 3300005444 Bacteria 4078
33 Ga0070694_100075232 3300005444 Bacteria 2335
34 Ga0070694_100212070 3300005444 Bacteria 1449
35 Ga0070694_100220916 3300005444 Bacteria 1421
36 Ga0070694_100381886 3300005444 Bacteria 1099
37 Ga0070708_100016216 3300005445 Bacteria 6177
38 Ga0070708_100055617 3300005445 Bacteria 3519
39 Ga0070708_100061658 3300005445 Bacteria 3351
40 Ga0070708_100148004 3300005445 Bacteria 2182
41 Ga0070708_100159392 3300005445 Bacteria 2102
42 Ga0070708_100288505 3300005445 Bacteria 1545
43 Ga0070708_100337557 3300005445 Unclassified 1420
44 Ga0070663_100767945 3300005455 Unclassified 824
45 Ga0070662_100027815 3300005457 Bacteria 3931
46 Ga0070662_100471825 3300005457 Bacteria 1044
47 Ga0070662_100781398 3300005457 Unclassified 811
48 Ga0070681_10004124 3300005458 Bacteria 13743
49 Ga0070681_10387683 3300005458 Bacteria 1308
50 Ga0068867_100000455 3300005459 Bacteria 27140
51 Ga0068867_100194989 3300005459 Bacteria 1618
52 Ga0068867_100269575 3300005459 Bacteria 1391
53 Ga0068867_100491618 3300005459 Bacteria 1053
54 Ga0070706_100005118 3300005467 Bacteria 12509
55 Ga0070706_100031118 3300005467 Bacteria 4921
56 Ga0070706_100047684 3300005467 Bacteria 3954
57 Ga0070706_100077558 3300005467 Bacteria 3075
58 Ga0070706_100116134 3300005467 Bacteria 2492
59 Ga0070706_100152467 3300005467 Bacteria 2157
60 Ga0070706_100224884 3300005467 Bacteria 1752
61 Ga0070706_100631058 3300005467 Bacteria 995
62 Ga0070706_100887284 3300005467 Archaea 824
63 Ga0070707_100000653 3300005468 Bacteria 34576
64 Ga0070707_100002097 3300005468 Bacteria 19110
65 Ga0070707_100017934 3300005468 Bacteria 6656
66 Ga0070707_100032582 3300005468 Bacteria 4966
67 Ga0070707_100103935 3300005468 Bacteria 2753
68 Ga0070707_100113897 3300005468 Bacteria 2624
69 Ga0070707_101160595 3300005468 Bacteria 738
70 Ga0070698_100000691 3300005471 Bacteria 36018
71 Ga0070698_100011480 3300005471 Bacteria 9401
72 Ga0070698_100014980 3300005471 Bacteria 8196
73 Ga0070698_100094612 3300005471 Bacteria 2966
74 Ga0070698_100133044 3300005471 Bacteria 2441
75 Ga0070698_100161752 3300005471 Bacteria 2182
76 Ga0070698_100190737 3300005471 Bacteria 1987
77 Ga0070699_100003274 3300005518 Bacteria 14324
78 Ga0070699_100013457 3300005518 Bacteria 7045
79 Ga0070699_100013570 3300005518 Bacteria 7013
80 Ga0070699_100020088 3300005518 Bacteria 5757
81 Ga0070699_100031353 3300005518 Bacteria 4588
82 Ga0070699_100420924 3300005518 Unclassified 1209
83 Ga0070699_100527310 3300005518 Bacteria 1074
84 Ga0070699_100532453 3300005518 Bacteria 1069
85 Ga0070679_100007477 3300005530 Bacteria 10214
86 Ga0070684_100732183 3300005535 Bacteria 923
87 Ga0070697_100023932 3300005536 Bacteria 4860
88 Ga0070697_100031298 3300005536 Bacteria 4279
89 Ga0070697_100065632 3300005536 Bacteria 2966
90 Ga0070697_100070721 3300005536 Bacteria 2861
91 Ga0070697_100090842 3300005536 Bacteria 2524
92 Ga0070697_100093448 3300005536 Bacteria 2490
93 Ga0070697_100124263 3300005536 Bacteria 2161
94 Ga0070697_100930803 3300005536 Bacteria 771
95 Ga0068853_100191463 3300005539 Bacteria 1858
96 Ga0070695_100003891 3300005545 Bacteria 8713
97 Ga0070695_100051338 3300005545 Bacteria 2646
98 Ga0070695_100061321 3300005545 Bacteria 2440
99 Ga0070695_100082910 3300005545 Bacteria 2123
100 Ga0070695_100088122 3300005545 Bacteria 2066
101 Ga0070695_100090045 3300005545 Bacteria 2047
102 Ga0070696_100111286 3300005546 Bacteria 1972
103 Ga0070696_100218306 3300005546 Bacteria 1430
104 Ga0070696_100354617 3300005546 Bacteria 1137
105 Ga0070696_100579039 3300005546 Unclassified 903
106 Ga0070693_100290587 3300005547 Bacteria 1098
107 Ga0070704_100015876 3300005549 Bacteria 4742
108 Ga0070704_100103095 3300005549 Bacteria 2154
109 Ga0070704_100132845 3300005549 Bacteria 1932
110 Ga0070704_100238805 3300005549 Unclassified 1486
111 Ga0070704_100479728 3300005549 Bacteria 1076
112 Ga0070704_100615366 3300005549 Bacteria 956
113 Ga0068855_100000225 3300005563 Bacteria 72196
114 Ga0070664_100017355 3300005564 Bacteria 5910
115 Ga0068854_100129883 3300005578 Bacteria 1922
116 Ga0068854_100730933 3300005578 Bacteria 857
117 Ga0068856_100001169 3300005614 Bacteria 27611
118 Ga0070702_100110874 3300005615 Bacteria 1701
119 Ga0070702_100239369 3300005615 Bacteria 1224
120 Ga0068852_100142485 3300005616 Bacteria 2220
121 Ga0068859_100001393 3300005617 Bacteria 24544
122 Ga0068866_10060874 3300005718 Bacteria 1959
123 Ga0068861_100819802 3300005719 Bacteria 875
124 Ga0068870_10000139 3300005840 Bacteria 25224
125 Ga0068863_100032824 3300005841 Bacteria 4947
126 Ga0068863_100767169 3300005841 Unclassified 961
127 Ga0068858_100189302 3300005842 Bacteria 1944
128 Ga0068858_100513696 3300005842 Bacteria 1158
129 Ga0068860_100001109 3300005843 Bacteria 29627
130 Ga0068860_100284175 3300005843 Bacteria 1618
131 Ga0068862_100003750 3300005844 Bacteria 12958
132 Ga0068862_100087038 3300005844 Bacteria 2717
133 Ga0068862_100143465 3300005844 Bacteria 2121
134 Ga0068862_100520989 3300005844 Bacteria 1131
135 Ga0081455_10001810 3300005937 Bacteria 25776
136 Ga0081538_10015371 3300005981 Bacteria 5929
137 Ga0081539_10000005 3300005985 Bacteria 549026
138 Ga0070716_100085712 3300006173 Bacteria 1893
139 Ga0070712_100006589 3300006175 Bacteria 7212
140 Ga0068871_100259299 3300006358 Bacteria 1516
141 Ga0075428_100000924 3300006844 Bacteria 31024
142 Ga0075428_100001380 3300006844 Bacteria 25833
143 Ga0075428_100023900 3300006844 Bacteria 6763
144 Ga0075428_100030517 3300006844 Bacteria 5961
145 Ga0075428_100054921 3300006844 Bacteria 4364
146 Ga0075428_100148309 3300006844 Bacteria 2549
147 Ga0075428_100197674 3300006844 Bacteria 2174
148 Ga0075428_100561473 3300006844 Bacteria 1220
149 Ga0075428_100717959 3300006844 Bacteria 1064
150 Ga0075430_100000019 3300006846 Bacteria 86721
151 Ga0075430_100000487 3300006846 Bacteria 29740
152 Ga0075430_100016723 3300006846 Bacteria 6247
153 Ga0075430_100046733 3300006846 Bacteria 3656
154 Ga0075430_100061652 3300006846 Bacteria 3151
155 Ga0075430_100147154 3300006846 Bacteria 1962
156 Ga0075430_100177697 3300006846 Bacteria 1771
157 Ga0075430_100191515 3300006846 Bacteria 1700
158 Ga0075431_100000797 3300006847 Bacteria 27524
159 Ga0075431_100002180 3300006847 Bacteria 18719
160 Ga0075431_100002229 3300006847 Bacteria 18559
161 Ga0075431_100008469 3300006847 Bacteria 10298
162 Ga0075431_100023868 3300006847 Bacteria 6261
163 Ga0075431_100072397 3300006847 Bacteria 3556
164 Ga0075431_100168828 3300006847 Bacteria 2249
165 Ga0075431_100187053 3300006847 Bacteria 2123
166 Ga0075431_100312236 3300006847 Bacteria 1587
167 Ga0075431_100340004 3300006847 Bacteria 1511
168 Ga0075431_100379091 3300006847 Bacteria 1419
169 Ga0075431_100461715 3300006847 Bacteria 1264
170 Ga0075431_100559326 3300006847 Bacteria 1131
171 Ga0075431_100983240 3300006847 Bacteria 811
172 Ga0075433_10006420 3300006852 Bacteria 9298
173 Ga0075433_10040066 3300006852 Bacteria 4053
174 Ga0075433_10051693 3300006852 Bacteria 3579
175 Ga0075433_10056759 3300006852 Bacteria 3421
176 Ga0075433_10157687 3300006852 Bacteria 2019
177 Ga0075433_10209438 3300006852 Unclassified 1732
178 Ga0075433_10361249 3300006852 Bacteria 1283
179 Ga0075433_10885883 3300006852 Unclassified 779
180 Ga0075434_100022146 3300006871 Bacteria 6189
181 Ga0075434_100031633 3300006871 Bacteria 5217
182 Ga0075434_100033398 3300006871 Bacteria 5078
183 Ga0075434_100076744 3300006871 Bacteria 3336
184 Ga0075434_100156094 3300006871 Bacteria 2301
185 Ga0075434_100167389 3300006871 Bacteria 2218
186 Ga0075434_100197129 3300006871 Bacteria 2033
187 Ga0075434_100223242 3300006871 Bacteria 1904
188 Ga0075434_100232081 3300006871 Bacteria 1865
189 Ga0075434_100371253 3300006871 Bacteria 1451
190 Ga0075434_100470265 3300006871 Bacteria 1278
191 Ga0075434_100652340 3300006871 Bacteria 1071
192 Ga0075434_100709239 3300006871 Bacteria 1023
193 Ga0075434_101469734 3300006871 Unclassified 691
194 Ga0075429_100000859 3300006880 Bacteria 23924
195 Ga0075429_100010038 3300006880 Bacteria 8205
196 Ga0075429_100011531 3300006880 Bacteria 7665
197 Ga0075429_100021240 3300006880 Bacteria 5627
198 Ga0075429_100027920 3300006880 Bacteria 4899
199 Ga0075429_100030148 3300006880 Bacteria 4712
200 Ga0075429_100107459 3300006880 Bacteria 2438
201 Ga0075429_100144173 3300006880 Bacteria 2084
202 Ga0075429_100144176 3300006880 Bacteria 2084
203 Ga0075429_100284026 3300006880 Bacteria 1449
204 Ga0075429_100385766 3300006880 Bacteria 1227
205 Ga0068865_100124729 3300006881 Bacteria 1920
206 Ga0075436_100001157 3300006914 Bacteria 17854
207 Ga0075436_100049119 3300006914 Bacteria 2911
208 Ga0075436_100281372 3300006914 Bacteria 1189
209 Ga0097620_100001393 3300006931 Bacteria 24544
210 Ga0075435_100015296 3300007076 Bacteria 5766
211 Ga0075435_100033102 3300007076 Bacteria 4085
212 Ga0075435_100057817 3300007076 Bacteria 3138
213 Ga0075435_100131566 3300007076 Bacteria 2094
214 Ga0075435_100220786 3300007076 Bacteria 1609
215 Ga0075435_100274139 3300007076 Bacteria 1439
216 Ga0075435_100606107 3300007076 Unclassified 950
217 Ga0099794_10003275 3300007265 Bacteria 6148
218 Ga0099794_10033382 3300007265 Bacteria 2420
219 Ga0099794_10059008 3300007265 Bacteria 1861
220 Ga0105251_10006103 3300009011 Bacteria 7761
221 Ga0105240_10868874 3300009093 Unclassified 972
222 Ga0111539_10018495 3300009094 Bacteria 8631
223 Ga0111539_10082769 3300009094 Bacteria 3775
224 Ga0111539_10114639 3300009094 Bacteria 3161
225 Ga0111539_10192811 3300009094 Bacteria 2377
226 Ga0111539_11030675 3300009094 Bacteria 957
227 Ga0111539_11260875 3300009094 Unclassified 858
228 Ga0111539_11525077 3300009094 Unclassified 775
229 Ga0114129_10000115 3300009147 Bacteria 80576
230 Ga0114129_10001447 3300009147 Bacteria 32031
231 Ga0114129_10001631 3300009147 Bacteria 30466
232 Ga0114129_10008441 3300009147 Bacteria 14680
233 Ga0114129_10009875 3300009147 Bacteria 13607
234 Ga0114129_10012822 3300009147 Bacteria 11929
235 Ga0114129_10036324 3300009147 Bacteria 6958
236 Ga0114129_10079508 3300009147 Bacteria 4559
237 Ga0114129_10088357 3300009147 Bacteria 4296
238 Ga0114129_10102712 3300009147 Bacteria 3953
239 Ga0114129_10102978 3300009147 Bacteria 3947
240 Ga0114129_10114996 3300009147 Bacteria 3709
241 Ga0114129_10119347 3300009147 Bacteria 3632
242 Ga0114129_10225093 3300009147 Bacteria 2529
243 Ga0114129_10232391 3300009147 Bacteria 2483
244 Ga0114129_10273784 3300009147 Bacteria 2258
245 Ga0114129_10574426 3300009147 Bacteria 1463
246 Ga0114129_10986130 3300009147 Unclassified 1062
247 Ga0114129_11264721 3300009147 Bacteria 916
248 Ga0105243_10285133 3300009148 Bacteria 1489
249 Ga0105241_10001038 3300009174 Bacteria 21150
250 Ga0105242_10589273 3300009176 Bacteria 1072
251 Ga0105242_10664580 3300009176 Bacteria 1015
252 Ga0105242_11044536 3300009176 Bacteria 828
253 Ga0105249_10082436 3300009553 Bacteria 2992
254 Ga0105249_10227328 3300009553 Bacteria 1839
255 Ga0105249_10984313 3300009553 Bacteria 912
256 Ga0105249_11010074 3300009553 Bacteria 901
257 Ga0105239_11297894 3300010375 Bacteria 840
258 Ga0157373_10000388 3300013100 Bacteria 35150
259 Ga0157373_10205914 3300013100 Bacteria 1387
260 Ga0157371_10324448 3300013102 Bacteria 1118
261 Ga0157369_10232425 3300013105 Bacteria 1927
262 Ga0157378_10933805 3300013297 Unclassified 900
263 Ga0163162_10015647 3300013306 Bacteria 7413
264 Ga0157372_10000105 3300013307 Bacteria 88007
265 Ga0157372_10072881 3300013307 Bacteria 3870
266 Ga0157375_10255141 3300013308 Bacteria 1915
267 Ga0163163_10150574 3300014325 Bacteria 2370
268 Ga0157380_10475568 3300014326 Bacteria 1207
269 Ga0207713_1022753 3300025735 Bacteria 2965
270 Ga0207653_10019880 3300025885 Bacteria 2120
271 Ga0207642_10089212 3300025899 Bacteria 1519
272 Ga0207688_10012816 3300025901 Bacteria 4558
273 Ga0207699_10229099 3300025906 Bacteria 1272
274 Ga0207645_10005499 3300025907 Bacteria 9176
275 Ga0207645_10117004 3300025907 Bacteria 1728
276 Ga0207643_10001465 3300025908 Bacteria 13545
277 Ga0207684_10000115 3300025910 Bacteria 149762
278 Ga0207684_10018826 3300025910 Bacteria 5907
279 Ga0207684_10019692 3300025910 Bacteria 5772
280 Ga0207684_10036906 3300025910 Bacteria 4148
281 Ga0207684_10073541 3300025910 Bacteria 2903
282 Ga0207684_10108911 3300025910 Bacteria 2371
283 Ga0207684_10132276 3300025910 Bacteria 2141
284 Ga0207684_10159932 3300025910 Bacteria 1939
285 Ga0207684_10210168 3300025910 Bacteria 1679
286 Ga0207684_10213506 3300025910 Bacteria 1664
287 Ga0207684_10251823 3300025910 Bacteria 1524
288 Ga0207684_10509497 3300025910 Unclassified 1031
289 Ga0207654_10190036 3300025911 Bacteria 1345
290 Ga0207707_10000352 3300025912 Bacteria 48248
291 Ga0207707_10283306 3300025912 Bacteria 1435
292 Ga0207693_10025215 3300025915 Bacteria 4715
293 Ga0207693_10186612 3300025915 Bacteria 1632
294 Ga0207663_10388572 3300025916 Archaea 1064
295 Ga0207660_10000334 3300025917 Bacteria 30356
296 Ga0207660_10127028 3300025917 Bacteria 1937
297 Ga0207660_10900651 3300025917 Bacteria 722
298 Ga0207662_10145280 3300025918 Bacteria 1505
299 Ga0207657_10002597 3300025919 Bacteria 19548
300 Ga0207649_10006035 3300025920 Bacteria 6576
301 Ga0207652_10000466 3300025921 Bacteria 41482
302 Ga0207652_10097233 3300025921 Bacteria 2595
303 Ga0207646_10000250 3300025922 Bacteria 73162
304 Ga0207646_10003851 3300025922 Bacteria 16662
305 Ga0207646_10008684 3300025922 Bacteria 10147
306 Ga0207646_10014285 3300025922 Bacteria 7549
307 Ga0207646_10028619 3300025922 Bacteria 5069
308 Ga0207646_10032828 3300025922 Bacteria 4696
309 Ga0207646_10035039 3300025922 Bacteria 4536
310 Ga0207646_10083233 3300025922 Bacteria 2862
311 Ga0207646_10084314 3300025922 Bacteria 2843
312 Ga0207646_10108278 3300025922 Bacteria 2493
313 Ga0207646_10299330 3300025922 Bacteria 1453
314 Ga0207646_10976971 3300025922 Bacteria 749
315 Ga0207681_10963595 3300025923 Unclassified 715
316 Ga0207650_10025156 3300025925 Bacteria 4239
317 Ga0207659_10148540 3300025926 Bacteria 1828
318 Ga0207644_10203632 3300025931 Bacteria 1562
319 Ga0207706_10024583 3300025933 Bacteria 5400
320 Ga0207706_10323362 3300025933 Bacteria 1342
321 Ga0207706_10911078 3300025933 Unclassified 742
322 Ga0207709_10127879 3300025935 Bacteria 1726
323 Ga0207670_10088095 3300025936 Bacteria 2188
324 Ga0207704_10421945 3300025938 Unclassified 1058
325 Ga0207665_10114297 3300025939 Bacteria 1900
326 Ga0207665_10165423 3300025939 Bacteria 1594
327 Ga0207689_10003685 3300025942 Bacteria 13959
328 Ga0207689_10074531 3300025942 Bacteria 2789
329 Ga0207661_10148620 3300025944 Bacteria 2024
330 Ga0207679_10000878 3300025945 Bacteria 19200
331 Ga0207667_10000497 3300025949 Bacteria 51927
332 Ga0207651_10184560 3300025960 Bacteria 1658
333 Ga0207668_10196221 3300025972 Bacteria 1604
334 Ga0207640_10278268 3300025981 Bacteria 1313
335 Ga0207703_10019303 3300026035 Bacteria 5325
336 Ga0207639_10002384 3300026041 Bacteria 12612
337 Ga0207678_10013961 3300026067 Bacteria 7060
338 Ga0207641_10071148 3300026088 Bacteria 2991
339 Ga0207641_10167672 3300026088 Bacteria 2001
340 Ga0207641_10192178 3300026088 Bacteria 1877
341 Ga0207648_10015946 3300026089 Bacteria 6885
342 Ga0207648_10153126 3300026089 Bacteria 2035
343 Ga0207674_10000550 3300026116 Bacteria 49205
344 Ga0207675_100005709 3300026118 Bacteria 11909
345 Ga0207675_100132891 3300026118 Bacteria 2360
346 Ga0207698_10116523 3300026142 Bacteria 2252
347 Ga0209981_1000490 3300027378 Bacteria 5020
348 Ga0209996_1000338 3300027395 Bacteria 5808
349 Ga0209984_1015316 3300027424 Bacteria 1018
350 Ga0210000_1008761 3300027462 Bacteria 1485
351 Ga0209968_1000579 3300027526 Bacteria 5659
352 Ga0209999_1000243 3300027543 Bacteria 7873
353 Ga0209982_1001041 3300027552 Bacteria 3693
354 Ga0209983_1000034 3300027665 Bacteria 19527
355 Ga0209588_1045530 3300027671 Bacteria 1419
356 Ga0209588_1051939 3300027671 Bacteria 1326
357 Ga0209971_1000028 3300027682 Bacteria 53458
358 Ga0209971_1005708 3300027682 Bacteria 2948
359 Ga0209971_1036225 3300027682 Unclassified 1187
360 Ga0209966_1000073 3300027695 Bacteria 44067
361 Ga0209966_1009155 3300027695 Bacteria 1764
362 Ga0209998_10000001 3300027717 Bacteria 203589
363 Ga0209998_10116032 3300027717 Unclassified 672
364 Ga0209974_10000369 3300027876 Bacteria 14852
365 Ga0209974_10015144 3300027876 Bacteria 2560
366 Ga0209974_10093959 3300027876 Unclassified 1042
367 Ga0207428_10000176 3300027907 Bacteria 89634
368 Ga0207428_10000394 3300027907 Bacteria 54660
369 Ga0207428_10123151 3300027907 Bacteria 1987
370 Ga0207428_10141454 3300027907 Bacteria 1836
371 Ga0268265_10024098 3300028380 Bacteria 4300
372 Ga0268265_10088185 3300028380 Bacteria 2471
373 Ga0268264_10031393 3300028381 Bacteria 4356
374 Ga0268264_11014898 3300028381 Bacteria 836
375 Ga0265332_10091490 3300031238 Bacteria 1286
376 Ga0307408_100034524 3300031548 Bacteria 3543
377 Ga0307408_100222462 3300031548 Bacteria 1541
378 Ga0265342_10131632 3300031712 Bacteria 1401
379 Ga0307405_10157785 3300031731 Bacteria 1603
380 Ga0307405_11237454 3300031731 Bacteria 647
381 Ga0307410_10059238 3300031852 Bacteria 2614
382 Ga0307410_10130784 3300031852 Bacteria 1844
383 Ga0307409_100572154 3300031995 Bacteria 1112
384 Ga0307416_100553296 3300032002 Bacteria 1224
385 Ga0307416_101979282 3300032002 Unclassified 685
386 Ga0307411_10034095 3300032005 Bacteria 3164
387 Ga0307411_10069622 3300032005 Bacteria 2377
388 Ga0307415_100326416 3300032126 Bacteria 1282
389 Ga0373928_0075756 3300035084 Bacteria 840
390 Ga0373929_0145897 3300035085 Bacteria 631
391 Ga0373949_0034097 3300035090 Bacteria 1226
392 Ga0373932_0003143 3300035112 Bacteria 4023
393 Ga0373939_0007077 3300035114 Bacteria 2716
394 Ga0373941_0062149 3300035115 Bacteria 1218
395 Ga0373962_0064142 3300035242 Bacteria 1085
396 Ga0373931_0008836 3300035691 Bacteria 4795
397 Ga0373931_0081418 3300035691 Bacteria 1788
398 Ga0395899_0005401 3300037312 Bacteria 9925
399 Ga0395899_0025520 3300037312 Bacteria 4461
400 Ga0395899_0265576 3300037312 Bacteria 1172
401 Ga0395900_0038990 3300037418 Bacteria 4897
402 Ga0395900_0333236 3300037418 Bacteria 1495
403 Ga0395905_0139761 3300037471 Bacteria 2279
404 Ga0395901_0103437 3300038443 Bacteria 2988
405 Ga0242420_018422 3300038996 Bacteria 1229
406 Ga0439448_0009418 3300042005 Bacteria 2879
407 Ga0439450_116358 3300042008 Bacteria 686
408 Ga0439455_0013689 3300042012 Bacteria 1842
409 Ga0439455_0027803 3300042012 Bacteria 1388
410 Ga0439458_0002296 3300042157 Bacteria 4694
411 Ga0439434_0053749 3300042435 Bacteria 1252
412 Ga0439435_0129585 3300042436 Unclassified 796
413 Ga0439459_0012077 3300042438 Bacteria 1532
414 Ga0439460_0001203 3300042461 Bacteria 6099
415 Ga0439460_0073831 3300042461 Bacteria 1061
416 Ga0451577_0010038 3300042876 Bacteria 9071
417 Ga0451577_0025265 3300042876 Bacteria 5391
418 Ga0451577_0035839 3300042876 Bacteria 4469
419 Ga0451577_0351582 3300042876 Bacteria 1337
420 Ga0451577_0411462 3300042876 Bacteria 1228
421 Ga0451577_0559300 3300042876 Bacteria 1038
422 Ga0453683_0003008 3300044673 Bacteria 12624
423 Ga0453683_0005950 3300044673 Bacteria 8409
424 Ga0453683_0013136 3300044673 Bacteria 5414
425 Ga0453683_0025100 3300044673 Bacteria 3789
426 Ga0453683_0033515 3300044673 Bacteria 3239
427 Ga0453684_0032377 3300044712 Bacteria 7318
428 Ga0453684_0082341 3300044712 Bacteria 4009
429 Ga0453684_0185691 3300044712 Bacteria 2437
430 Ga0451576_0024239 3300045051 Bacteria 6555
431 Ga0451576_0026201 3300045051 Bacteria 6272
432 Ga0451576_0028871 3300045051 Bacteria 5941
433 Ga0451576_0036861 3300045051 Bacteria 5181
434 Ga0451576_0049195 3300045051 Bacteria 4424
435 Ga0451576_0263638 3300045051 Bacteria 1801
436 Ga0451576_0278038 3300045051 Bacteria 1750
437 Ga0451576_0353374 3300045051 Unclassified 1539
438 Ga0495580_0029596 3300046472 Bacteria 3973
439 Ga0495580_0202467 3300046472 Bacteria 1367
440 Ga0495580_0277844 3300046472 Bacteria 1143
441 Ga0495594_0214590 3300046499 Bacteria 1097
442 Ga0495642_0088081 3300046528 Bacteria 1312
443 Ga0495609_0203461 3300046538 Unclassified 827
444 Ga0495656_0070364 3300046615 Bacteria 1552
445 Ga0495659_0054774 3300046664 Bacteria 1460
446 Ga0495669_0032522 3300046684 Bacteria 2293
447 Ga0495669_0141691 3300046684 Unclassified 1135
448 Ga0495669_0152784 3300046684 Bacteria 1093
449 Ga0496102_0001871 3300048905 Bacteria 18136
450 Ga0496106_0239711 3300048909 Bacteria 1449
451 Ga0496108_0361939 3300048911 Bacteria 1266
452 Ga0501031_0090122 3300049568 Bacteria 2000
453 Ga0501031_0193282 3300049568 Bacteria 1329
454 Ga0501033_0225203 3300049570 Bacteria 1334
455 Ga0501033_0231740 3300049570 Bacteria 1312
456 Ga0501036_0025187 3300049572 Bacteria 5019
457 Ga0501036_0224031 3300049572 Bacteria 1579
458 Ga0501036_0308257 3300049572 Bacteria 1324
459 Ga0501036_0386286 3300049572 Bacteria 1168
460 Ga0501036_0448893 3300049572 Bacteria 1074
461 Ga0501036_0710671 3300049572 Bacteria 830
462 Ga0501037_0308819 3300049573 Bacteria 1097
463 Ga0501038_0100011 3300049574 Bacteria 2417
464 Ga0501038_0110847 3300049574 Bacteria 2274
465 Ga0501038_0197507 3300049574 Bacteria 1616
466 Ga0501038_0473156 3300049574 Bacteria 961
467 Ga0501038_0597343 3300049574 Bacteria 835
468 Ga0501039_0164062 3300049575 Bacteria 1747
469 Ga0501039_0201418 3300049575 Bacteria 1565
470 Ga0501039_0291456 3300049575 Bacteria 1283
471 Ga0501039_0311493 3300049575 Bacteria 1237
472 Ga0501039_0336090 3300049575 Bacteria 1187
473 Ga0501039_0517763 3300049575 Bacteria 937
474 Ga0501040_0006783 3300049576 Bacteria 7424
475 Ga0501040_0016619 3300049576 Bacteria 4876
476 Ga0501040_0055431 3300049576 Bacteria 2718
477 Ga0501040_0055533 3300049576 Bacteria 2715
478 Ga0501040_0067285 3300049576 Bacteria 2469
479 Ga0501040_0113952 3300049576 Bacteria 1892
480 Ga0501040_0120591 3300049576 Bacteria 1840
481 Ga0501040_0154345 3300049576 Bacteria 1621
482 Ga0501040_0156057 3300049576 Bacteria 1612
483 Ga0501040_0177175 3300049576 Bacteria 1510
484 Ga0501040_0204399 3300049576 Bacteria 1403
485 Ga0501040_0266368 3300049576 Bacteria 1223
486 Ga0501040_0437225 3300049576 Bacteria 941
487 Ga0501040_0870403 3300049576 Bacteria 652
488 Ga0501041_0009513 3300049577 Bacteria 5729
489 Ga0501041_0031877 3300049577 Bacteria 3186
490 Ga0501041_0041434 3300049577 Bacteria 2797
491 Ga0501041_0165786 3300049577 Bacteria 1382
492 Ga0501041_0255052 3300049577 Bacteria 1103
493 Ga0501042_0007739 3300049578 Bacteria 7058
494 Ga0501042_0030821 3300049578 Bacteria 3792
495 Ga0501042_0071625 3300049578 Bacteria 2480
496 Ga0501042_0106688 3300049578 Bacteria 2016
497 Ga0501042_0160808 3300049578 Bacteria 1620
498 Ga0501042_0339482 3300049578 Bacteria 1086
499 Ga0501046_0002061 3300049580 Bacteria 19077
500 Ga0501046_0016933 3300049580 Bacteria 6097
501 Ga0501046_0162774 3300049580 Bacteria 1677
502 Ga0501046_0202866 3300049580 Bacteria 1475
503 Ga0501046_0502094 3300049580 Bacteria 868
504 Ga0501047_0056714 3300049581 Bacteria 3789
505 Ga0501048_0021144 3300049582 Bacteria 4765
506 Ga0501048_0044237 3300049582 Bacteria 3185
507 Ga0501048_0058521 3300049582 Bacteria 2731
508 Ga0501048_0305062 3300049582 Bacteria 1133
509 Ga0501067_0048491 3300049583 Bacteria 2355
510 Ga0501068_0047035 3300049584 Bacteria 2602
511 Ga0501068_0064635 3300049584 Bacteria 2227
512 Ga0501068_0087739 3300049584 Bacteria 1916
513 Ga0501069_0007927 3300049585 Bacteria 5578
514 Ga0501070_0316882 3300049586 Unclassified 1269
515 Ga0501071_0096534 3300049587 Bacteria 2175
516 Ga0501071_0124817 3300049587 Bacteria 1910
517 Ga0501071_0186637 3300049587 Bacteria 1554
518 Ga0501071_0219441 3300049587 Bacteria 1431
519 Ga0501071_0602815 3300049587 Unclassified 844
520 Ga0501072_0015809 3300049588 Bacteria 5786
521 Ga0501072_0025773 3300049588 Bacteria 4581
522 Ga0501072_0026080 3300049588 Bacteria 4554
523 Ga0501072_0054150 3300049588 Bacteria 3160
524 Ga0501072_0059434 3300049588 Bacteria 3014
525 Ga0501072_0116890 3300049588 Bacteria 2124
526 Ga0501072_0124331 3300049588 Bacteria 2055
527 Ga0501072_0188867 3300049588 Bacteria 1643
528 Ga0501072_0236008 3300049588 Bacteria 1456
529 Ga0501072_0260974 3300049588 Bacteria 1379
530 Ga0501072_0276920 3300049588 Bacteria 1335
531 Ga0501072_0298420 3300049588 Bacteria 1281
532 Ga0501072_0333483 3300049588 Unclassified 1205
533 Ga0501072_0380619 3300049588 Bacteria 1120
534 Ga0501073_0260566 3300049589 Bacteria 1197
535 Ga0501074_0019321 3300049590 Bacteria 4950
536 Ga0501074_0021260 3300049590 Bacteria 4712
537 Ga0501074_0080958 3300049590 Bacteria 2329
538 Ga0501074_0102039 3300049590 Bacteria 2054
539 Ga0501074_0505234 3300049590 Unclassified 856
540 Ga0501075_0014948 3300049591 Bacteria 5567
541 Ga0501075_0029861 3300049591 Bacteria 4033
542 Ga0501075_0076372 3300049591 Bacteria 2534
543 Ga0501075_0076992 3300049591 Bacteria 2524
544 Ga0501075_0097421 3300049591 Bacteria 2232
545 Ga0501075_0104215 3300049591 Bacteria 2156
546 Ga0501075_0108503 3300049591 Bacteria 2110
547 Ga0501075_0186754 3300049591 Bacteria 1581
548 Ga0501075_0298672 3300049591 Bacteria 1227
549 Ga0501075_0370131 3300049591 Bacteria 1092
550 Ga0501075_0441825 3300049591 Unclassified 992
551 Ga0501076_0002878 3300049592 Bacteria 11918
552 Ga0501076_0019643 3300049592 Bacteria 5166
553 Ga0501076_0021226 3300049592 Bacteria 4980
554 Ga0501076_0024534 3300049592 Bacteria 4661
555 Ga0501076_0055972 3300049592 Bacteria 3129
556 Ga0501076_0065644 3300049592 Bacteria 2895
557 Ga0501076_0109288 3300049592 Bacteria 2235
558 Ga0501076_0110518 3300049592 Bacteria 2222
559 Ga0501076_0121304 3300049592 Bacteria 2117
560 Ga0501076_0220677 3300049592 Bacteria 1549
561 Ga0501076_0270085 3300049592 Bacteria 1393
562 Ga0501076_0471809 3300049592 Bacteria 1034
563 Ga0501076_0502749 3300049592 Bacteria 999
564 Ga0501077_0009924 3300049593 Bacteria 5926
565 Ga0501077_0009995 3300049593 Bacteria 5905
566 Ga0501077_0086190 3300049593 Bacteria 1991
567 Ga0501077_0118791 3300049593 Bacteria 1675
568 Ga0501077_0149061 3300049593 Bacteria 1484
569 Ga0501077_0191364 3300049593 Bacteria 1300
570 Ga0501079_0001185 3300049741 Bacteria 18261
571 Ga0501079_0011862 3300049741 Bacteria 6649
572 Ga0501079_0017090 3300049741 Bacteria 5540
573 Ga0501079_0018925 3300049741 Bacteria 5262
574 Ga0501079_0043772 3300049741 Bacteria 3456
575 Ga0501079_0218232 3300049741 Bacteria 1490
576 Ga0501079_0247687 3300049741 Bacteria 1392
577 Ga0501079_0436105 3300049741 Bacteria 1029
578 Ga0501080_0059941 3300049742 Bacteria 3542
579 Ga0501080_0113479 3300049742 Bacteria 2512
580 Ga0501080_0122207 3300049742 Bacteria 2412
581 Ga0501080_0318970 3300049742 Bacteria 1407
582 Ga0501081_0001033 3300049743 Bacteria 16654
583 Ga0501081_0003182 3300049743 Bacteria 10436
584 Ga0501081_0008697 3300049743 Bacteria 6598
585 Ga0501081_0016788 3300049743 Bacteria 4840
586 Ga0501081_0021956 3300049743 Bacteria 4265
587 Ga0501081_0036313 3300049743 Bacteria 3360
588 Ga0501081_0112229 3300049743 Bacteria 1935
589 Ga0501081_0324469 3300049743 Bacteria 1132
590 Ga0501081_0404848 3300049743 Bacteria 1010
591 Ga0501081_0474753 3300049743 Bacteria 930
592 Ga0501081_0554960 3300049743 Unclassified 858
593 Ga0501081_0618435 3300049743 Bacteria 811
594 Ga0501081_0881902 3300049743 Bacteria 674
595 Ga0501083_0031778 3300049744 Bacteria 3623
596 Ga0501083_0113204 3300049744 Bacteria 1783
597 Ga0501083_0240779 3300049744 Unclassified 1178
598 Ga0501045_0024468 3300049824 Bacteria 4336
599 Ga0501045_0073786 3300049824 Bacteria 2513
600 Ga0501045_0156523 3300049824 Bacteria 1695
601 Ga0501045_0485680 3300049824 Bacteria 917
602 Ga0501045_0550117 3300049824 Bacteria 856
603 Ga0501045_0602268 3300049824 Unclassified 814
604 Ga0501045_0708612 3300049824 Bacteria 742
605 nmdc:mga05p37_141781_c1 3300050507 Bacteria 2944
606 nmdc:mga05p37_14582_c1 3300050507 Bacteria 9438
607 nmdc:mga05p37_189936_c1 3300050507 Bacteria 2495
608 nmdc:mga05p37_21565_c1 3300050507 Bacteria 7806
609 nmdc:mga05p37_218253_c1 3300050507 Bacteria 2303
610 nmdc:mga05p37_23238_c1 3300050507 Bacteria 7520
611 nmdc:mga05p37_28205_c1 3300050507 Bacteria 6844
612 nmdc:mga05p37_331825_c1 3300050507 Bacteria 1796
613 nmdc:mga05p37_336224_c1 3300050507 Unclassified 1782
614 nmdc:mga05p37_339410_c1 3300050507 Bacteria 1772
615 nmdc:mga05p37_3396_c1 3300050507 Bacteria 18593
616 nmdc:mga05p37_35596_c1 3300050507 Bacteria 6106
617 nmdc:mga05p37_363045_c1 3300050507 Bacteria 1702
618 nmdc:mga05p37_37629_c1 3300050507 Bacteria 5933
619 nmdc:mga05p37_413792_c1 3300050507 Bacteria 1571
620 nmdc:mga05p37_433261_c1 3300050507 Bacteria 1527
621 nmdc:mga05p37_65962_c1 3300050507 Bacteria 4454
622 nmdc:mga05p37_736607_c1 3300050507 Unclassified 1089
623 nmdc:mga05p37_85453_c1 3300050507 Bacteria 3888
624 nmdc:mga05p37_89_c1 3300050507 Bacteria 81482
625 nmdc:mga09592_1406_c1 3300050508 Bacteria 19268
626 nmdc:mga09592_21339_c1 3300050508 Bacteria 5338
627 nmdc:mga09592_349513_c1 3300050508 Bacteria 1280
628 nmdc:mga09592_36258_c1 3300050508 Bacteria 4131
629 nmdc:mga09592_41843_c1 3300050508 Bacteria 3854
630 nmdc:mga09592_6345_c1 3300050508 Bacteria 9637
631 nmdc:mga09592_837_c1 3300050508 Bacteria 23885
632 nmdc:mga0qj67_130140_c1 3300050509 Bacteria 2038
633 nmdc:mga0qj67_22992_c1 3300050509 Bacteria 4790
634 nmdc:mga0qj67_246111_c1 3300050509 Bacteria 1451
635 nmdc:mga0qj67_343_c1 3300050509 Bacteria 32121
636 nmdc:mga0qj67_43339_c1 3300050509 Bacteria 3544
637 nmdc:mga0qj67_798_c1 3300050509 Bacteria 21472
638 nmdc:mga06r32_10348_c1 3300050510 Bacteria 8414
639 nmdc:mga06r32_1324267_c1 3300050510 Unclassified 664
640 nmdc:mga06r32_14068_c1 3300050510 Bacteria 7257
641 nmdc:mga06r32_181961_c1 3300050510 Bacteria 2087
642 nmdc:mga06r32_20307_c1 3300050510 Bacteria 6114
643 nmdc:mga06r32_27649_c1 3300050510 Bacteria 5302
644 nmdc:mga06r32_287705_c1 3300050510 Unclassified 1630
645 nmdc:mga06r32_32294_c1 3300050510 Bacteria 4924
646 nmdc:mga06r32_345196_c1 3300050510 Bacteria 1473
647 nmdc:mga06r32_4631_c1 3300050510 Bacteria 12337
648 nmdc:mga06r32_523226_c1 3300050510 Bacteria 1162
649 nmdc:mga06r32_654930_c1 3300050510 Bacteria 1018
650 nmdc:mga06r32_705351_c1 3300050510 Bacteria 974
651 nmdc:mga06r32_76392_c1 3300050510 Bacteria 3253
652 nmdc:mga06r32_87705_c1 3300050510 Bacteria 3037
653 nmdc:mga08y16_108945_c1 3300050511 Bacteria 2884
654 nmdc:mga08y16_1417_c1 3300050511 Bacteria 24061
655 nmdc:mga08y16_163309_c1 3300050511 Bacteria 2314
656 nmdc:mga08y16_2945_c1 3300050511 Bacteria 17531
657 nmdc:mga08y16_556387_c1 3300050511 Bacteria 1160
658 nmdc:mga08y16_90439_c1 3300050511 Bacteria 3191
659 nmdc:mga0n895_1008327_c1 3300050512 Unclassified 813
660 nmdc:mga0n895_1302219_c1 3300050512 Bacteria 697
661 nmdc:mga0n895_176870_c1 3300050512 Bacteria 2165
662 nmdc:mga0n895_203_c1 3300050512 Bacteria 21253
663 nmdc:mga0n895_230485_c1 3300050512 Bacteria 1880
664 nmdc:mga0n895_300974_c1 3300050512 Bacteria 1626
665 nmdc:mga0n895_35010_c1 3300050512 Bacteria 4838
666 nmdc:mga0n895_41940_c1 3300050512 Bacteria 4451
667 nmdc:mga0n895_43098_c1 3300050512 Bacteria 4396
668 nmdc:mga0n895_469973_c1 3300050512 Bacteria 1269
669 nmdc:mga0n895_61867_c1 3300050512 Bacteria 3698
670 nmdc:mga0n895_647060_c1 3300050512 Bacteria 1056
671 nmdc:mga0n895_677592_c1 3300050512 Bacteria 1028
672 nmdc:mga0n895_735924_c1 3300050512 Unclassified 980
673 nmdc:mga0n895_88977_c1 3300050512 Bacteria 3088
674 nmdc:mga0rr50_152938_c1 3300050513 Bacteria 1866
675 nmdc:mga0rr50_33149_c1 3300050513 Bacteria 3688
676 nmdc:mga0rr50_389073_c1 3300050513 Bacteria 1177
677 nmdc:mga0rr50_551275_c1 3300050513 Bacteria 982
678 nmdc:mga0rr50_599997_c1 3300050513 Bacteria 939
679 nmdc:mga0rr50_694_c1 3300050513 Bacteria 18015
680 nmdc:mga08x19_153171_c1 3300050514 Bacteria 1562
681 nmdc:mga08x19_384020_c1 3300050514 Bacteria 984
682 nmdc:mga08x19_4220_c1 3300050514 Bacteria 8518
683 nmdc:mga08x19_470_c1 3300050514 Bacteria 27216
684 nmdc:mga0a205_1021094_c1 3300050515 Unclassified 674
685 nmdc:mga0a205_12060_c1 3300050515 Bacteria 7985
686 nmdc:mga0a205_156907_c1 3300050515 Bacteria 2174
687 nmdc:mga0a205_156982_c1 3300050515 Bacteria 2173
688 nmdc:mga0a205_205119_c1 3300050515 Bacteria 1861
689 nmdc:mga0a205_22996_c1 3300050515 Bacteria 5910
690 nmdc:mga0a205_24042_c1 3300050515 Bacteria 5786
691 nmdc:mga0a205_432933_c1 3300050515 Bacteria 1177
692 nmdc:mga0a205_49115_c1 3300050515 Bacteria 4072
693 nmdc:mga0a205_58667_c1 3300050515 Bacteria 3718
694 nmdc:mga0a205_5896_c1 3300050515 Bacteria 11035
695 Ga0501084_0015809 3300054114 Bacteria 6259
696 Ga0501084_0055736 3300054114 Bacteria 3307
697 Ga0501084_0097754 3300054114 Bacteria 2465
698 Ga0501084_0117206 3300054114 Bacteria 2239
699 Ga0501084_0257276 3300054114 Bacteria 1474
700 Ga0501084_0394375 3300054114 Bacteria 1170
701 Ga0501084_0449865 3300054114 Bacteria 1089
702 Ga0501084_0541814 3300054114 Bacteria 983
703 Ga0501084_0621423 3300054114 Bacteria 912
704 Ga0590071_010281 3300059421 Bacteria 2193
705 Ga0590075_052785 3300059424 Bacteria 1043
706 Ga0501082_0056973 3300060353 Bacteria 3367
707 Ga0501082_0064057 3300060353 Bacteria 3166
708 Ga0501082_0109230 3300060353 Bacteria 2394
709 Ga0501082_0190196 3300060353 Bacteria 1786
710 Ga0501082_0229789 3300060353 Bacteria 1614
711 Ga0501082_0261260 3300060353 Bacteria 1506
712 Ga0501082_0276776 3300060353 Bacteria 1461
713 Ga0501082_0494565 3300060353 Bacteria 1069
714 Ga0530510_0012716 3300061734 Bacteria 5916
715 Ga0530510_0015625 3300061734 Bacteria 5364
716 Ga0530510_0042801 3300061734 Bacteria 3272
717 Ga0530510_0046999 3300061734 Bacteria 3118
718 Ga0530510_0063379 3300061734 Bacteria 2676
719 Ga0530510_0122257 3300061734 Bacteria 1911
720 Ga0530510_0343364 3300061734 Bacteria 1121
721 Ga0530510_0391577 3300061734 Bacteria 1046
722 Ga0530510_0839864 3300061734 Unclassified 701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049576 Ga0501040_0870403 Ga0501040_0870403_123_641 172
2 3300061734 Ga0530510_0343364 Ga0530510_0343364_36_578 180
3 iso_pu_bacteria 2864997549 2864998605 181
4 iso_pu_bacteria 2889295896 2889298289 181
5 iso_pu_bacteria 2981284811 2981286776 181
6 iso_pu_bacteria 2981289755 2981291727 181
7 iso_pu_bacteria 2981980479 2981982416 181
8 iso_pu_bacteria 2981985349 2981987320 181
9 iso_pu_bacteria 2857604169 2857607586 182
10 iso_pu_bacteria 8022948649 8022948895 182
11 3300037312 Ga0395899_0025520 Ga0395899_0025520_1893_2447 183
12 iso_pu_bacteria 8054795415 8054800799 183
13 3300049578 Ga0501042_0160808 Ga0501042_0160808_978_1559 184
14 3300061734 Ga0530510_0391577 Ga0530510_0391577_477_1031 184
15 3300003316 rootH1_10183144 rootH1_101831441 185
16 3300009011 Ga0105251_10006103 Ga0105251_100061035 185
17 3300025735 Ga0207713_1022753 Ga0207713_10227533 185
18 3300006846 Ga0075430_100046733 Ga0075430_1000467334 186
19 3300006847 Ga0075431_100008469 Ga0075431_1000084696 186
20 3300006880 Ga0075429_100144176 Ga0075429_1001441763 186
21 3300031548 Ga0307408_100222462 Ga0307408_1002224621 186
22 3300031731 Ga0307405_11237454 Ga0307405_112374541 186
23 3300050508 nmdc:mga09592_349513_c1 nmdc:mga09592_349513_c1_384_944 186
24 3300050509 nmdc:mga0qj67_246111_c1 nmdc:mga0qj67_246111_c1_364_924 186
25 3300050510 nmdc:mga06r32_20307_c1 nmdc:mga06r32_20307_c1_387_947 186
26 3300005445 Ga0070708_100337557 Ga0070708_1003375572 189
27 3300005518 Ga0070699_100527310 Ga0070699_1005273101 189
28 3300007265 Ga0099794_10059008 Ga0099794_100590082 189
29 3300025910 Ga0207684_10213506 Ga0207684_102135062 189
30 3300025922 Ga0207646_10032828 Ga0207646_100328286 189
31 3300005439 Ga0070711_100109745 Ga0070711_1001097453 190
32 3300005445 Ga0070708_100061658 Ga0070708_1000616583 190
33 3300005445 Ga0070708_100288505 Ga0070708_1002885052 190
34 3300005457 Ga0070662_100781398 Ga0070662_1007813982 190
35 3300005459 Ga0068867_100269575 Ga0068867_1002695752 190
36 3300005467 Ga0070706_100005118 Ga0070706_1000051185 190
37 3300005467 Ga0070706_100887284 Ga0070706_1008872842 190
38 3300005468 Ga0070707_100000653 Ga0070707_1000006538 190
39 3300005468 Ga0070707_100032582 Ga0070707_1000325823 190
40 3300005549 Ga0070704_100132845 Ga0070704_1001328452 190
41 3300005615 Ga0070702_100239369 Ga0070702_1002393692 190
42 3300005841 Ga0068863_100032824 Ga0068863_1000328245 190
43 3300005842 Ga0068858_100513696 Ga0068858_1005136962 190
44 3300005843 Ga0068860_100284175 Ga0068860_1002841752 190
45 3300005844 Ga0068862_100087038 Ga0068862_1000870382 190
46 3300005981 Ga0081538_10015371 Ga0081538_100153714 190
47 3300006175 Ga0070712_100006589 Ga0070712_1000065895 190
48 3300006847 Ga0075431_100023868 Ga0075431_1000238683 190
49 3300006847 Ga0075431_100559326 Ga0075431_1005593262 190
50 3300006852 Ga0075433_10056759 Ga0075433_100567593 190
51 3300006852 Ga0075433_10209438 Ga0075433_102094382 190
52 3300006871 Ga0075434_100167389 Ga0075434_1001673893 190
53 3300006871 Ga0075434_100197129 Ga0075434_1001971292 190
54 3300007076 Ga0075435_100606107 Ga0075435_1006061072 190
55 3300007265 Ga0099794_10003275 Ga0099794_100032758 190
56 3300009093 Ga0105240_10868874 Ga0105240_108688742 190
57 3300009094 Ga0111539_10114639 Ga0111539_101146393 190
58 3300009094 Ga0111539_11030675 Ga0111539_110306752 190
59 3300009147 Ga0114129_10225093 Ga0114129_102250932 190
60 3300009176 Ga0105242_10664580 Ga0105242_106645802 190
61 3300025910 Ga0207684_10036906 Ga0207684_100369064 190
62 3300025915 Ga0207693_10025215 Ga0207693_100252153 190
63 3300025916 Ga0207663_10388572 Ga0207663_103885722 190
64 3300025922 Ga0207646_10008684 Ga0207646_100086842 190
65 3300025922 Ga0207646_10083233 Ga0207646_100832333 190
66 3300025923 Ga0207681_10963595 Ga0207681_109635951 190
67 3300025933 Ga0207706_10911078 Ga0207706_109110782 190
68 3300026088 Ga0207641_10167672 Ga0207641_101676722 190
69 3300027671 Ga0209588_1045530 Ga0209588_10455302 190
70 3300027682 Ga0209971_1036225 Ga0209971_10362251 190
71 3300027717 Ga0209998_10116032 Ga0209998_101160321 190
72 3300027876 Ga0209974_10093959 Ga0209974_100939592 190
73 3300027907 Ga0207428_10000394 Ga0207428_100003946 190
74 3300028380 Ga0268265_10024098 Ga0268265_100240983 190
75 3300038996 Ga0242420_018422 Ga0242420_018422_82_654 190
76 3300042876 Ga0451577_0025265 Ga0451577_0025265_1293_1865 190
77 3300044673 Ga0453683_0005950 Ga0453683_0005950_5569_6141 190
78 3300044673 Ga0453683_0025100 Ga0453683_0025100_3163_3735 190
79 3300044673 Ga0453683_0033515 Ga0453683_0033515_279_851 190
80 3300044712 Ga0453684_0032377 Ga0453684_0032377_4308_4880 190
81 3300045051 Ga0451576_0049195 Ga0451576_0049195_3780_4352 190
82 3300049588 Ga0501072_0333483 Ga0501072_0333483_561_1133 190
83 3300049592 Ga0501076_0502749 Ga0501076_0502749_26_598 190
84 3300050507 nmdc:mga05p37_363045_c1 nmdc:mga05p37_363045_c1_747_1319 190
85 3300050510 nmdc:mga06r32_14068_c1 nmdc:mga06r32_14068_c1_4451_5023 190
86 3300050511 nmdc:mga08y16_1417_c1 nmdc:mga08y16_1417_c1_5224_5796 190
87 3300050511 nmdc:mga08y16_556387_c1 nmdc:mga08y16_556387_c1_440_1012 190
88 3300050511 nmdc:mga08y16_90439_c1 nmdc:mga08y16_90439_c1_1599_2171 190
89 3300050512 nmdc:mga0n895_176870_c1 nmdc:mga0n895_176870_c1_189_761 190
90 3300050512 nmdc:mga0n895_300974_c1 nmdc:mga0n895_300974_c1_1029_1601 190
91 3300050512 nmdc:mga0n895_35010_c1 nmdc:mga0n895_35010_c1_1371_1943 190
92 3300050515 nmdc:mga0a205_12060_c1 nmdc:mga0a205_12060_c1_2831_3403 190
93 3300050515 nmdc:mga0a205_22996_c1 nmdc:mga0a205_22996_c1_4334_4906 190
94 3300050515 nmdc:mga0a205_24042_c1 nmdc:mga0a205_24042_c1_2700_3272 190
95 3300005440 Ga0070705_100122966 Ga0070705_1001229663 191
96 3300005444 Ga0070694_100220916 Ga0070694_1002209162 191
97 3300005444 Ga0070694_100381886 Ga0070694_1003818861 191
98 3300005459 Ga0068867_100194989 Ga0068867_1001949891 191
99 3300005467 Ga0070706_100631058 Ga0070706_1006310581 191
100 3300005536 Ga0070697_100031298 Ga0070697_1000312984 191
101 3300005545 Ga0070695_100088122 Ga0070695_1000881221 191
102 3300005545 Ga0070695_100090045 Ga0070695_1000900452 191
103 3300005578 Ga0068854_100730933 Ga0068854_1007309331 191
104 3300005718 Ga0068866_10060874 Ga0068866_100608743 191
105 3300006844 Ga0075428_100148309 Ga0075428_1001483094 191
106 3300006852 Ga0075433_10157687 Ga0075433_101576872 191
107 3300006852 Ga0075433_10885883 Ga0075433_108858832 191
108 3300006871 Ga0075434_100371253 Ga0075434_1003712532 191
109 3300006871 Ga0075434_100652340 Ga0075434_1006523402 191
110 3300006880 Ga0075429_100030148 Ga0075429_1000301484 191
111 3300009094 Ga0111539_10192811 Ga0111539_101928113 191
112 3300009147 Ga0114129_10001447 Ga0114129_1000144729 191
113 3300009147 Ga0114129_10986130 Ga0114129_109861302 191
114 3300009147 Ga0114129_11264721 Ga0114129_112647212 191
115 3300009176 Ga0105242_11044536 Ga0105242_110445362 191
116 3300025899 Ga0207642_10089212 Ga0207642_100892122 191
117 3300025917 Ga0207660_10900651 Ga0207660_109006512 191
118 3300025981 Ga0207640_10278268 Ga0207640_102782682 191
119 3300031238 Ga0265332_10091490 Ga0265332_100914901 191
120 3300031712 Ga0265342_10131632 Ga0265342_101316321 191
121 3300031852 Ga0307410_10059238 Ga0307410_100592382 191
122 3300031995 Ga0307409_100572154 Ga0307409_1005721542 191
123 3300032126 Ga0307415_100326416 Ga0307415_1003264161 191
124 3300049572 Ga0501036_0224031 Ga0501036_0224031_469_1044 191
125 3300049575 Ga0501039_0517763 Ga0501039_0517763_291_866 191
126 3300049576 Ga0501040_0055431 Ga0501040_0055431_835_1410 191
127 3300049577 Ga0501041_0255052 Ga0501041_0255052_299_874 191
128 3300049583 Ga0501067_0048491 Ga0501067_0048491_201_776 191
129 3300049585 Ga0501069_0007927 Ga0501069_0007927_4073_4648 191
130 3300049588 Ga0501072_0026080 Ga0501072_0026080_2007_2582 191
131 3300049591 Ga0501075_0108503 Ga0501075_0108503_759_1334 191
132 3300049592 Ga0501076_0055972 Ga0501076_0055972_780_1355 191
133 3300049593 Ga0501077_0191364 Ga0501077_0191364_414_989 191
134 3300049824 Ga0501045_0708612 Ga0501045_0708612_108_683 191
135 3300050507 nmdc:mga05p37_339410_c1 nmdc:mga05p37_339410_c1_236_811 191
136 3300050507 nmdc:mga05p37_433261_c1 nmdc:mga05p37_433261_c1_137_712 191
137 3300050507 nmdc:mga05p37_736607_c1 nmdc:mga05p37_736607_c1_256_831 191
138 3300050510 nmdc:mga06r32_27649_c1 nmdc:mga06r32_27649_c1_3738_4313 191
139 3300050511 nmdc:mga08y16_163309_c1 nmdc:mga08y16_163309_c1_1119_1694 191
140 3300050512 nmdc:mga0n895_1008327_c1 nmdc:mga0n895_1008327_c1_61_636 191
141 3300050512 nmdc:mga0n895_230485_c1 nmdc:mga0n895_230485_c1_485_1060 191
142 3300050512 nmdc:mga0n895_469973_c1 nmdc:mga0n895_469973_c1_591_1166 191
143 3300050512 nmdc:mga0n895_88977_c1 nmdc:mga0n895_88977_c1_1138_1713 191
144 3300050513 nmdc:mga0rr50_152938_c1 nmdc:mga0rr50_152938_c1_36_611 191
145 3300050515 nmdc:mga0a205_1021094_c1 nmdc:mga0a205_1021094_c1_55_630 191
146 3300050515 nmdc:mga0a205_49115_c1 nmdc:mga0a205_49115_c1_653_1228 191
147 3300054114 Ga0501084_0257276 Ga0501084_0257276_56_631 191
148 3300060353 Ga0501082_0261260 Ga0501082_0261260_850_1425 191
149 3300061734 Ga0530510_0042801 Ga0530510_0042801_829_1404 191
150 3300005328 Ga0070676_10001402 Ga0070676_100014023 192
151 3300005329 Ga0070683_100234008 Ga0070683_1002340081 192
152 3300005330 Ga0070690_100086393 Ga0070690_1000863932 192
153 3300005331 Ga0070670_100001558 Ga0070670_1000015581 192
154 3300005334 Ga0068869_100000795 Ga0068869_1000007954 192
155 3300005336 Ga0070680_100002409 Ga0070680_10000240911 192
156 3300005337 Ga0070682_100000179 Ga0070682_10000017930 192
157 3300005339 Ga0070660_100000476 Ga0070660_10000047613 192
158 3300005340 Ga0070689_100073029 Ga0070689_1000730292 192
159 3300005344 Ga0070661_100000876 Ga0070661_1000008765 192
160 3300005345 Ga0070692_10000828 Ga0070692_100008285 192
161 3300005354 Ga0070675_100282656 Ga0070675_1002826562 192
162 3300005366 Ga0070659_100153974 Ga0070659_1001539741 192
163 3300005406 Ga0070703_10042571 Ga0070703_100425712 192
164 3300005440 Ga0070705_100000333 Ga0070705_1000003337 192
165 3300005444 Ga0070694_100008838 Ga0070694_1000088382 192
166 3300005444 Ga0070694_100022054 Ga0070694_1000220544 192
167 3300005445 Ga0070708_100148004 Ga0070708_1001480043 192
168 3300005457 Ga0070662_100027815 Ga0070662_1000278151 192
169 3300005458 Ga0070681_10004124 Ga0070681_100041243 192
170 3300005459 Ga0068867_100000455 Ga0068867_10000045513 192
171 3300005467 Ga0070706_100031118 Ga0070706_1000311185 192
172 3300005467 Ga0070706_100152467 Ga0070706_1001524673 192
173 3300005468 Ga0070707_100017934 Ga0070707_1000179345 192
174 3300005468 Ga0070707_101160595 Ga0070707_1011605951 192
175 3300005471 Ga0070698_100000691 Ga0070698_10000069118 192
176 3300005471 Ga0070698_100133044 Ga0070698_1001330444 192
177 3300005471 Ga0070698_100190737 Ga0070698_1001907371 192
178 3300005518 Ga0070699_100013457 Ga0070699_1000134575 192
179 3300005518 Ga0070699_100013570 Ga0070699_1000135705 192
180 3300005518 Ga0070699_100031353 Ga0070699_1000313531 192
181 3300005518 Ga0070699_100420924 Ga0070699_1004209242 192
182 3300005518 Ga0070699_100532453 Ga0070699_1005324532 192
183 3300005530 Ga0070679_100007477 Ga0070679_1000074773 192
184 3300005535 Ga0070684_100732183 Ga0070684_1007321831 192
185 3300005536 Ga0070697_100070721 Ga0070697_1000707214 192
186 3300005536 Ga0070697_100124263 Ga0070697_1001242632 192
187 3300005539 Ga0068853_100191463 Ga0068853_1001914631 192
188 3300005545 Ga0070695_100051338 Ga0070695_1000513384 192
189 3300005545 Ga0070695_100061321 Ga0070695_1000613212 192
190 3300005546 Ga0070696_100111286 Ga0070696_1001112863 192
191 3300005549 Ga0070704_100238805 Ga0070704_1002388052 192
192 3300005549 Ga0070704_100615366 Ga0070704_1006153662 192
193 3300005563 Ga0068855_100000225 Ga0068855_10000022557 192
194 3300005564 Ga0070664_100017355 Ga0070664_1000173553 192
195 3300005578 Ga0068854_100129883 Ga0068854_1001298832 192
196 3300005614 Ga0068856_100001169 Ga0068856_10000116913 192
197 3300005615 Ga0070702_100110874 Ga0070702_1001108742 192
198 3300005616 Ga0068852_100142485 Ga0068852_1001424853 192
199 3300005617 Ga0068859_100001393 Ga0068859_1000013937 192
200 3300005719 Ga0068861_100819802 Ga0068861_1008198021 192
201 3300005840 Ga0068870_10000139 Ga0068870_1000013920 192
202 3300005842 Ga0068858_100189302 Ga0068858_1001893023 192
203 3300005843 Ga0068860_100001109 Ga0068860_10000110915 192
204 3300005844 Ga0068862_100003750 Ga0068862_10000375016 192
205 3300006358 Ga0068871_100259299 Ga0068871_1002592993 192
206 3300006847 Ga0075431_100312236 Ga0075431_1003122362 192
207 3300006847 Ga0075431_100379091 Ga0075431_1003790912 192
208 3300006847 Ga0075431_100983240 Ga0075431_1009832402 192
209 3300006852 Ga0075433_10040066 Ga0075433_100400665 192
210 3300006871 Ga0075434_100076744 Ga0075434_1000767444 192
211 3300006931 Ga0097620_100001393 Ga0097620_10000139316 192
212 3300009174 Ga0105241_10001038 Ga0105241_100010383 192
213 3300009553 Ga0105249_10227328 Ga0105249_102273282 192
214 3300013100 Ga0157373_10000388 Ga0157373_1000038811 192
215 3300013105 Ga0157369_10232425 Ga0157369_102324252 192
216 3300013307 Ga0157372_10000105 Ga0157372_1000010558 192
217 3300014325 Ga0163163_10150574 Ga0163163_101505741 192
218 3300014326 Ga0157380_10475568 Ga0157380_104755681 192
219 3300025885 Ga0207653_10019880 Ga0207653_100198802 192
220 3300025901 Ga0207688_10012816 Ga0207688_100128165 192
221 3300025907 Ga0207645_10005499 Ga0207645_100054999 192
222 3300025908 Ga0207643_10001465 Ga0207643_100014653 192
223 3300025910 Ga0207684_10018826 Ga0207684_100188262 192
224 3300025910 Ga0207684_10132276 Ga0207684_101322763 192
225 3300025910 Ga0207684_10210168 Ga0207684_102101683 192
226 3300025912 Ga0207707_10000352 Ga0207707_100003528 192
227 3300025917 Ga0207660_10000334 Ga0207660_1000033418 192
228 3300025918 Ga0207662_10145280 Ga0207662_101452802 192
229 3300025919 Ga0207657_10002597 Ga0207657_100025975 192
230 3300025920 Ga0207649_10006035 Ga0207649_100060353 192
231 3300025921 Ga0207652_10000466 Ga0207652_1000046620 192
232 3300025922 Ga0207646_10000250 Ga0207646_1000025038 192
233 3300025922 Ga0207646_10299330 Ga0207646_102993301 192
234 3300025922 Ga0207646_10976971 Ga0207646_109769711 192
235 3300025925 Ga0207650_10025156 Ga0207650_100251562 192
236 3300025926 Ga0207659_10148540 Ga0207659_101485403 192
237 3300025933 Ga0207706_10024583 Ga0207706_100245835 192
238 3300025936 Ga0207670_10088095 Ga0207670_100880953 192
239 3300025939 Ga0207665_10165423 Ga0207665_101654231 192
240 3300025942 Ga0207689_10003685 Ga0207689_100036854 192
241 3300025944 Ga0207661_10148620 Ga0207661_101486201 192
242 3300025945 Ga0207679_10000878 Ga0207679_100008786 192
243 3300025949 Ga0207667_10000497 Ga0207667_1000049720 192
244 3300025960 Ga0207651_10184560 Ga0207651_101845602 192
245 3300026035 Ga0207703_10019303 Ga0207703_100193032 192
246 3300026041 Ga0207639_10002384 Ga0207639_1000238416 192
247 3300026067 Ga0207678_10013961 Ga0207678_100139614 192
248 3300026088 Ga0207641_10071148 Ga0207641_100711483 192
249 3300026089 Ga0207648_10015946 Ga0207648_100159463 192
250 3300026116 Ga0207674_10000550 Ga0207674_100005503 192
251 3300026118 Ga0207675_100005709 Ga0207675_10000570912 192
252 3300026142 Ga0207698_10116523 Ga0207698_101165233 192
253 3300027671 Ga0209588_1051939 Ga0209588_10519392 192
254 3300028381 Ga0268264_10031393 Ga0268264_100313935 192
255 3300031731 Ga0307405_10157785 Ga0307405_101577852 192
256 3300031852 Ga0307410_10130784 Ga0307410_101307842 192
257 3300032002 Ga0307416_100553296 Ga0307416_1005532962 192
258 3300032005 Ga0307411_10034095 Ga0307411_100340952 192
259 3300032005 Ga0307411_10069622 Ga0307411_100696222 192
260 3300037312 Ga0395899_0265576 Ga0395899_0265576_51_629 192
261 3300037418 Ga0395900_0333236 Ga0395900_0333236_90_668 192
262 3300037471 Ga0395905_0139761 Ga0395905_0139761_1682_2260 192
263 3300042005 Ga0439448_0009418 Ga0439448_0009418_313_891 192
264 3300042012 Ga0439455_0027803 Ga0439455_0027803_440_1018 192
265 3300042157 Ga0439458_0002296 Ga0439458_0002296_1052_1630 192
266 3300042436 Ga0439435_0129585 Ga0439435_0129585_151_729 192
267 3300042438 Ga0439459_0012077 Ga0439459_0012077_383_961 192
268 3300042461 Ga0439460_0073831 Ga0439460_0073831_408_986 192
269 3300042876 Ga0451577_0010038 Ga0451577_0010038_559_1137 192
270 3300044673 Ga0453683_0003008 Ga0453683_0003008_5888_6466 192
271 3300044673 Ga0453683_0013136 Ga0453683_0013136_1581_2159 192
272 3300044712 Ga0453684_0082341 Ga0453684_0082341_252_830 192
273 3300044712 Ga0453684_0185691 Ga0453684_0185691_349_927 192
274 3300045051 Ga0451576_0028871 Ga0451576_0028871_4220_4798 192
275 3300045051 Ga0451576_0036861 Ga0451576_0036861_894_1472 192
276 3300045051 Ga0451576_0353374 Ga0451576_0353374_113_691 192
277 3300046472 Ga0495580_0202467 Ga0495580_0202467_65_643 192
278 3300049570 Ga0501033_0231740 Ga0501033_0231740_366_944 192
279 3300049572 Ga0501036_0308257 Ga0501036_0308257_458_1036 192
280 3300049572 Ga0501036_0386286 Ga0501036_0386286_425_1003 192
281 3300049573 Ga0501037_0308819 Ga0501037_0308819_506_1084 192
282 3300049574 Ga0501038_0473156 Ga0501038_0473156_324_902 192
283 3300049575 Ga0501039_0291456 Ga0501039_0291456_155_733 192
284 3300049576 Ga0501040_0113952 Ga0501040_0113952_831_1409 192
285 3300049576 Ga0501040_0120591 Ga0501040_0120591_461_1039 192
286 3300049576 Ga0501040_0154345 Ga0501040_0154345_165_743 192
287 3300049576 Ga0501040_0156057 Ga0501040_0156057_605_1183 192
288 3300049576 Ga0501040_0437225 Ga0501040_0437225_235_813 192
289 3300049577 Ga0501041_0009513 Ga0501041_0009513_2827_3405 192
290 3300049577 Ga0501041_0165786 Ga0501041_0165786_92_670 192
291 3300049578 Ga0501042_0030821 Ga0501042_0030821_2975_3553 192
292 3300049578 Ga0501042_0106688 Ga0501042_0106688_615_1193 192
293 3300049578 Ga0501042_0339482 Ga0501042_0339482_165_743 192
294 3300049580 Ga0501046_0016933 Ga0501046_0016933_5346_5924 192
295 3300049580 Ga0501046_0202866 Ga0501046_0202866_560_1138 192
296 3300049582 Ga0501048_0305062 Ga0501048_0305062_492_1070 192
297 3300049584 Ga0501068_0087739 Ga0501068_0087739_234_812 192
298 3300049587 Ga0501071_0124817 Ga0501071_0124817_969_1547 192
299 3300049588 Ga0501072_0059434 Ga0501072_0059434_1813_2391 192
300 3300049588 Ga0501072_0188867 Ga0501072_0188867_476_1054 192
301 3300049588 Ga0501072_0236008 Ga0501072_0236008_433_1011 192
302 3300049588 Ga0501072_0276920 Ga0501072_0276920_447_1025 192
303 3300049588 Ga0501072_0298420 Ga0501072_0298420_647_1225 192
304 3300049589 Ga0501073_0260566 Ga0501073_0260566_470_1048 192
305 3300049590 Ga0501074_0102039 Ga0501074_0102039_133_711 192
306 3300049591 Ga0501075_0029861 Ga0501075_0029861_2663_3241 192
307 3300049591 Ga0501075_0076372 Ga0501075_0076372_967_1545 192
308 3300049591 Ga0501075_0370131 Ga0501075_0370131_69_647 192
309 3300049591 Ga0501075_0441825 Ga0501075_0441825_205_783 192
310 3300049592 Ga0501076_0002878 Ga0501076_0002878_922_1500 192
311 3300049592 Ga0501076_0121304 Ga0501076_0121304_57_635 192
312 3300049592 Ga0501076_0220677 Ga0501076_0220677_779_1357 192
313 3300049593 Ga0501077_0009995 Ga0501077_0009995_4925_5503 192
314 3300049593 Ga0501077_0149061 Ga0501077_0149061_155_733 192
315 3300049741 Ga0501079_0011862 Ga0501079_0011862_1393_1971 192
316 3300049741 Ga0501079_0247687 Ga0501079_0247687_458_1036 192
317 3300049742 Ga0501080_0059941 Ga0501080_0059941_1353_1931 192
318 3300049742 Ga0501080_0113479 Ga0501080_0113479_1416_1994 192
319 3300049743 Ga0501081_0003182 Ga0501081_0003182_2357_2935 192
320 3300049743 Ga0501081_0008697 Ga0501081_0008697_3123_3701 192
321 3300049743 Ga0501081_0404848 Ga0501081_0404848_35_613 192
322 3300049743 Ga0501081_0474753 Ga0501081_0474753_329_907 192
323 3300049743 Ga0501081_0554960 Ga0501081_0554960_80_658 192
324 3300049824 Ga0501045_0024468 Ga0501045_0024468_435_1013 192
325 3300049824 Ga0501045_0602268 Ga0501045_0602268_146_724 192
326 3300050507 nmdc:mga05p37_336224_c1 nmdc:mga05p37_336224_c1_948_1526 192
327 3300050510 nmdc:mga06r32_287705_c1 nmdc:mga06r32_287705_c1_141_719 192
328 3300050510 nmdc:mga06r32_345196_c1 nmdc:mga06r32_345196_c1_436_1014 192
329 3300050510 nmdc:mga06r32_705351_c1 nmdc:mga06r32_705351_c1_279_857 192
330 3300050515 nmdc:mga0a205_156907_c1 nmdc:mga0a205_156907_c1_265_843 192
331 3300054114 Ga0501084_0015809 Ga0501084_0015809_4431_5009 192
332 3300054114 Ga0501084_0055736 Ga0501084_0055736_910_1488 192
333 3300054114 Ga0501084_0097754 Ga0501084_0097754_1311_1889 192
334 3300054114 Ga0501084_0117206 Ga0501084_0117206_333_911 192
335 3300054114 Ga0501084_0449865 Ga0501084_0449865_487_1065 192
336 3300054114 Ga0501084_0541814 Ga0501084_0541814_329_907 192
337 3300059424 Ga0590075_052785 Ga0590075_052785_29_607 192
338 3300060353 Ga0501082_0056973 Ga0501082_0056973_1961_2539 192
339 3300060353 Ga0501082_0109230 Ga0501082_0109230_493_1071 192
340 3300061734 Ga0530510_0012716 Ga0530510_0012716_4674_5252 192
341 3300061734 Ga0530510_0063379 Ga0530510_0063379_2014_2592 192
342 3300061734 Ga0530510_0122257 Ga0530510_0122257_1074_1652 192
343 3300003322 rootL2_10180209 rootL2_101802093 193
344 3300003349 JGI26129J50193_1000967 JGI26129J50193_10009672 193
345 3300005295 Ga0065707_10390632 Ga0065707_103906322 193
346 3300005341 Ga0070691_10203984 Ga0070691_102039842 193
347 3300005345 Ga0070692_10046023 Ga0070692_100460233 193
348 3300005345 Ga0070692_10105200 Ga0070692_101052002 193
349 3300005434 Ga0070709_10910594 Ga0070709_109105941 193
350 3300005440 Ga0070705_100101787 Ga0070705_1001017873 193
351 3300005440 Ga0070705_101146624 Ga0070705_1011466241 193
352 3300005444 Ga0070694_100075232 Ga0070694_1000752323 193
353 3300005444 Ga0070694_100212070 Ga0070694_1002120702 193
354 3300005445 Ga0070708_100055617 Ga0070708_1000556173 193
355 3300005445 Ga0070708_100159392 Ga0070708_1001593923 193
356 3300005457 Ga0070662_100471825 Ga0070662_1004718252 193
357 3300005458 Ga0070681_10387683 Ga0070681_103876832 193
358 3300005467 Ga0070706_100047684 Ga0070706_1000476843 193
359 3300005467 Ga0070706_100116134 Ga0070706_1001161343 193
360 3300005467 Ga0070706_100224884 Ga0070706_1002248841 193
361 3300005468 Ga0070707_100103935 Ga0070707_1001039353 193
362 3300005468 Ga0070707_100113897 Ga0070707_1001138973 193
363 3300005471 Ga0070698_100011480 Ga0070698_1000114805 193
364 3300005471 Ga0070698_100094612 Ga0070698_1000946123 193
365 3300005471 Ga0070698_100161752 Ga0070698_1001617523 193
366 3300005518 Ga0070699_100003274 Ga0070699_1000032743 193
367 3300005518 Ga0070699_100020088 Ga0070699_1000200883 193
368 3300005536 Ga0070697_100023932 Ga0070697_1000239323 193
369 3300005536 Ga0070697_100065632 Ga0070697_1000656323 193
370 3300005536 Ga0070697_100093448 Ga0070697_1000934483 193
371 3300005545 Ga0070695_100003891 Ga0070695_1000038914 193
372 3300005545 Ga0070695_100082910 Ga0070695_1000829103 193
373 3300005546 Ga0070696_100218306 Ga0070696_1002183062 193
374 3300005546 Ga0070696_100354617 Ga0070696_1003546172 193
375 3300005547 Ga0070693_100290587 Ga0070693_1002905872 193
376 3300005549 Ga0070704_100015876 Ga0070704_1000158763 193
377 3300005549 Ga0070704_100103095 Ga0070704_1001030951 193
378 3300005549 Ga0070704_100479728 Ga0070704_1004797282 193
379 3300005841 Ga0068863_100767169 Ga0068863_1007671692 193
380 3300005844 Ga0068862_100143465 Ga0068862_1001434653 193
381 3300005844 Ga0068862_100520989 Ga0068862_1005209892 193
382 3300005937 Ga0081455_10001810 Ga0081455_100018101 193
383 3300006173 Ga0070716_100085712 Ga0070716_1000857123 193
384 3300006844 Ga0075428_100001380 Ga0075428_10000138013 193
385 3300006844 Ga0075428_100023900 Ga0075428_1000239004 193
386 3300006844 Ga0075428_100030517 Ga0075428_1000305173 193
387 3300006844 Ga0075428_100197674 Ga0075428_1001976742 193
388 3300006844 Ga0075428_100717959 Ga0075428_1007179592 193
389 3300006846 Ga0075430_100000019 Ga0075430_10000001927 193
390 3300006846 Ga0075430_100000487 Ga0075430_10000048711 193
391 3300006846 Ga0075430_100016723 Ga0075430_1000167232 193
392 3300006846 Ga0075430_100061652 Ga0075430_1000616522 193
393 3300006846 Ga0075430_100147154 Ga0075430_1001471541 193
394 3300006847 Ga0075431_100000797 Ga0075431_1000007973 193
395 3300006847 Ga0075431_100002180 Ga0075431_1000021809 193
396 3300006847 Ga0075431_100072397 Ga0075431_1000723972 193
397 3300006847 Ga0075431_100168828 Ga0075431_1001688283 193
398 3300006847 Ga0075431_100187053 Ga0075431_1001870532 193
399 3300006847 Ga0075431_100340004 Ga0075431_1003400042 193
400 3300006847 Ga0075431_100461715 Ga0075431_1004617152 193
401 3300006852 Ga0075433_10051693 Ga0075433_100516935 193
402 3300006852 Ga0075433_10361249 Ga0075433_103612492 193
403 3300006871 Ga0075434_100031633 Ga0075434_1000316333 193
404 3300006871 Ga0075434_100033398 Ga0075434_1000333985 193
405 3300006871 Ga0075434_100156094 Ga0075434_1001560942 193
406 3300006871 Ga0075434_100223242 Ga0075434_1002232423 193
407 3300006871 Ga0075434_100232081 Ga0075434_1002320812 193
408 3300006871 Ga0075434_100470265 Ga0075434_1004702652 193
409 3300006871 Ga0075434_100709239 Ga0075434_1007092391 193
410 3300006871 Ga0075434_101469734 Ga0075434_1014697342 193
411 3300006880 Ga0075429_100000859 Ga0075429_10000085919 193
412 3300006880 Ga0075429_100010038 Ga0075429_1000100388 193
413 3300006880 Ga0075429_100011531 Ga0075429_1000115315 193
414 3300006880 Ga0075429_100021240 Ga0075429_1000212405 193
415 3300006880 Ga0075429_100027920 Ga0075429_1000279203 193
416 3300006880 Ga0075429_100284026 Ga0075429_1002840262 193
417 3300006880 Ga0075429_100385766 Ga0075429_1003857662 193
418 3300006881 Ga0068865_100124729 Ga0068865_1001247292 193
419 3300006914 Ga0075436_100049119 Ga0075436_1000491192 193
420 3300006914 Ga0075436_100281372 Ga0075436_1002813722 193
421 3300007076 Ga0075435_100033102 Ga0075435_1000331022 193
422 3300007076 Ga0075435_100057817 Ga0075435_1000578173 193
423 3300007076 Ga0075435_100131566 Ga0075435_1001315662 193
424 3300007076 Ga0075435_100220786 Ga0075435_1002207862 193
425 3300007076 Ga0075435_100274139 Ga0075435_1002741392 193
426 3300007265 Ga0099794_10033382 Ga0099794_100333823 193
427 3300009094 Ga0111539_10018495 Ga0111539_100184952 193
428 3300009094 Ga0111539_11260875 Ga0111539_112608752 193
429 3300009094 Ga0111539_11525077 Ga0111539_115250772 193
430 3300009147 Ga0114129_10008441 Ga0114129_1000844111 193
431 3300009147 Ga0114129_10009875 Ga0114129_100098753 193
432 3300009147 Ga0114129_10012822 Ga0114129_1001282212 193
433 3300009147 Ga0114129_10036324 Ga0114129_100363243 193
434 3300009147 Ga0114129_10088357 Ga0114129_100883572 193
435 3300009147 Ga0114129_10102978 Ga0114129_101029782 193
436 3300009147 Ga0114129_10114996 Ga0114129_101149962 193
437 3300009147 Ga0114129_10119347 Ga0114129_101193472 193
438 3300009147 Ga0114129_10232391 Ga0114129_102323912 193
439 3300009147 Ga0114129_10273784 Ga0114129_102737842 193
440 3300009147 Ga0114129_10574426 Ga0114129_105744262 193
441 3300009148 Ga0105243_10285133 Ga0105243_102851332 193
442 3300009553 Ga0105249_10082436 Ga0105249_100824363 193
443 3300009553 Ga0105249_10984313 Ga0105249_109843132 193
444 3300009553 Ga0105249_11010074 Ga0105249_110100742 193
445 3300010375 Ga0105239_11297894 Ga0105239_112978942 193
446 3300013102 Ga0157371_10324448 Ga0157371_103244482 193
447 3300013307 Ga0157372_10072881 Ga0157372_100728814 193
448 3300025906 Ga0207699_10229099 Ga0207699_102290993 193
449 3300025907 Ga0207645_10117004 Ga0207645_101170043 193
450 3300025910 Ga0207684_10019692 Ga0207684_100196924 193
451 3300025910 Ga0207684_10073541 Ga0207684_100735413 193
452 3300025910 Ga0207684_10108911 Ga0207684_101089111 193
453 3300025910 Ga0207684_10251823 Ga0207684_102518232 193
454 3300025910 Ga0207684_10509497 Ga0207684_105094971 193
455 3300025912 Ga0207707_10283306 Ga0207707_102833062 193
456 3300025915 Ga0207693_10186612 Ga0207693_101866122 193
457 3300025917 Ga0207660_10127028 Ga0207660_101270282 193
458 3300025921 Ga0207652_10097233 Ga0207652_100972332 193
459 3300025922 Ga0207646_10028619 Ga0207646_100286193 193
460 3300025922 Ga0207646_10035039 Ga0207646_100350394 193
461 3300025922 Ga0207646_10084314 Ga0207646_100843142 193
462 3300025922 Ga0207646_10108278 Ga0207646_101082782 193
463 3300025933 Ga0207706_10323362 Ga0207706_103233622 193
464 3300025938 Ga0207704_10421945 Ga0207704_104219452 193
465 3300025939 Ga0207665_10114297 Ga0207665_101142973 193
466 3300025942 Ga0207689_10074531 Ga0207689_100745313 193
467 3300027378 Ga0209981_1000490 Ga0209981_10004904 193
468 3300027395 Ga0209996_1000338 Ga0209996_10003384 193
469 3300027424 Ga0209984_1015316 Ga0209984_10153161 193
470 3300027526 Ga0209968_1000579 Ga0209968_10005794 193
471 3300027543 Ga0209999_1000243 Ga0209999_100024310 193
472 3300027552 Ga0209982_1001041 Ga0209982_10010413 193
473 3300027665 Ga0209983_1000034 Ga0209983_10000348 193
474 3300027682 Ga0209971_1000028 Ga0209971_100002813 193
475 3300027682 Ga0209971_1005708 Ga0209971_10057082 193
476 3300027695 Ga0209966_1000073 Ga0209966_10000735 193
477 3300027695 Ga0209966_1009155 Ga0209966_10091551 193
478 3300027717 Ga0209998_10000001 Ga0209998_10000001153 193
479 3300027876 Ga0209974_10000369 Ga0209974_100003698 193
480 3300027876 Ga0209974_10015144 Ga0209974_100151443 193
481 3300027907 Ga0207428_10000176 Ga0207428_1000017681 193
482 3300027907 Ga0207428_10141454 Ga0207428_101414542 193
483 3300028380 Ga0268265_10088185 Ga0268265_100881852 193
484 3300028381 Ga0268264_11014898 Ga0268264_110148982 193
485 3300031548 Ga0307408_100034524 Ga0307408_1000345243 193
486 3300032002 Ga0307416_101979282 Ga0307416_1019792821 193
487 3300035084 Ga0373928_0075756 Ga0373928_0075756_138_719 193
488 3300035085 Ga0373929_0145897 Ga0373929_0145897_15_596 193
489 3300035090 Ga0373949_0034097 Ga0373949_0034097_90_671 193
490 3300035112 Ga0373932_0003143 Ga0373932_0003143_3379_3960 193
491 3300035114 Ga0373939_0007077 Ga0373939_0007077_1211_1792 193
492 3300035115 Ga0373941_0062149 Ga0373941_0062149_55_636 193
493 3300035242 Ga0373962_0064142 Ga0373962_0064142_129_710 193
494 3300035691 Ga0373931_0008836 Ga0373931_0008836_2302_2883 193
495 3300035691 Ga0373931_0081418 Ga0373931_0081418_493_1074 193
496 3300037312 Ga0395899_0005401 Ga0395899_0005401_5795_6376 193
497 3300037418 Ga0395900_0038990 Ga0395900_0038990_161_742 193
498 3300038443 Ga0395901_0103437 Ga0395901_0103437_42_623 193
499 3300042008 Ga0439450_116358 Ga0439450_116358_66_647 193
500 3300042012 Ga0439455_0013689 Ga0439455_0013689_159_740 193
501 3300042435 Ga0439434_0053749 Ga0439434_0053749_444_1025 193
502 3300042461 Ga0439460_0001203 Ga0439460_0001203_767_1348 193
503 3300042876 Ga0451577_0035839 Ga0451577_0035839_1087_1668 193
504 3300042876 Ga0451577_0351582 Ga0451577_0351582_492_1073 193
505 3300042876 Ga0451577_0411462 Ga0451577_0411462_103_684 193
506 3300042876 Ga0451577_0559300 Ga0451577_0559300_36_617 193
507 3300045051 Ga0451576_0024239 Ga0451576_0024239_1914_2495 193
508 3300045051 Ga0451576_0026201 Ga0451576_0026201_2501_3082 193
509 3300045051 Ga0451576_0263638 Ga0451576_0263638_96_677 193
510 3300045051 Ga0451576_0278038 Ga0451576_0278038_87_668 193
511 3300046472 Ga0495580_0029596 Ga0495580_0029596_2042_2623 193
512 3300046528 Ga0495642_0088081 Ga0495642_0088081_311_892 193
513 3300046538 Ga0495609_0203461 Ga0495609_0203461_28_609 193
514 3300046684 Ga0495669_0152784 Ga0495669_0152784_72_653 193
515 3300048905 Ga0496102_0001871 Ga0496102_0001871_3936_4517 193
516 3300048911 Ga0496108_0361939 Ga0496108_0361939_88_669 193
517 3300049568 Ga0501031_0090122 Ga0501031_0090122_854_1435 193
518 3300049568 Ga0501031_0193282 Ga0501031_0193282_526_1107 193
519 3300049572 Ga0501036_0025187 Ga0501036_0025187_1307_1888 193
520 3300049572 Ga0501036_0710671 Ga0501036_0710671_228_809 193
521 3300049574 Ga0501038_0110847 Ga0501038_0110847_774_1355 193
522 3300049574 Ga0501038_0197507 Ga0501038_0197507_865_1446 193
523 3300049574 Ga0501038_0597343 Ga0501038_0597343_145_726 193
524 3300049575 Ga0501039_0164062 Ga0501039_0164062_158_739 193
525 3300049575 Ga0501039_0201418 Ga0501039_0201418_716_1297 193
526 3300049575 Ga0501039_0336090 Ga0501039_0336090_105_686 193
527 3300049576 Ga0501040_0016619 Ga0501040_0016619_1652_2233 193
528 3300049576 Ga0501040_0055533 Ga0501040_0055533_1551_2132 193
529 3300049576 Ga0501040_0067285 Ga0501040_0067285_1287_1868 193
530 3300049576 Ga0501040_0177175 Ga0501040_0177175_707_1288 193
531 3300049576 Ga0501040_0204399 Ga0501040_0204399_46_627 193
532 3300049576 Ga0501040_0266368 Ga0501040_0266368_125_706 193
533 3300049577 Ga0501041_0031877 Ga0501041_0031877_1224_1805 193
534 3300049578 Ga0501042_0071625 Ga0501042_0071625_1102_1683 193
535 3300049580 Ga0501046_0162774 Ga0501046_0162774_546_1127 193
536 3300049580 Ga0501046_0502094 Ga0501046_0502094_27_608 193
537 3300049582 Ga0501048_0021144 Ga0501048_0021144_2590_3171 193
538 3300049582 Ga0501048_0044237 Ga0501048_0044237_2163_2744 193
539 3300049584 Ga0501068_0047035 Ga0501068_0047035_1547_2128 193
540 3300049586 Ga0501070_0316882 Ga0501070_0316882_320_901 193
541 3300049587 Ga0501071_0096534 Ga0501071_0096534_605_1186 193
542 3300049587 Ga0501071_0602815 Ga0501071_0602815_163_744 193
543 3300049588 Ga0501072_0015809 Ga0501072_0015809_293_874 193
544 3300049588 Ga0501072_0025773 Ga0501072_0025773_2206_2787 193
545 3300049588 Ga0501072_0054150 Ga0501072_0054150_367_948 193
546 3300049588 Ga0501072_0124331 Ga0501072_0124331_294_875 193
547 3300049588 Ga0501072_0260974 Ga0501072_0260974_751_1332 193
548 3300049588 Ga0501072_0380619 Ga0501072_0380619_277_858 193
549 3300049590 Ga0501074_0021260 Ga0501074_0021260_3307_3888 193
550 3300049590 Ga0501074_0080958 Ga0501074_0080958_411_992 193
551 3300049590 Ga0501074_0505234 Ga0501074_0505234_83_664 193
552 3300049591 Ga0501075_0014948 Ga0501075_0014948_4078_4659 193
553 3300049591 Ga0501075_0076992 Ga0501075_0076992_1278_1859 193
554 3300049591 Ga0501075_0104215 Ga0501075_0104215_1252_1833 193
555 3300049591 Ga0501075_0186754 Ga0501075_0186754_324_905 193
556 3300049591 Ga0501075_0298672 Ga0501075_0298672_396_977 193
557 3300049592 Ga0501076_0019643 Ga0501076_0019643_578_1159 193
558 3300049592 Ga0501076_0024534 Ga0501076_0024534_3351_3932 193
559 3300049592 Ga0501076_0065644 Ga0501076_0065644_415_996 193
560 3300049592 Ga0501076_0109288 Ga0501076_0109288_869_1450 193
561 3300049592 Ga0501076_0110518 Ga0501076_0110518_1625_2206 193
562 3300049592 Ga0501076_0471809 Ga0501076_0471809_52_633 193
563 3300049593 Ga0501077_0009924 Ga0501077_0009924_1525_2106 193
564 3300049593 Ga0501077_0118791 Ga0501077_0118791_967_1548 193
565 3300049741 Ga0501079_0017090 Ga0501079_0017090_4098_4679 193
566 3300049741 Ga0501079_0018925 Ga0501079_0018925_3028_3609 193
567 3300049741 Ga0501079_0043772 Ga0501079_0043772_2401_2982 193
568 3300049741 Ga0501079_0436105 Ga0501079_0436105_134_715 193
569 3300049742 Ga0501080_0122207 Ga0501080_0122207_551_1132 193
570 3300049743 Ga0501081_0001033 Ga0501081_0001033_13889_14470 193
571 3300049743 Ga0501081_0021956 Ga0501081_0021956_1250_1831 193
572 3300049743 Ga0501081_0036313 Ga0501081_0036313_1528_2109 193
573 3300049743 Ga0501081_0112229 Ga0501081_0112229_994_1575 193
574 3300049743 Ga0501081_0324469 Ga0501081_0324469_78_659 193
575 3300049743 Ga0501081_0618435 Ga0501081_0618435_33_614 193
576 3300049743 Ga0501081_0881902 Ga0501081_0881902_82_663 193
577 3300049744 Ga0501083_0113204 Ga0501083_0113204_303_884 193
578 3300049744 Ga0501083_0240779 Ga0501083_0240779_290_871 193
579 3300049824 Ga0501045_0073786 Ga0501045_0073786_919_1500 193
580 3300049824 Ga0501045_0156523 Ga0501045_0156523_882_1463 193
581 3300049824 Ga0501045_0485680 Ga0501045_0485680_182_763 193
582 3300049824 Ga0501045_0550117 Ga0501045_0550117_257_838 193
583 3300050507 nmdc:mga05p37_14582_c1 nmdc:mga05p37_14582_c1_7450_8031 193
584 3300050507 nmdc:mga05p37_189936_c1 nmdc:mga05p37_189936_c1_127_708 193
585 3300050507 nmdc:mga05p37_21565_c1 nmdc:mga05p37_21565_c1_5847_6428 193
586 3300050507 nmdc:mga05p37_218253_c1 nmdc:mga05p37_218253_c1_76_657 193
587 3300050507 nmdc:mga05p37_28205_c1 nmdc:mga05p37_28205_c1_4354_4935 193
588 3300050507 nmdc:mga05p37_3396_c1 nmdc:mga05p37_3396_c1_651_1232 193
589 3300050507 nmdc:mga05p37_35596_c1 nmdc:mga05p37_35596_c1_3523_4104 193
590 3300050507 nmdc:mga05p37_37629_c1 nmdc:mga05p37_37629_c1_5273_5854 193
591 3300050507 nmdc:mga05p37_413792_c1 nmdc:mga05p37_413792_c1_732_1313 193
592 3300050507 nmdc:mga05p37_65962_c1 nmdc:mga05p37_65962_c1_3599_4180 193
593 3300050507 nmdc:mga05p37_85453_c1 nmdc:mga05p37_85453_c1_1733_2314 193
594 3300050508 nmdc:mga09592_36258_c1 nmdc:mga09592_36258_c1_459_1040 193
595 3300050508 nmdc:mga09592_41843_c1 nmdc:mga09592_41843_c1_424_1005 193
596 3300050508 nmdc:mga09592_6345_c1 nmdc:mga09592_6345_c1_7099_7680 193
597 3300050508 nmdc:mga09592_837_c1 nmdc:mga09592_837_c1_4084_4665 193
598 3300050509 nmdc:mga0qj67_22992_c1 nmdc:mga0qj67_22992_c1_3514_4095 193
599 3300050509 nmdc:mga0qj67_343_c1 nmdc:mga0qj67_343_c1_23810_24391 193
600 3300050509 nmdc:mga0qj67_43339_c1 nmdc:mga0qj67_43339_c1_1811_2392 193
601 3300050509 nmdc:mga0qj67_798_c1 nmdc:mga0qj67_798_c1_7250_7831 193
602 3300050510 nmdc:mga06r32_10348_c1 nmdc:mga06r32_10348_c1_3295_3876 193
603 3300050510 nmdc:mga06r32_1324267_c1 nmdc:mga06r32_1324267_c1_41_622 193
604 3300050510 nmdc:mga06r32_32294_c1 nmdc:mga06r32_32294_c1_4041_4622 193
605 3300050510 nmdc:mga06r32_4631_c1 nmdc:mga06r32_4631_c1_5744_6325 193
606 3300050510 nmdc:mga06r32_76392_c1 nmdc:mga06r32_76392_c1_1952_2533 193
607 3300050510 nmdc:mga06r32_87705_c1 nmdc:mga06r32_87705_c1_806_1387 193
608 3300050511 nmdc:mga08y16_2945_c1 nmdc:mga08y16_2945_c1_2135_2716 193
609 3300050512 nmdc:mga0n895_41940_c1 nmdc:mga0n895_41940_c1_2421_3002 193
610 3300050512 nmdc:mga0n895_43098_c1 nmdc:mga0n895_43098_c1_1529_2110 193
611 3300050512 nmdc:mga0n895_61867_c1 nmdc:mga0n895_61867_c1_1835_2416 193
612 3300050512 nmdc:mga0n895_677592_c1 nmdc:mga0n895_677592_c1_389_970 193
613 3300050512 nmdc:mga0n895_735924_c1 nmdc:mga0n895_735924_c1_302_883 193
614 3300050513 nmdc:mga0rr50_33149_c1 nmdc:mga0rr50_33149_c1_626_1207 193
615 3300050513 nmdc:mga0rr50_389073_c1 nmdc:mga0rr50_389073_c1_510_1091 193
616 3300050513 nmdc:mga0rr50_551275_c1 nmdc:mga0rr50_551275_c1_391_972 193
617 3300050513 nmdc:mga0rr50_599997_c1 nmdc:mga0rr50_599997_c1_19_600 193
618 3300050514 nmdc:mga08x19_153171_c1 nmdc:mga08x19_153171_c1_164_745 193
619 3300050514 nmdc:mga08x19_384020_c1 nmdc:mga08x19_384020_c1_209_790 193
620 3300050514 nmdc:mga08x19_4220_c1 nmdc:mga08x19_4220_c1_2059_2640 193
621 3300050515 nmdc:mga0a205_156982_c1 nmdc:mga0a205_156982_c1_698_1279 193
622 3300050515 nmdc:mga0a205_205119_c1 nmdc:mga0a205_205119_c1_941_1522 193
623 3300050515 nmdc:mga0a205_432933_c1 nmdc:mga0a205_432933_c1_36_617 193
624 3300050515 nmdc:mga0a205_5896_c1 nmdc:mga0a205_5896_c1_5231_5812 193
625 3300054114 Ga0501084_0621423 Ga0501084_0621423_226_807 193
626 3300059421 Ga0590071_010281 Ga0590071_010281_295_876 193
627 3300060353 Ga0501082_0190196 Ga0501082_0190196_740_1321 193
628 3300060353 Ga0501082_0229789 Ga0501082_0229789_348_929 193
629 3300060353 Ga0501082_0276776 Ga0501082_0276776_78_659 193
630 3300060353 Ga0501082_0494565 Ga0501082_0494565_469_1050 193
631 3300061734 Ga0530510_0015625 Ga0530510_0015625_453_1034 193
632 3300061734 Ga0530510_0839864 Ga0530510_0839864_82_663 193
633 3300005353 Ga0070669_100277262 Ga0070669_1002772622 194
634 3300005440 Ga0070705_100438821 Ga0070705_1004388212 194
635 3300005445 Ga0070708_100016216 Ga0070708_1000162166 194
636 3300005455 Ga0070663_100767945 Ga0070663_1007679451 194
637 3300005459 Ga0068867_100491618 Ga0068867_1004916182 194
638 3300005467 Ga0070706_100077558 Ga0070706_1000775582 194
639 3300005471 Ga0070698_100014980 Ga0070698_1000149802 194
640 3300005536 Ga0070697_100090842 Ga0070697_1000908421 194
641 3300005536 Ga0070697_100930803 Ga0070697_1009308031 194
642 3300005546 Ga0070696_100579039 Ga0070696_1005790391 194
643 3300006844 Ga0075428_100000924 Ga0075428_10000092420 194
644 3300006844 Ga0075428_100054921 Ga0075428_1000549212 194
645 3300006846 Ga0075430_100177697 Ga0075430_1001776972 194
646 3300006847 Ga0075431_100002229 Ga0075431_10000222915 194
647 3300006852 Ga0075433_10006420 Ga0075433_100064204 194
648 3300006871 Ga0075434_100022146 Ga0075434_1000221465 194
649 3300006880 Ga0075429_100107459 Ga0075429_1001074592 194
650 3300006914 Ga0075436_100001157 Ga0075436_1000011576 194
651 3300007076 Ga0075435_100015296 Ga0075435_1000152965 194
652 3300009094 Ga0111539_10082769 Ga0111539_100827693 194
653 3300009147 Ga0114129_10000115 Ga0114129_1000011555 194
654 3300009147 Ga0114129_10001631 Ga0114129_100016313 194
655 3300009147 Ga0114129_10102712 Ga0114129_101027123 194
656 3300009176 Ga0105242_10589273 Ga0105242_105892732 194
657 3300013100 Ga0157373_10205914 Ga0157373_102059142 194
658 3300013297 Ga0157378_10933805 Ga0157378_109338052 194
659 3300013306 Ga0163162_10015647 Ga0163162_100156473 194
660 3300013308 Ga0157375_10255141 Ga0157375_102551412 194
661 3300025910 Ga0207684_10000115 Ga0207684_1000011510 194
662 3300025911 Ga0207654_10190036 Ga0207654_101900362 194
663 3300025922 Ga0207646_10003851 Ga0207646_100038519 194
664 3300025931 Ga0207644_10203632 Ga0207644_102036322 194
665 3300025935 Ga0207709_10127879 Ga0207709_101278792 194
666 3300025972 Ga0207668_10196221 Ga0207668_101962212 194
667 3300026088 Ga0207641_10192178 Ga0207641_101921783 194
668 3300026089 Ga0207648_10153126 Ga0207648_101531262 194
669 3300026118 Ga0207675_100132891 Ga0207675_1001328913 194
670 3300027462 Ga0210000_1008761 Ga0210000_10087612 194
671 3300027907 Ga0207428_10123151 Ga0207428_101231513 194
672 3300046472 Ga0495580_0277844 Ga0495580_0277844_125_709 194
673 3300046499 Ga0495594_0214590 Ga0495594_0214590_155_739 194
674 3300046615 Ga0495656_0070364 Ga0495656_0070364_548_1132 194
675 3300046664 Ga0495659_0054774 Ga0495659_0054774_807_1391 194
676 3300046684 Ga0495669_0032522 Ga0495669_0032522_675_1259 194
677 3300046684 Ga0495669_0141691 Ga0495669_0141691_356_940 194
678 3300048909 Ga0496106_0239711 Ga0496106_0239711_586_1170 194
679 3300049570 Ga0501033_0225203 Ga0501033_0225203_196_780 194
680 3300049572 Ga0501036_0448893 Ga0501036_0448893_90_674 194
681 3300049574 Ga0501038_0100011 Ga0501038_0100011_716_1300 194
682 3300049575 Ga0501039_0311493 Ga0501039_0311493_196_780 194
683 3300049576 Ga0501040_0006783 Ga0501040_0006783_6821_7405 194
684 3300049577 Ga0501041_0041434 Ga0501041_0041434_447_1031 194
685 3300049578 Ga0501042_0007739 Ga0501042_0007739_2176_2760 194
686 3300049580 Ga0501046_0002061 Ga0501046_0002061_1549_2133 194
687 3300049581 Ga0501047_0056714 Ga0501047_0056714_2169_2753 194
688 3300049582 Ga0501048_0058521 Ga0501048_0058521_311_895 194
689 3300049584 Ga0501068_0064635 Ga0501068_0064635_340_924 194
690 3300049587 Ga0501071_0186637 Ga0501071_0186637_144_728 194
691 3300049587 Ga0501071_0219441 Ga0501071_0219441_527_1111 194
692 3300049588 Ga0501072_0116890 Ga0501072_0116890_1298_1882 194
693 3300049590 Ga0501074_0019321 Ga0501074_0019321_2995_3579 194
694 3300049591 Ga0501075_0097421 Ga0501075_0097421_1108_1692 194
695 3300049592 Ga0501076_0021226 Ga0501076_0021226_1522_2106 194
696 3300049592 Ga0501076_0270085 Ga0501076_0270085_777_1361 194
697 3300049593 Ga0501077_0086190 Ga0501077_0086190_209_793 194
698 3300049741 Ga0501079_0001185 Ga0501079_0001185_15816_16400 194
699 3300049741 Ga0501079_0218232 Ga0501079_0218232_448_1032 194
700 3300049742 Ga0501080_0318970 Ga0501080_0318970_551_1135 194
701 3300049743 Ga0501081_0016788 Ga0501081_0016788_376_960 194
702 3300049744 Ga0501083_0031778 Ga0501083_0031778_528_1112 194
703 3300050507 nmdc:mga05p37_23238_c1 nmdc:mga05p37_23238_c1_987_1571 194
704 3300050507 nmdc:mga05p37_331825_c1 nmdc:mga05p37_331825_c1_84_668 194
705 3300050507 nmdc:mga05p37_89_c1 nmdc:mga05p37_89_c1_59581_60165 194
706 3300050508 nmdc:mga09592_1406_c1 nmdc:mga09592_1406_c1_17259_17843 194
707 3300050509 nmdc:mga0qj67_130140_c1 nmdc:mga0qj67_130140_c1_1095_1679 194
708 3300050510 nmdc:mga06r32_523226_c1 nmdc:mga06r32_523226_c1_335_919 194
709 3300050510 nmdc:mga06r32_654930_c1 nmdc:mga06r32_654930_c1_337_921 194
710 3300050511 nmdc:mga08y16_108945_c1 nmdc:mga08y16_108945_c1_816_1400 194
711 3300050512 nmdc:mga0n895_1302219_c1 nmdc:mga0n895_1302219_c1_57_683 194
712 3300050512 nmdc:mga0n895_203_c1 nmdc:mga0n895_203_c1_20357_20941 194
713 3300050512 nmdc:mga0n895_647060_c1 nmdc:mga0n895_647060_c1_282_866 194
714 3300050513 nmdc:mga0rr50_694_c1 nmdc:mga0rr50_694_c1_13715_14299 194
715 3300050514 nmdc:mga08x19_470_c1 nmdc:mga08x19_470_c1_13723_14307 194
716 3300050515 nmdc:mga0a205_58667_c1 nmdc:mga0a205_58667_c1_633_1217 194
717 3300054114 Ga0501084_0394375 Ga0501084_0394375_416_1003 194
718 3300060353 Ga0501082_0064057 Ga0501082_0064057_1807_2391 194
719 3300061734 Ga0530510_0046999 Ga0530510_0046999_1006_1590 194
720 3300005468 Ga0070707_100002097 Ga0070707_10000209717 197
721 3300025910 Ga0207684_10159932 Ga0207684_101599322 197
722 3300025922 Ga0207646_10014285 Ga0207646_100142856 197
723 3300006844 Ga0075428_100561473 Ga0075428_1005614732 201
724 3300006846 Ga0075430_100191515 Ga0075430_1001915151 201
725 3300006880 Ga0075429_100144173 Ga0075429_1001441732 201
726 3300009147 Ga0114129_10079508 Ga0114129_100795084 201
727 3300050507 nmdc:mga05p37_141781_c1 nmdc:mga05p37_141781_c1_1224_1829 201
728 3300050508 nmdc:mga09592_21339_c1 nmdc:mga09592_21339_c1_4286_4891 201
729 3300050510 nmdc:mga06r32_181961_c1 nmdc:mga06r32_181961_c1_1339_1944 201
730 3300003203 JGI25406J46586_10017390 JGI25406J46586_100173904 205
731 3300005985 Ga0081539_10000005 Ga0081539_10000005382 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05683

Fumerase_C

Fumarase C-terminus

1

187

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uq8-assembly1.cif.gz_B crystal structure of r421a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate and malonate 0.9376 30 192
6uq9-assembly1.cif.gz_B crystal structure of r421a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate 0.9376 30 192
6uqm-assembly1.cif.gz_B crystal structure of r173a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate 0.9374 30 192
6uqn-assembly1.cif.gz_B crystal structure of r173a variant of cytosolic fumarate hydratase from leishmania major in a complex with fumarate and s-malate 0.9363 30 192
6uqb-assembly1.cif.gz_A crystal structure of r471a variant of cytosolic fumarate hydratase from leishmania major in a complex with s-malate and malonate 0.9357 30 192
ID Description Score Start End Superfamily
af_E9AH43_359_548_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.9374 30 193 3.20.130.10
1vpjA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.9278 23 192 3.20.130.10
5dniA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.9178 23 192 3.20.130.10
1vpjA00 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.9017 23 192 3.20.130.10
af_P0AC35_1_176_3.20.130.10 Alpha Beta;Alpha-Beta Barrel;fumarase;Fe-S hydro-lyase, tartrate dehydratase beta-type, catalytic domain 0.8892 23 191 3.20.130.10
ID Description Score Start End GO Terms
AF-A0A2V7FHV7-F1-model_v4 TRZ/ATZ family protein 0.9965 23 135 GO:0016836
AF-A0A2V6WXE7-F1-model_v4 TRZ/ATZ family protein 0.9928 29 191 GO:0016836
AF-A0A2V6ZFZ3-F1-model_v4 Fe-S-containing hydro-lyase 0.99 13 200 GO:0016836
AF-A0A2V6SD42-F1-model_v4 TRZ/ATZ family protein 0.9882 23 200 GO:0016836
AF-A0A1V5BMI2-F1-model_v4 Fumarate hydratase class I, anaerobic (EC 4.2.1.2) 0.988 23 199 GO:0004333
GO:0008730

Feature Viewer

pLDDT pTM Quality
88.72 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map