F478010

General Info

Members Datasets Scaffolds Average Seq Length
732 379 1465 454

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100063204|Ga0070706_1000632042
Length 531
Sequence MGLLRTFPRGGVGILRGGCGRAKGSGACTIPGDLKSVAILVDASGREEQPLRAASARNKQDGQSRSATKLSSLDPVDRAVASGLERTGRFVNRHPRSITSAVMLALAGFGATAFGIAPLAPDAADLPSRIVTENVTPESIDSQLEALAAHELELYRSDLTRASDTADSLLRRLNVDDAQAAGFVRSDAAARRLLAGRAGKMVQVRTGANGELEELVARYAADNTEQFATHFTRLRITRAGGKFQTSVETAPLAAQVRLGSGTIRNSLFAATDEAHIPDAVASQIAEIFATDVDFHRELRRGDSFRVIYEALTADGEPITWNQSSGRVMAAEFINNGKTYTAVWFKDASGKGGYFDMNGQSKRRSFLAAPLEFSRVTSGFAMRFHPILQTWKQHNGVDYGAPSGTPVRTVGDGTVDFAGWQNGYGNVVSIKHSNDRSTVYAHLSRVDVRRGQHVDQGMRIGAVGMTGWATGPHLHFEVKQHGMQQNPLTIAKASETLTIAPAAKPQFAQLAQGVRAQLDAAQTVAGSAMYAE

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
13 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
17 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
36 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
37 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
38 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
68 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
81 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
107 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
108 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
116 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
117 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
118 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
121 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
122 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
128 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
180 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
181 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
189 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
190 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
191 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
192 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
193 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
194 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
195 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
196 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
197 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
198 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
199 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
202 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
203 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
204 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
205 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
206 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
207 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
208 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
216 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
223 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
224 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
228 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
229 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
232 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
233 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
234 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
235 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
236 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
237 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
238 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
239 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
240 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
241 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
242 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
243 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
244 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
245 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
248 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
249 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
250 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
251 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
252 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
253 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
254 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
255 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
256 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
259 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
260 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
261 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
262 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
263 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
264 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
265 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
266 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
267 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
268 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
269 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
270 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
271 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
274 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
275 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
278 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
279 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
280 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
281 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
289 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
294 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
295 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
304 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
307 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
308 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
309 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
310 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
311 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
320 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
321 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
322 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
323 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
325 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
326 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
327 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
328 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
329 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
330 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
331 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
332 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
333 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
334 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
339 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
340 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
341 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
342 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
343 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
344 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
345 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
346 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
347 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
348 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
349 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
350 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
351 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
353 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
354 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
355 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
356 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
357 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
358 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
359 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
360 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
361 2643221660 Methylibium sp. Root1272 Isolate Unclassified
362 2721755523 Delftia sp. HK171 Isolate Unclassified
363 2738543013 Variovorax sp. BT01 Isolate Unclassified
364 2831864461 Roseateles noduli HZ7 Isolate Nodule
365 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
366 2842677519 Variovorax sp. R-72495 Isolate Unclassified
367 2842733646 Variovorax sp. R-72446 Isolate Unclassified
368 2842747753 Variovorax sp. R-72060 Isolate Unclassified
369 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
370 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
371 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
372 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
373 2904456579 Variovorax sp. 2002 Isolate Unclassified
374 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
375 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
376 2929520902 Variovorax beijingensis 502 Isolate Unclassified
377 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
378 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
379 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.9
Metatranscriptomes 0.41
Isolates 3.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.17
Nodule 0.82
Rhizoplane 2.87
Rhizosphere 67.08
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100063204 3300005467 Bacteria 3421
2 JGI25156J39149_1002558 3300002705 Bacteria 6454
3 JGI25154J39366_1004695 3300002738 Bacteria 2366
4 JGI25157J39369_1000267 3300002741 Bacteria 38232
5 JGI25153J46596_10002860 3300003215 Bacteria 9807
6 rootH1_10012758 3300003316 Bacteria 8702
7 rootH1_10012758 3300003323 Bacteria 4964
8 rootH1_10083585 3300003316 Bacteria 3863
9 rootL2_10003381 3300003322 Bacteria 63123
10 rootL2_10087698 3300003322 Bacteria 3532
11 rootL2_10106425 3300003322 Bacteria 3907
12 rootH1_10013830 3300003323 Bacteria 3134
13 rootH1_10060360 3300003323 Bacteria 2463
14 rootH1_10069288 3300003323 Bacteria 2808
15 Ga0006562J51391_1042152 3300003578 Bacteria 3520
16 Ga0055539_1000550 3300003752 Bacteria 10874
17 Ga0055539_1001108 3300003752 Bacteria 5590
18 Ga0055533_1000045 3300003756 Bacteria 223637
19 Ga0055525_1000004 3300003759 Bacteria 888039
20 Ga0055525_1000632 3300003759 Bacteria 14353
21 Ga0055535_1000047 3300003761 Bacteria 139836
22 Ga0055529_1000148 3300003763 Bacteria 100809
23 Ga0055526_1001509 3300003771 Bacteria 16488
24 Ga0055526_1002656 3300003771 Bacteria 11933
25 Ga0055524_1000247 3300003775 Bacteria 56379
26 Ga0055524_1002449 3300003775 Bacteria 9548
27 Ga0055524_1003709 3300003775 Bacteria 7308
28 Ga0055534_1002527 3300003784 Bacteria 6276
29 Ga0055530_10003306 3300003791 Bacteria 9321
30 Ga0055540_1000260 3300003792 Bacteria 47714
31 Ga0055540_1006264 3300003792 Bacteria 4762
32 Ga0055540_1008623 3300003792 Bacteria 3649
33 Ga0055531_10004940 3300003794 Bacteria 7929
34 Ga0055531_10008285 3300003794 Bacteria 5520
35 Ga0055531_10009185 3300003794 Bacteria 5090
36 Ga0055543_1004417 3300004625 Bacteria 3851
37 Ga0065165_1000290 3300005262 Bacteria 85623
38 Ga0065165_1001688 3300005262 Bacteria 22283
39 Ga0065165_1005747 3300005262 Bacteria 6812
40 Ga0065714_10010259 3300005288 Bacteria 5056
41 Ga0070690_100004054 3300005330 Bacteria 8110
42 Ga0070690_100027300 3300005330 Bacteria 3529
43 Ga0070670_100005551 3300005331 Bacteria 10640
44 Ga0070670_100006917 3300005331 Bacteria 9615
45 Ga0070670_100010262 3300005331 Bacteria 7992
46 Ga0070670_100026772 3300005331 Bacteria 4960
47 Ga0070670_100044235 3300005331 Bacteria 3829
48 Ga0070670_100105924 3300005331 Bacteria 2423
49 Ga0070670_100118273 3300005331 Bacteria 2285
50 Ga0068869_100024040 3300005334 Bacteria 4218
51 Ga0070666_10032453 3300005335 Bacteria 3449
52 Ga0070680_100025814 3300005336 Bacteria 4697
53 Ga0068868_100022196 3300005338 Bacteria 4788
54 Ga0068868_100079731 3300005338 Bacteria 2623
55 Ga0068868_100111977 3300005338 Bacteria 2218
56 Ga0070660_100015360 3300005339 Bacteria 5525
57 Ga0070660_100023302 3300005339 Bacteria 4586
58 Ga0070660_100026833 3300005339 Bacteria 4292
59 Ga0070689_100012386 3300005340 Bacteria 6142
60 Ga0070691_10053453 3300005341 Bacteria 1932
61 Ga0070687_100013556 3300005343 Bacteria 3636
62 Ga0070661_100000361 3300005344 Bacteria 35932
63 Ga0070661_100025217 3300005344 Bacteria 4272
64 Ga0070692_10043595 3300005345 Bacteria 2308
65 Ga0070668_100003480 3300005347 Bacteria 11615
66 Ga0070668_100111676 3300005347 Bacteria 2176
67 Ga0070668_100112479 3300005347 Bacteria 2168
68 Ga0070669_100002701 3300005353 Bacteria 12795
69 Ga0070669_100013341 3300005353 Bacteria 5840
70 Ga0070675_100000703 3300005354 Bacteria 23209
71 Ga0070675_100002723 3300005354 Bacteria 13282
72 Ga0070675_100012549 3300005354 Bacteria 6642
73 Ga0070675_100034117 3300005354 Bacteria 4128
74 Ga0070675_100189509 3300005354 Bacteria 1781
75 Ga0070671_100002088 3300005355 Bacteria 15388
76 Ga0070671_100004115 3300005355 Bacteria 11486
77 Ga0070671_100018389 3300005355 Bacteria 5676
78 Ga0070671_100026675 3300005355 Bacteria 4751
79 Ga0070674_100001813 3300005356 Bacteria 11593
80 Ga0070674_100004415 3300005356 Bacteria 8019
81 Ga0070674_100004918 3300005356 Bacteria 7656
82 Ga0070674_100034797 3300005356 Bacteria 3367
83 Ga0070673_100009469 3300005364 Bacteria 6538
84 Ga0070673_100015757 3300005364 Bacteria 5321
85 Ga0070673_100040286 3300005364 Bacteria 3583
86 Ga0070673_100055040 3300005364 Bacteria 3133
87 Ga0070659_100001606 3300005366 Bacteria 16262
88 Ga0070659_100164693 3300005366 Bacteria 1814
89 Ga0070659_100188672 3300005366 Bacteria 1694
90 Ga0070659_100195089 3300005366 Bacteria 1665
91 Ga0070667_100006775 3300005367 Bacteria 9512
92 Ga0070667_100008119 3300005367 Bacteria 8705
93 Ga0070667_100036643 3300005367 Bacteria 4113
94 Ga0070663_100098121 3300005455 Bacteria 2182
95 Ga0070678_100009710 3300005456 Bacteria 5846
96 Ga0070678_100013404 3300005456 Bacteria 5139
97 Ga0070678_100051450 3300005456 Bacteria 2986
98 Ga0070678_100122314 3300005456 Bacteria 2054
99 Ga0070662_100022134 3300005457 Bacteria 4347
100 Ga0070662_100075344 3300005457 Bacteria 2498
101 Ga0070681_10062170 3300005458 Bacteria 3708
102 Ga0070681_10139067 3300005458 Bacteria 2358
103 Ga0068867_100000120 3300005459 Bacteria 49908
104 Ga0068867_100002943 3300005459 Bacteria 11989
105 Ga0068867_100007438 3300005459 Bacteria 7746
106 Ga0068867_100054036 3300005459 Bacteria 2967
107 Ga0070679_100013044 3300005530 Bacteria 7957
108 Ga0070679_100062147 3300005530 Bacteria 3723
109 Ga0070672_100000177 3300005543 Bacteria 35110
110 Ga0070672_100005324 3300005543 Bacteria 8521
111 Ga0070672_100006490 3300005543 Bacteria 7862
112 Ga0070672_100020259 3300005543 Bacteria 4847
113 Ga0070672_100027809 3300005543 Bacteria 4222
114 Ga0070672_100079594 3300005543 Bacteria 2623
115 Ga0070672_100123912 3300005543 Bacteria 2118
116 Ga0070665_100009614 3300005548 Bacteria 9781
117 Ga0068855_100007548 3300005563 Bacteria 13156
118 Ga0068855_100048080 3300005563 Bacteria 5036
119 Ga0068855_100069769 3300005563 Bacteria 4089
120 Ga0068855_100072373 3300005563 Bacteria 4007
121 Ga0068855_100268088 3300005563 Bacteria 1900
122 Ga0068855_100275571 3300005563 Bacteria 1870
123 Ga0070664_100001095 3300005564 Bacteria 21389
124 Ga0070664_100043654 3300005564 Bacteria 3784
125 Ga0068857_100005597 3300005577 Bacteria 10734
126 Ga0068857_100040785 3300005577 Bacteria 4115
127 Ga0068857_100056953 3300005577 Bacteria 3469
128 Ga0068854_100006801 3300005578 Bacteria 7289
129 Ga0068854_100016734 3300005578 Bacteria 4893
130 Ga0068856_100001716 3300005614 Bacteria 22915
131 Ga0068856_100020622 3300005614 Bacteria 6404
132 Ga0068856_100023648 3300005614 Bacteria 5975
133 Ga0068852_100005336 3300005616 Bacteria 9178
134 Ga0068852_100140444 3300005616 Bacteria 2235
135 Ga0068859_100028219 3300005617 Bacteria 5626
136 Ga0068864_100002220 3300005618 Bacteria 16047
137 Ga0068864_100030433 3300005618 Bacteria 4575
138 Ga0068864_100106106 3300005618 Bacteria 2498
139 Ga0068861_100040043 3300005719 Bacteria 3502
140 Ga0068851_10011301 3300005834 Bacteria 4185
141 Ga0068851_10095902 3300005834 Bacteria 1568
142 Ga0068863_100003043 3300005841 Bacteria 16570
143 Ga0068863_100045751 3300005841 Bacteria 4154
144 Ga0068858_100002003 3300005842 Bacteria 20846
145 Ga0068858_100004297 3300005842 Bacteria 14008
146 Ga0068860_100005401 3300005843 Bacteria 12967
147 Ga0068860_100084500 3300005843 Bacteria 3020
148 Ga0068862_100064969 3300005844 Bacteria 3142
149 Ga0068862_100101762 3300005844 Bacteria 2514
150 Ga0075365_10010955 3300006038 Bacteria 5311
151 Ga0075365_10011610 3300006038 Bacteria 5189
152 Ga0075363_100005295 3300006048 Bacteria 5725
153 Ga0075363_100009657 3300006048 Bacteria 4544
154 Ga0075364_10079311 3300006051 Bacteria 2169
155 Ga0075362_10001230 3300006177 Bacteria 8064
156 Ga0075362_10002845 3300006177 Bacteria 5909
157 Ga0075362_10004591 3300006177 Bacteria 4976
158 Ga0075362_10005426 3300006177 Bacteria 4663
159 Ga0075362_10026936 3300006177 Bacteria 2458
160 Ga0075367_10009945 3300006178 Bacteria 4984
161 Ga0075367_10025245 3300006178 Bacteria 3359
162 Ga0075369_10003566 3300006186 Bacteria 5669
163 Ga0075369_10037162 3300006186 Bacteria 2074
164 Ga0075369_10055871 3300006186 Bacteria 1716
165 Ga0075366_10000488 3300006195 Bacteria 18352
166 Ga0075366_10000512 3300006195 Bacteria 17914
167 Ga0075366_10000833 3300006195 Bacteria 14815
168 Ga0075366_10001615 3300006195 Bacteria 11295
169 Ga0075366_10002670 3300006195 Bacteria 9196
170 Ga0075366_10009487 3300006195 Bacteria 5432
171 Ga0075366_10013295 3300006195 Bacteria 4682
172 Ga0075366_10020444 3300006195 Bacteria 3842
173 Ga0075366_10036444 3300006195 Bacteria 2900
174 Ga0075366_10043068 3300006195 Bacteria 2674
175 Ga0075366_10073830 3300006195 Bacteria 2033
176 Ga0097621_100013906 3300006237 Bacteria 6011
177 Ga0075370_10001163 3300006353 Bacteria 11056
178 Ga0075370_10001599 3300006353 Bacteria 9986
179 Ga0075370_10001843 3300006353 Bacteria 9495
180 Ga0075370_10002011 3300006353 Bacteria 9216
181 Ga0075370_10002147 3300006353 Bacteria 9019
182 Ga0075370_10003491 3300006353 Bacteria 7490
183 Ga0075370_10008222 3300006353 Bacteria 5356
184 Ga0075370_10012954 3300006353 Bacteria 4421
185 Ga0068871_100013329 3300006358 Bacteria 6100
186 Ga0068871_100032334 3300006358 Bacteria 4132
187 Ga0075430_100014313 3300006846 Bacteria 6760
188 Ga0075429_100045567 3300006880 Bacteria 3815
189 Ga0068865_100004212 3300006881 Bacteria 8668
190 Ga0068865_100036159 3300006881 Bacteria 3327
191 Ga0068865_100051203 3300006881 Bacteria 2857
192 Ga0097620_100028217 3300006931 Bacteria 5626
193 Ga0099823_1000065 3300006944 Bacteria 50323
194 Ga0079104_1000711 3300006946 Bacteria 30224
195 Ga0079104_1013480 3300006946 Bacteria 2515
196 Ga0105240_10019194 3300009093 Bacteria 9138
197 Ga0105240_10030649 3300009093 Bacteria 6987
198 Ga0105240_10110593 3300009093 Bacteria 3325
199 Ga0105240_10160491 3300009093 Bacteria 2671
200 Ga0105240_10199500 3300009093 Bacteria 2346
201 Ga0105245_10012950 3300009098 Bacteria 7271
202 Ga0105245_10037642 3300009098 Bacteria 4301
203 Ga0105243_10006470 3300009148 Bacteria 9059
204 Ga0105243_10020659 3300009148 Bacteria 4993
205 Ga0105243_10298387 3300009148 Bacteria 1459
206 Ga0105242_10001200 3300009176 Bacteria 20452
207 Ga0105242_10029895 3300009176 Bacteria 4348
208 Ga0105248_10024656 3300009177 Bacteria 6688
209 Ga0105248_10036212 3300009177 Bacteria 5519
210 Ga0105248_10103720 3300009177 Bacteria 3206
211 Ga0105248_10270413 3300009177 Bacteria 1914
212 Ga0105237_10000646 3300009545 Bacteria 48623
213 Ga0105237_10007873 3300009545 Bacteria 11614
214 Ga0105237_10055655 3300009545 Bacteria 3962
215 Ga0105238_10013724 3300009551 Bacteria 8186
216 Ga0105249_10075709 3300009553 Bacteria 3117
217 Ga0105239_10002203 3300010375 Bacteria 25060
218 Ga0105239_10034573 3300010375 Bacteria 5550
219 Ga0105246_10139525 3300011119 Bacteria 1821
220 Ga0157319_1000005 3300012497 Bacteria 372810
221 Ga0157373_10012300 3300013100 Bacteria 6292
222 Ga0157373_10051815 3300013100 Bacteria 2922
223 Ga0157371_10139560 3300013102 Bacteria 1726
224 Ga0157369_10051064 3300013105 Bacteria 4476
225 Ga0157374_10048229 3300013296 Bacteria 3952
226 Ga0157374_10071539 3300013296 Bacteria 3270
227 Ga0157378_10122419 3300013297 Bacteria 2400
228 Ga0163162_10006139 3300013306 Bacteria 11629
229 Ga0163162_10019585 3300013306 Bacteria 6642
230 Ga0163162_10051927 3300013306 Bacteria 4115
231 Ga0157372_10011552 3300013307 Bacteria 9393
232 Ga0157375_10010413 3300013308 Bacteria 8188
233 Ga0157375_10016070 3300013308 Bacteria 6714
234 Ga0157375_10035829 3300013308 Bacteria 4741
235 Ga0157375_10036344 3300013308 Bacteria 4711
236 Ga0157375_10060447 3300013308 Bacteria 3758
237 Ga0157375_10098903 3300013308 Bacteria 2995
238 Ga0163163_10035773 3300014325 Bacteria 4820
239 Ga0163163_10243940 3300014325 Bacteria 1847
240 Ga0182008_10002992 3300014497 Bacteria 10403
241 Ga0182008_10006547 3300014497 Bacteria 6504
242 Ga0157377_10000044 3300014745 Bacteria 100420
243 Ga0157379_10008058 3300014968 Bacteria 9148
244 Ga0157379_10022724 3300014968 Bacteria 5557
245 Ga0157379_10030665 3300014968 Bacteria 4788
246 Ga0157379_10038113 3300014968 Bacteria 4289
247 Ga0157376_10026761 3300014969 Bacteria 4562
248 Ga0157376_10061714 3300014969 Bacteria 3152
249 Ga0157376_10064408 3300014969 Bacteria 3092
250 Ga0157376_10177582 3300014969 Bacteria 1944
251 Ga0182007_10004423 3300015262 Bacteria 6368
252 Ga0182005_1007578 3300015265 Bacteria 3247
253 Ga0183362_10005 3300015683 Bacteria 437616
254 Ga0163161_10006497 3300017792 Bacteria 8093
255 Ga0163161_10019147 3300017792 Bacteria 4800
256 Ga0163161_10039817 3300017792 Bacteria 3375
257 Ga0213872_10000007 3300021361 Bacteria 228206
258 Ga0213872_10000067 3300021361 Bacteria 92410
259 Ga0213872_10000131 3300021361 Bacteria 68632
260 Ga0213872_10000233 3300021361 Bacteria 48866
261 Ga0213872_10019666 3300021361 Bacteria 3110
262 Ga0213872_10025078 3300021361 Bacteria 2742
263 Ga0209674_100073 3300025226 Bacteria 223689
264 Ga0209563_100013 3300025230 Bacteria 941463
265 Ga0209563_100061 3300025230 Bacteria 274295
266 Ga0207427_101037 3300025231 Bacteria 11594
267 Ga0209258_100072 3300025242 Bacteria 274355
268 Ga0209258_103059 3300025242 Bacteria 3833
269 Ga0209258_103479 3300025242 Bacteria 3373
270 Ga0207425_1000426 3300025245 Bacteria 28024
271 Ga0209646_1000076 3300025246 Bacteria 212891
272 Ga0209026_1000011 3300025250 Bacteria 507291
273 Ga0209677_100070 3300025253 Bacteria 143311
274 Ga0209677_100751 3300025253 Bacteria 16421
275 Ga0209677_105485 3300025253 Bacteria 3294
276 Ga0209148_1002371 3300025254 Bacteria 6612
277 Ga0209759_1000034 3300025256 Bacteria 271209
278 Ga0209759_1001263 3300025256 Bacteria 15243
279 Ga0209759_1001427 3300025256 Bacteria 13561
280 Ga0209129_1000269 3300025258 Bacteria 51170
281 Ga0209455_1000053 3300025272 Bacteria 365949
282 Ga0209673_1003690 3300025273 Bacteria 8809
283 Ga0209673_1011942 3300025273 Bacteria 3538
284 Ga0209673_1029399 3300025273 Bacteria 1750
285 Ga0209675_1000911 3300025291 Bacteria 18891
286 Ga0209676_1011605 3300025292 Bacteria 3536
287 Ga0209564_1000008 3300025295 Bacteria 953227
288 Ga0209564_1000300 3300025295 Bacteria 98386
289 Ga0209758_1000605 3300025297 Bacteria 55552
290 Ga0209758_1027675 3300025297 Bacteria 2416
291 Ga0209050_1000770 3300025298 Bacteria 46024
292 Ga0209050_1004597 3300025298 Bacteria 9232
293 Ga0209050_1008492 3300025298 Bacteria 5472
294 Ga0209050_1010621 3300025298 Bacteria 4506
295 Ga0209256_1000049 3300025299 Bacteria 310696
296 Ga0209256_1003918 3300025299 Bacteria 9824
297 Ga0209256_1004159 3300025299 Bacteria 9342
298 Ga0209051_1000247 3300025303 Bacteria 91122
299 Ga0209051_1003902 3300025303 Bacteria 9515
300 Ga0209051_1004626 3300025303 Bacteria 8381
301 Ga0209051_1007075 3300025303 Bacteria 6206
302 Ga0209051_1008990 3300025303 Bacteria 5203
303 Ga0209051_1015628 3300025303 Bacteria 3481
304 Ga0209051_1026222 3300025303 Bacteria 2355
305 Ga0209257_1000141 3300025304 Bacteria 201130
306 Ga0209257_1001704 3300025304 Bacteria 24663
307 Ga0209257_1004727 3300025304 Bacteria 10192
308 Ga0209257_1006810 3300025304 Bacteria 7187
309 Ga0209257_1024286 3300025304 Bacteria 2103
310 Ga0207688_10022598 3300025901 Bacteria 3442
311 Ga0207680_10028440 3300025903 Bacteria 3127
312 Ga0207647_10073527 3300025904 Bacteria 2060
313 Ga0207645_10004343 3300025907 Bacteria 10500
314 Ga0207645_10027832 3300025907 Bacteria 3650
315 Ga0207645_10028492 3300025907 Bacteria 3605
316 Ga0207645_10054409 3300025907 Bacteria 2556
317 Ga0207705_10027738 3300025909 Bacteria 4039
318 Ga0207705_10050908 3300025909 Bacteria 2982
319 Ga0207705_10136076 3300025909 Bacteria 1832
320 Ga0207684_10101912 3300025910 Bacteria 2454
321 Ga0207707_10120457 3300025912 Bacteria 2294
322 Ga0207695_10028147 3300025913 Bacteria 6239
323 Ga0207695_10034025 3300025913 Bacteria 5548
324 Ga0207671_10007157 3300025914 Bacteria 9732
325 Ga0207671_10026506 3300025914 Bacteria 4342
326 Ga0207660_10001454 3300025917 Bacteria 15902
327 Ga0207660_10117650 3300025917 Bacteria 2009
328 Ga0207657_10018081 3300025919 Bacteria 6744
329 Ga0207657_10023991 3300025919 Bacteria 5663
330 Ga0207657_10029766 3300025919 Bacteria 4964
331 Ga0207649_10000335 3300025920 Bacteria 35710
332 Ga0207649_10027585 3300025920 Bacteria 3334
333 Ga0207652_10051225 3300025921 Bacteria 3539
334 Ga0207652_10110056 3300025921 Bacteria 2442
335 Ga0207646_10069488 3300025922 Bacteria 3145
336 Ga0207681_10001008 3300025923 Bacteria 18376
337 Ga0207681_10002578 3300025923 Bacteria 11488
338 Ga0207681_10042266 3300025923 Bacteria 3044
339 Ga0207681_10071123 3300025923 Bacteria 2425
340 Ga0207694_10016495 3300025924 Bacteria 5578
341 Ga0207694_10034410 3300025924 Bacteria 3884
342 Ga0207650_10001346 3300025925 Bacteria 17761
343 Ga0207650_10003269 3300025925 Bacteria 11170
344 Ga0207650_10077599 3300025925 Bacteria 2511
345 Ga0207659_10000207 3300025926 Bacteria 35338
346 Ga0207659_10019315 3300025926 Bacteria 4483
347 Ga0207659_10040934 3300025926 Bacteria 3243
348 Ga0207644_10003278 3300025931 Bacteria 10459
349 Ga0207644_10005018 3300025931 Bacteria 8640
350 Ga0207644_10017333 3300025931 Bacteria 4862
351 Ga0207644_10020439 3300025931 Bacteria 4502
352 Ga0207690_10000176 3300025932 Bacteria 49560
353 Ga0207706_10061609 3300025933 Bacteria 3304
354 Ga0207686_10004163 3300025934 Bacteria 7764
355 Ga0207686_10014698 3300025934 Bacteria 4365
356 Ga0207686_10103781 3300025934 Bacteria 1903
357 Ga0207709_10007539 3300025935 Bacteria 6046
358 Ga0207709_10012409 3300025935 Bacteria 4695
359 Ga0207669_10002599 3300025937 Bacteria 7721
360 Ga0207669_10005642 3300025937 Bacteria 5641
361 Ga0207704_10037050 3300025938 Bacteria 2813
362 Ga0207704_10040842 3300025938 Bacteria 2715
363 Ga0207665_10069689 3300025939 Bacteria 2398
364 Ga0207691_10002895 3300025940 Bacteria 16737
365 Ga0207691_10003449 3300025940 Bacteria 15379
366 Ga0207691_10008177 3300025940 Bacteria 10044
367 Ga0207691_10009917 3300025940 Bacteria 9143
368 Ga0207711_10019739 3300025941 Bacteria 5614
369 Ga0207711_10033268 3300025941 Bacteria 4361
370 Ga0207689_10003961 3300025942 Bacteria 13485
371 Ga0207689_10070714 3300025942 Bacteria 2867
372 Ga0207661_10012579 3300025944 Bacteria 6155
373 Ga0207679_10001472 3300025945 Bacteria 14754
374 Ga0207679_10050636 3300025945 Bacteria 3036
375 Ga0207679_10158714 3300025945 Bacteria 1849
376 Ga0207667_10027618 3300025949 Bacteria 6174
377 Ga0207667_10051160 3300025949 Bacteria 4357
378 Ga0207667_10058267 3300025949 Bacteria 4052
379 Ga0207667_10131052 3300025949 Bacteria 2582
380 Ga0207651_10008453 3300025960 Bacteria 5562
381 Ga0207651_10009387 3300025960 Bacteria 5353
382 Ga0207651_10040524 3300025960 Bacteria 3082
383 Ga0207651_10041282 3300025960 Bacteria 3061
384 Ga0207712_10013724 3300025961 Bacteria 5195
385 Ga0207668_10013756 3300025972 Bacteria 4992
386 Ga0207640_10012952 3300025981 Bacteria 4765
387 Ga0207640_10024457 3300025981 Bacteria 3644
388 Ga0207658_10012147 3300025986 Bacteria 5874
389 Ga0207658_10028406 3300025986 Bacteria 3938
390 Ga0207677_10055029 3300026023 Bacteria 2718
391 Ga0207703_10004229 3300026035 Bacteria 11831
392 Ga0207703_10011615 3300026035 Bacteria 6846
393 Ga0207703_10065459 3300026035 Bacteria 2987
394 Ga0207678_10007570 3300026067 Bacteria 9599
395 Ga0207702_10001565 3300026078 Bacteria 22647
396 Ga0207641_10006229 3300026088 Bacteria 10091
397 Ga0207641_10011103 3300026088 Bacteria 7389
398 Ga0207641_10032121 3300026088 Bacteria 4358
399 Ga0207648_10001584 3300026089 Bacteria 24952
400 Ga0207648_10010452 3300026089 Bacteria 8794
401 Ga0207648_10010854 3300026089 Bacteria 8610
402 Ga0207648_10011167 3300026089 Bacteria 8473
403 Ga0207648_10061480 3300026089 Bacteria 3275
404 Ga0207676_10095831 3300026095 Bacteria 2448
405 Ga0207675_100042444 3300026118 Bacteria 4247
406 Ga0207675_100058322 3300026118 Bacteria 3602
407 Ga0207683_10012763 3300026121 Bacteria 7170
408 Ga0207683_10038257 3300026121 Bacteria 4180
409 Ga0207683_10098453 3300026121 Bacteria 2609
410 Ga0207683_10154519 3300026121 Bacteria 2072
411 Ga0207698_10073054 3300026142 Bacteria 2729
412 Ga0207698_10142335 3300026142 Bacteria 2068
413 Ga0209281_1000395 3300027111 Bacteria 67983
414 Ga0209389_1010868 3300027296 Bacteria 8227
415 Ga0209968_1000906 3300027526 Bacteria 4594
416 Ga0209999_1007707 3300027543 Bacteria 1936
417 Ga0209966_1000017 3300027695 Bacteria 71183
418 Ga0209813_10012578 3300027866 Bacteria 2241
419 Ga0209974_10000608 3300027876 Bacteria 12020
420 Ga0209974_10017019 3300027876 Bacteria 2412
421 Ga0268265_10158359 3300028380 Bacteria 1919
422 Ga0268264_10010530 3300028381 Bacteria 7647
423 Ga0268264_10034363 3300028381 Bacteria 4170
424 Ga0265336_10000036 3300028666 Bacteria 154609
425 Ga0307517_10072690 3300028786 Bacteria 3061
426 Ga0307515_10000011 3300028794 Bacteria 633903
427 Ga0307515_10000281 3300028794 Bacteria 125306
428 Ga0307515_10000419 3300028794 Bacteria 102271
429 Ga0307515_10031865 3300028794 Bacteria 8758
430 Ga0307515_10073207 3300028794 Bacteria 4609
431 Ga0265324_10000136 3300029957 Bacteria 57490
432 Ga0307512_10040205 3300030522 Bacteria 3907
433 Ga0316178_1131179 3300030735 Bacteria 1797
434 Ga0265330_10000052 3300031235 Bacteria 102771
435 Ga0265332_10000001 3300031238 Bacteria 863783
436 Ga0265325_10010139 3300031241 Bacteria 5470
437 Ga0265340_10059587 3300031247 Bacteria 1831
438 Ga0265331_10003008 3300031250 Bacteria 11082
439 Ga0265327_10000035 3300031251 Bacteria 314419
440 Ga0265327_10016534 3300031251 Bacteria 4678
441 Ga0307513_10025768 3300031456 Bacteria 6801
442 Ga0307513_10034575 3300031456 Bacteria 5669
443 Ga0307513_10075354 3300031456 Bacteria 3504
444 Ga0307509_10020572 3300031507 Bacteria 7484
445 Ga0307408_100032911 3300031548 Bacteria 3618
446 Ga0307408_100056443 3300031548 Bacteria 2847
447 Ga0307408_100064624 3300031548 Bacteria 2681
448 Ga0307514_10000355 3300031649 Bacteria 106758
449 Ga0307514_10006320 3300031649 Bacteria 10353
450 Ga0265314_10000013 3300031711 Bacteria 403405
451 Ga0307516_10000054 3300031730 Bacteria 126288
452 Ga0307516_10001808 3300031730 Bacteria 29384
453 Ga0307516_10001961 3300031730 Bacteria 28186
454 Ga0307516_10005578 3300031730 Bacteria 14995
455 Ga0307405_10034443 3300031731 Bacteria 3013
456 Ga0307405_10061018 3300031731 Bacteria 2381
457 Ga0307405_10100625 3300031731 Bacteria 1937
458 Ga0307406_10007227 3300031901 Bacteria 6152
459 Ga0307406_10056239 3300031901 Bacteria 2518
460 Ga0307407_10016230 3300031903 Bacteria 3703
461 Ga0307412_10015031 3300031911 Bacteria 4578
462 Ga0307412_10026896 3300031911 Bacteria 3582
463 Ga0307412_10138233 3300031911 Bacteria 1780
464 Ga0307409_100004999 3300031995 Bacteria 7550
465 Ga0307416_100077835 3300032002 Bacteria 2787
466 Ga0307414_10038560 3300032004 Bacteria 3210
467 Ga0307411_10003141 3300032005 Bacteria 7576
468 Ga0307411_10090769 3300032005 Bacteria 2132
469 Ga0307415_100047717 3300032126 Bacteria 2884
470 Ga0373931_0002648 3300035691 Bacteria 7967
471 Ga0373937_0016810 3300036401 Bacteria 6504
472 Ga0373937_0090530 3300036401 Bacteria 2833
473 Ga0373925_0048624 3300037068 Bacteria 3161
474 Ga0395900_0001686 3300037418 Bacteria 25712
475 Ga0395900_0032417 3300037418 Bacteria 5373
476 Ga0395898_0002642 3300037466 Bacteria 20848
477 Ga0395898_0005142 3300037466 Bacteria 14155
478 Ga0395905_0014064 3300037471 Bacteria 7651
479 Ga0395905_0109466 3300037471 Bacteria 2594
480 Ga0395905_0147587 3300037471 Bacteria 2213
481 Ga0395901_0040745 3300038443 Bacteria 4810
482 Ga0395901_0072660 3300038443 Bacteria 3586
483 Ga0436361_0028732 3300039447 Bacteria 3225
484 Ga0436361_0099386 3300039447 Bacteria 7920
485 Ga0436361_0479314 3300039447 Bacteria 9473
486 Ga0436361_0504982 3300039447 Bacteria 102576
487 Ga0436361_0816515 3300039447 Bacteria 4479
488 Ga0436361_1043865 3300039447 Bacteria 11886
489 Ga0436361_1149866 3300039447 Bacteria 37566
490 Ga0439436_0009572 3300041404 Bacteria 2971
491 Ga0439436_0016190 3300041404 Bacteria 2239
492 Ga0439439_0002335 3300041406 Bacteria 4011
493 Ga0439466_0006336 3300041411 Bacteria 4503
494 Ga0439466_0013342 3300041411 Bacteria 3009
495 Ga0439466_0019082 3300041411 Bacteria 2456
496 Ga0439465_0006744 3300041413 Bacteria 3646
497 Ga0439431_0001021 3300041997 Bacteria 6074
498 Ga0439433_0007805 3300041999 Bacteria 2312
499 Ga0439442_003465 3300042002 Bacteria 3120
500 Ga0439442_004829 3300042002 Bacteria 2682
501 Ga0439442_008074 3300042002 Bacteria 2126
502 Ga0439445_0000222 3300042004 Bacteria 10552
503 Ga0439445_0012752 3300042004 Bacteria 2024
504 Ga0439432_005922 3300042006 Bacteria 4389
505 Ga0439432_021684 3300042006 Bacteria 2127
506 Ga0439449_0005925 3300042007 Bacteria 4667
507 Ga0439449_0011708 3300042007 Bacteria 3297
508 Ga0439449_0012922 3300042007 Bacteria 3139
509 Ga0439452_012584 3300042010 Bacteria 2400
510 Ga0439457_009566 3300042014 Bacteria 2252
511 Ga0439457_009633 3300042014 Bacteria 2244
512 Ga0439462_0004249 3300042015 Bacteria 3485
513 Ga0439462_0006720 3300042015 Bacteria 2869
514 Ga0450911_004418 3300042115 Bacteria 2306
515 Ga0450919_000965 3300042121 Bacteria 3723
516 Ga0450921_000014 3300042123 Bacteria 4316
517 Ga0450923_001529 3300042125 Bacteria 3100
518 Ga0450890_002246 3300042127 Bacteria 2684
519 Ga0450894_002457 3300042131 Bacteria 2489
520 Ga0450906_004008 3300042145 Bacteria 3115
521 Ga0439446_0017256 3300042156 Bacteria 2015
522 Ga0439446_0018498 3300042156 Bacteria 1952
523 Ga0450908_000591 3300042184 Bacteria 6952
524 Ga0450908_009850 3300042184 Bacteria 1768
525 Ga0450909_003138 3300042185 Bacteria 2351
526 Ga0439434_0011742 3300042435 Bacteria 2591
527 Ga0439434_0015589 3300042435 Bacteria 2266
528 Ga0439460_0009792 3300042461 Bacteria 2441
529 Ga0450918_000077 3300042531 Bacteria 20527
530 Ga0450918_003796 3300042531 Bacteria 2784
531 Ga0451577_0003515 3300042876 Bacteria 17370
532 Ga0451577_0009895 3300042876 Bacteria 9139
533 Ga0451577_0014500 3300042876 Bacteria 7347
534 Ga0451577_0024419 3300042876 Bacteria 5499
535 Ga0451577_0089473 3300042876 Bacteria 2747
536 Ga0451577_0125297 3300042876 Bacteria 2302
537 Ga0451577_0153188 3300042876 Bacteria 2074
538 Ga0466969_0000046 3300044656 Bacteria 63999
539 Ga0466969_0067627 3300044656 Bacteria 1723
540 Ga0453683_0035550 3300044673 Bacteria 3139
541 Ga0453683_0089176 3300044673 Bacteria 1933
542 Ga0466965_0008433 3300044683 Bacteria 4769
543 Ga0466965_0035916 3300044683 Bacteria 2429
544 Ga0466966_0003197 3300044684 Bacteria 10785
545 Ga0466966_0011921 3300044684 Bacteria 5761
546 Ga0466966_0016292 3300044684 Bacteria 4915
547 Ga0466961_0007180 3300044693 Bacteria 7087
548 Ga0466961_0147994 3300044693 Bacteria 1467
549 Ga0466963_0062885 3300044694 Bacteria 2483
550 Ga0466963_0086305 3300044694 Bacteria 2132
551 Ga0466964_0006544 3300044706 Bacteria 4344
552 Ga0453684_0000065 3300044712 Bacteria 468481
553 Ga0453684_0001131 3300044712 Bacteria 83523
554 Ga0453684_0010067 3300044712 Bacteria 16251
555 Ga0453684_0032339 3300044712 Bacteria 7325
556 Ga0453684_0082882 3300044712 Bacteria 3994
557 Ga0453684_0198002 3300044712 Bacteria 2344
558 Ga0466971_0043912 3300044719 Bacteria 2007
559 Ga0466957_0112722 3300044842 Bacteria 1726
560 Ga0466960_0042774 3300044901 Bacteria 2152
561 Ga0466959_0000174 3300045049 Bacteria 42543
562 Ga0466959_0026183 3300045049 Bacteria 4323
563 Ga0451576_0000526 3300045051 Bacteria 83427
564 Ga0451576_0003229 3300045051 Bacteria 22685
565 Ga0451576_0024150 3300045051 Bacteria 6569
566 Ga0451576_0049640 3300045051 Bacteria 4404
567 Ga0466958_0066533 3300045836 Bacteria 2200
568 Ga0495590_0033892 3300046457 Bacteria 1784
569 Ga0495629_0070447 3300046459 Bacteria 2440
570 Ga0495650_0017128 3300046471 Bacteria 3643
571 Ga0495580_0111528 3300046472 Bacteria 1899
572 Ga0495639_0004264 3300046475 Bacteria 6134
573 Ga0495585_0043320 3300046492 Bacteria 2518
574 Ga0495583_0000129 3300046506 Bacteria 126766
575 Ga0495606_0053792 3300046507 Bacteria 2610
576 Ga0495610_0007076 3300046512 Bacteria 7573
577 Ga0495630_0052261 3300046517 Bacteria 3059
578 Ga0495632_0004609 3300046519 Bacteria 9335
579 Ga0495643_0027317 3300046522 Bacteria 3210
580 Ga0495643_0030737 3300046522 Bacteria 2996
581 Ga0495642_0020287 3300046528 Bacteria 2610
582 Ga0495598_0005445 3300046537 Bacteria 2822
583 Ga0495645_0050111 3300046543 Bacteria 3040
584 Ga0495622_0020307 3300046557 Bacteria 3093
585 Ga0495633_0007721 3300046558 Bacteria 6152
586 Ga0495656_0002495 3300046615 Bacteria 6121
587 Ga0495625_0009857 3300046660 Bacteria 7947
588 Ga0495625_0012566 3300046660 Bacteria 6854
589 Ga0495625_0044634 3300046660 Bacteria 3208
590 Ga0495588_0060622 3300046674 Bacteria 1958
591 Ga0495624_0037876 3300046690 Bacteria 3101
592 Ga0495649_0000524 3300046694 Bacteria 32600
593 Ga0495589_0005373 3300046794 Bacteria 6760
594 Ga0495660_0016578 3300046810 Bacteria 4248
595 Ga0495674_0197156 3300047319 Bacteria 1672
596 Ga0495687_000174 3300047443 Bacteria 95031
597 Ga0495684_0038701 3300047471 Bacteria 3656
598 Ga0495686_0080121 3300047472 Bacteria 1996
599 Ga0495593_0045358 3300047673 Bacteria 2346
600 Ga0496101_0029043 3300048904 Bacteria 3866
601 Ga0496102_0009157 3300048905 Bacteria 8492
602 Ga0496102_0009561 3300048905 Bacteria 8339
603 Ga0496102_0011400 3300048905 Bacteria 7661
604 Ga0496103_0033383 3300048906 Bacteria 3143
605 Ga0496104_0106928 3300048907 Bacteria 2681
606 Ga0496104_0113229 3300048907 Bacteria 2602
607 Ga0496105_0032115 3300048908 Bacteria 4306
608 Ga0496105_0039421 3300048908 Bacteria 3894
609 Ga0496107_0109186 3300048910 Bacteria 2032
610 Ga0496108_0118815 3300048911 Bacteria 2266
611 Ga0496109_0047302 3300048912 Bacteria 3911
612 Ga0496109_0077567 3300048912 Bacteria 3058
613 Ga0496109_0155807 3300048912 Bacteria 2140
614 Ga0496109_0193157 3300048912 Bacteria 1913
615 Ga0496109_0232931 3300048912 Bacteria 1733
616 Ga0496110_0019147 3300048913 Bacteria 5755
617 Ga0496110_0153617 3300048913 Bacteria 2084
618 Ga0496111_0150933 3300048914 Bacteria 1723
619 Ga0496113_0089270 3300048916 Bacteria 2372
620 Ga0496114_0006241 3300048917 Bacteria 9381
621 Ga0496121_0023358 3300048924 Bacteria 5958
622 Ga0496122_0004537 3300048925 Bacteria 17119
623 Ga0496123_0000160 3300048926 Bacteria 135310
624 Ga0496124_0000108 3300048927 Bacteria 167473
625 Ga0496124_0031147 3300048927 Bacteria 4725
626 Ga0496124_0075218 3300048927 Bacteria 2790
627 Ga0496125_0004332 3300048928 Bacteria 16465
628 Ga0496125_0019117 3300048928 Bacteria 6476
629 Ga0496125_0074777 3300048928 Bacteria 2625
630 Ga0496125_0075095 3300048928 Bacteria 2617
631 Ga0496126_0146301 3300048929 Bacteria 2029
632 Ga0496126_0172256 3300048929 Bacteria 1843
633 Ga0501308_000901 3300049128 Bacteria 2177
634 Ga0501304_000399 3300049160 Bacteria 2177
635 Ga0501032_0037757 3300049569 Bacteria 3292
636 Ga0501034_0124759 3300049571 Bacteria 2560
637 Ga0501043_0000002 3300049579 Bacteria 351081
638 Ga0501043_0030215 3300049579 Bacteria 4257
639 Ga0501046_0000008 3300049580 Bacteria 351167
640 Ga0501047_0000003 3300049581 Bacteria 508375
641 Ga0501048_0004029 3300049582 Bacteria 11173
642 Ga0501198_000007 3300049649 Bacteria 129700
643 Ga0501222_000005 3300049662 Bacteria 129724
644 Ga0501257_015855 3300049686 Bacteria 1743
645 Ga0501265_002543 3300049762 Bacteria 2069
646 Ga0501035_0083199 3300049822 Bacteria 2824
647 Ga0501035_0111195 3300049822 Bacteria 2401
648 Ga0501044_0308243 3300049823 Bacteria 1510
649 nmdc:mga03683_13349_c1 3300050489 Bacteria 3021
650 nmdc:mga03683_15504_c1 3300050489 Bacteria 2845
651 nmdc:mga03683_6266_c1 3300050489 Bacteria 4063
652 nmdc:mga03683_7162_c1 3300050489 Bacteria 3858
653 nmdc:mga03n38_16652_c1 3300050490 Bacteria 2864
654 nmdc:mga03n38_26117_c1 3300050490 Bacteria 2408
655 nmdc:mga00v17_87387_c1 3300050491 Bacteria 1954
656 nmdc:mga0yw44_64343_c1 3300050492 Bacteria 2257
657 nmdc:mga0yw44_8074_c1 3300050492 Bacteria 5223
658 nmdc:mga0k408_1174_c1 3300050493 Bacteria 14328
659 nmdc:mga0k408_12497_c1 3300050493 Bacteria 4642
660 nmdc:mga0k408_35206_c1 3300050493 Bacteria 2871
661 nmdc:mga0k408_3759_c1 3300050493 Bacteria 8049
662 nmdc:mga0k408_396_c1 3300050493 Bacteria 23854
663 nmdc:mga0k408_47579_c1 3300050493 Bacteria 2479
664 nmdc:mga0k408_57467_c1 3300050493 Bacteria 2258
665 nmdc:mga0k408_729_c1 3300050493 Bacteria 18040
666 nmdc:mga0k408_7424_c1 3300050493 Bacteria 5853
667 nmdc:mga0k408_892_c1 3300050493 Bacteria 16353
668 nmdc:mga06z11_16470_c1 3300050494 Bacteria 3331
669 nmdc:mga06z11_63094_c1 3300050494 Bacteria 1938
670 nmdc:mga07m45_10995_c1 3300050496 Bacteria 4745
671 nmdc:mga07m45_11599_c1 3300050496 Bacteria 4634
672 nmdc:mga07m45_23016_c1 3300050496 Bacteria 3404
673 nmdc:mga07m45_27970_c1 3300050496 Bacteria 3111
674 nmdc:mga07m45_3610_c1 3300050496 Bacteria 7474
675 nmdc:mga07m45_4843_c1 3300050496 Bacteria 6621
676 nmdc:mga07m45_5171_c1 3300050496 Bacteria 6468
677 nmdc:mga07m45_55744_c1 3300050496 Bacteria 2234
678 nmdc:mga07m45_55905_c1 3300050496 Bacteria 2016
679 nmdc:mga07m45_6993_c1 3300050496 Bacteria 5740
680 nmdc:mga07m45_74089_c1 3300050496 Bacteria 1939
681 nmdc:mga07m45_7711_c1 3300050496 Bacteria 5510
682 nmdc:mga09592_2264_c1 3300050508 Bacteria 15188
683 nmdc:mga0qj67_10871_c1 3300050509 Bacteria 6808
684 nmdc:mga0sz30_14235_c1 3300050516 Bacteria 3127
685 Ga0495601_0023250 3300053077 Bacteria 3808
686 Ga0500635_0000030 3300053080 Bacteria 99936
687 Ga0495619_0022578 3300053085 Bacteria 4029
688 Ga0500578_0000025 3300053086 Bacteria 151485
689 Ga0500562_015236 3300053108 Bacteria 1972
690 Ga0500593_003896 3300053117 Bacteria 5722
691 Ga0500595_018156 3300053119 Bacteria 2578
692 Ga0500642_0032519 3300053130 Bacteria 2189
693 Ga0500658_0001460 3300053134 Bacteria 9460
694 Ga0500559_0005517 3300053136 Bacteria 5816
695 Ga0500559_0012959 3300053136 Bacteria 3537
696 Ga0500564_025252 3300053138 Bacteria 2729
697 Ga0500568_0011402 3300053139 Bacteria 4129
698 Ga0500568_0021802 3300053139 Bacteria 2752
699 Ga0500590_035532 3300053148 Bacteria 2579
700 Ga0500619_000014 3300053154 Bacteria 55951
701 Ga0500622_0000890 3300053156 Bacteria 25460
702 Ga0500622_0001306 3300053156 Bacteria 20253
703 Ga0500622_0010205 3300053156 Bacteria 5163
704 Ga0500636_0022800 3300053177 Bacteria 3700
705 Ga0500661_003126 3300055283 Bacteria 3110
706 Ga0466962_0002224 3300061719 Bacteria 9174
707 2587725502 2585428057 Bacteria 6737412
708 2587734972 2585428058 Bacteria 6853932
709 2588290504 2588253510 Bacteria 6901809
710 2643970018 2643221592 Bacteria 6608788
711 2644143008 2643221625 Bacteria 6512927
712 2644164023 2643221628 Bacteria 5745828
713 2644244825 2643221644 Bacteria 6865017
714 2644271932 2643221648 Bacteria 6521465
715 2644338646 2643221660 Bacteria 4208257
716 2722881536 2721755523 Bacteria 6430384
717 2739249703 2738543013 Bacteria 5618633
718 2831864583 2831864461 Bacteria 6502356
719 2839144792 2839138175 Bacteria 6549354
720 2842678630 2842677519 Bacteria 5615038
721 2842733898 2842733646 Bacteria 5716726
722 2842752377 2842747753 Bacteria 5578255
723 2881103309 2881101125 Bacteria 4590519
724 2885193210 2885192300 Bacteria 5882526
725 2886851440 2886848708 Bacteria 5632523
726 2904452766 2904449895 Bacteria 6927402
727 2904460206 2904456579 Bacteria 6819253
728 2919463614 2919462493 Bacteria 5817112
729 2928117980 2928115317 Bacteria 6477646
730 2929525735 2929520902 Bacteria 6765052
731 2932424491 2932422444 Bacteria 4678430
732 2945945702 2945945610 Bacteria 5951079
733 2945975357 2945972063 Bacteria 6086495
734 Ga0070706_100063204
735 JGI25156J39149_1002558
736 JGI25154J39366_1004695
737 JGI25157J39369_1000267
738 JGI25153J46596_10002860
739 rootH1_10012758
740 rootH1_10083585
741 rootL2_10003381
742 rootL2_10087698
743 rootL2_10106425
744 rootH1_10013830
745 rootH1_10060360
746 rootH1_10069288
747 Ga0006562J51391_1042152
748 Ga0055539_1000550
749 Ga0055539_1001108
750 Ga0055533_1000045
751 Ga0055525_1000004
752 Ga0055525_1000632
753 Ga0055535_1000047
754 Ga0055529_1000148
755 Ga0055526_1001509
756 Ga0055526_1002656
757 Ga0055524_1000247
758 Ga0055524_1002449
759 Ga0055524_1003709
760 Ga0055534_1002527
761 Ga0055530_10003306
762 Ga0055540_1000260
763 Ga0055540_1006264
764 Ga0055540_1008623
765 Ga0055531_10004940
766 Ga0055531_10008285
767 Ga0055531_10009185
768 Ga0055543_1004417
769 Ga0065165_1000290
770 Ga0065165_1001688
771 Ga0065165_1005747
772 Ga0065714_10010259
773 Ga0070690_100004054
774 Ga0070690_100027300
775 Ga0070670_100005551
776 Ga0070670_100006917
777 Ga0070670_100010262
778 Ga0070670_100026772
779 Ga0070670_100044235
780 Ga0070670_100105924
781 Ga0070670_100118273
782 Ga0068869_100024040
783 Ga0070666_10032453
784 Ga0070680_100025814
785 Ga0068868_100022196
786 Ga0068868_100079731
787 Ga0068868_100111977
788 Ga0070660_100015360
789 Ga0070660_100023302
790 Ga0070660_100026833
791 Ga0070689_100012386
792 Ga0070691_10053453
793 Ga0070687_100013556
794 Ga0070661_100000361
795 Ga0070661_100025217
796 Ga0070692_10043595
797 Ga0070668_100003480
798 Ga0070668_100111676
799 Ga0070668_100112479
800 Ga0070669_100002701
801 Ga0070669_100013341
802 Ga0070675_100000703
803 Ga0070675_100002723
804 Ga0070675_100012549
805 Ga0070675_100034117
806 Ga0070675_100189509
807 Ga0070671_100002088
808 Ga0070671_100004115
809 Ga0070671_100018389
810 Ga0070671_100026675
811 Ga0070674_100001813
812 Ga0070674_100004415
813 Ga0070674_100004918
814 Ga0070674_100034797
815 Ga0070673_100009469
816 Ga0070673_100015757
817 Ga0070673_100040286
818 Ga0070673_100055040
819 Ga0070659_100001606
820 Ga0070659_100164693
821 Ga0070659_100188672
822 Ga0070659_100195089
823 Ga0070667_100006775
824 Ga0070667_100008119
825 Ga0070667_100036643
826 Ga0070663_100098121
827 Ga0070678_100009710
828 Ga0070678_100013404
829 Ga0070678_100051450
830 Ga0070678_100122314
831 Ga0070662_100022134
832 Ga0070662_100075344
833 Ga0070681_10062170
834 Ga0070681_10139067
835 Ga0068867_100000120
836 Ga0068867_100002943
837 Ga0068867_100007438
838 Ga0068867_100054036
839 Ga0070679_100013044
840 Ga0070679_100062147
841 Ga0070672_100000177
842 Ga0070672_100005324
843 Ga0070672_100006490
844 Ga0070672_100020259
845 Ga0070672_100027809
846 Ga0070672_100079594
847 Ga0070672_100123912
848 Ga0070665_100009614
849 Ga0068855_100007548
850 Ga0068855_100048080
851 Ga0068855_100069769
852 Ga0068855_100072373
853 Ga0068855_100268088
854 Ga0068855_100275571
855 Ga0070664_100001095
856 Ga0070664_100043654
857 Ga0068857_100005597
858 Ga0068857_100040785
859 Ga0068857_100056953
860 Ga0068854_100006801
861 Ga0068854_100016734
862 Ga0068856_100001716
863 Ga0068856_100020622
864 Ga0068856_100023648
865 Ga0068852_100005336
866 Ga0068852_100140444
867 Ga0068859_100028219
868 Ga0068864_100002220
869 Ga0068864_100030433
870 Ga0068864_100106106
871 Ga0068861_100040043
872 Ga0068851_10011301
873 Ga0068851_10095902
874 Ga0068863_100003043
875 Ga0068863_100045751
876 Ga0068858_100002003
877 Ga0068858_100004297
878 Ga0068860_100005401
879 Ga0068860_100084500
880 Ga0068862_100064969
881 Ga0068862_100101762
882 Ga0075365_10010955
883 Ga0075365_10011610
884 Ga0075363_100005295
885 Ga0075363_100009657
886 Ga0075364_10079311
887 Ga0075362_10001230
888 Ga0075362_10002845
889 Ga0075362_10004591
890 Ga0075362_10005426
891 Ga0075362_10026936
892 Ga0075367_10009945
893 Ga0075367_10025245
894 Ga0075369_10003566
895 Ga0075369_10037162
896 Ga0075369_10055871
897 Ga0075366_10000488
898 Ga0075366_10000512
899 Ga0075366_10000833
900 Ga0075366_10001615
901 Ga0075366_10002670
902 Ga0075366_10009487
903 Ga0075366_10013295
904 Ga0075366_10020444
905 Ga0075366_10036444
906 Ga0075366_10043068
907 Ga0075366_10073830
908 Ga0097621_100013906
909 Ga0075370_10001163
910 Ga0075370_10001599
911 Ga0075370_10001843
912 Ga0075370_10002011
913 Ga0075370_10002147
914 Ga0075370_10003491
915 Ga0075370_10008222
916 Ga0075370_10012954
917 Ga0068871_100013329
918 Ga0068871_100032334
919 Ga0075430_100014313
920 Ga0075429_100045567
921 Ga0068865_100004212
922 Ga0068865_100036159
923 Ga0068865_100051203
924 Ga0097620_100028217
925 Ga0099823_1000065
926 Ga0079104_1000711
927 Ga0079104_1013480
928 Ga0105240_10019194
929 Ga0105240_10030649
930 Ga0105240_10110593
931 Ga0105240_10160491
932 Ga0105240_10199500
933 Ga0105245_10012950
934 Ga0105245_10037642
935 Ga0105243_10006470
936 Ga0105243_10020659
937 Ga0105243_10298387
938 Ga0105242_10001200
939 Ga0105242_10029895
940 Ga0105248_10024656
941 Ga0105248_10036212
942 Ga0105248_10103720
943 Ga0105248_10270413
944 Ga0105237_10000646
945 Ga0105237_10007873
946 Ga0105237_10055655
947 Ga0105238_10013724
948 Ga0105249_10075709
949 Ga0105239_10002203
950 Ga0105239_10034573
951 Ga0105246_10139525
952 Ga0157319_1000005
953 Ga0157373_10012300
954 Ga0157373_10051815
955 Ga0157371_10139560
956 Ga0157369_10051064
957 Ga0157374_10048229
958 Ga0157374_10071539
959 Ga0157378_10122419
960 Ga0163162_10006139
961 Ga0163162_10019585
962 Ga0163162_10051927
963 Ga0157372_10011552
964 Ga0157375_10010413
965 Ga0157375_10016070
966 Ga0157375_10035829
967 Ga0157375_10036344
968 Ga0157375_10060447
969 Ga0157375_10098903
970 Ga0163163_10035773
971 Ga0163163_10243940
972 Ga0182008_10002992
973 Ga0182008_10006547
974 Ga0157377_10000044
975 Ga0157379_10008058
976 Ga0157379_10022724
977 Ga0157379_10030665
978 Ga0157379_10038113
979 Ga0157376_10026761
980 Ga0157376_10061714
981 Ga0157376_10064408
982 Ga0157376_10177582
983 Ga0182007_10004423
984 Ga0182005_1007578
985 Ga0183362_10005
986 Ga0163161_10006497
987 Ga0163161_10019147
988 Ga0163161_10039817
989 Ga0213872_10000007
990 Ga0213872_10000067
991 Ga0213872_10000131
992 Ga0213872_10000233
993 Ga0213872_10019666
994 Ga0213872_10025078
995 Ga0209674_100073
996 Ga0209563_100013
997 Ga0209563_100061
998 Ga0207427_101037
999 Ga0209258_100072
1000 Ga0209258_103059
1001 Ga0209258_103479
1002 Ga0207425_1000426
1003 Ga0209646_1000076
1004 Ga0209026_1000011
1005 Ga0209677_100070
1006 Ga0209677_100751
1007 Ga0209677_105485
1008 Ga0209148_1002371
1009 Ga0209759_1000034
1010 Ga0209759_1001263
1011 Ga0209759_1001427
1012 Ga0209129_1000269
1013 Ga0209455_1000053
1014 Ga0209673_1003690
1015 Ga0209673_1011942
1016 Ga0209673_1029399
1017 Ga0209675_1000911
1018 Ga0209676_1011605
1019 Ga0209564_1000008
1020 Ga0209564_1000300
1021 Ga0209758_1000605
1022 Ga0209758_1027675
1023 Ga0209050_1000770
1024 Ga0209050_1004597
1025 Ga0209050_1008492
1026 Ga0209050_1010621
1027 Ga0209256_1000049
1028 Ga0209256_1003918
1029 Ga0209256_1004159
1030 Ga0209051_1000247
1031 Ga0209051_1003902
1032 Ga0209051_1004626
1033 Ga0209051_1007075
1034 Ga0209051_1008990
1035 Ga0209051_1015628
1036 Ga0209051_1026222
1037 Ga0209257_1000141
1038 Ga0209257_1001704
1039 Ga0209257_1004727
1040 Ga0209257_1006810
1041 Ga0209257_1024286
1042 Ga0207688_10022598
1043 Ga0207680_10028440
1044 Ga0207647_10073527
1045 Ga0207645_10004343
1046 Ga0207645_10027832
1047 Ga0207645_10028492
1048 Ga0207645_10054409
1049 Ga0207705_10027738
1050 Ga0207705_10050908
1051 Ga0207705_10136076
1052 Ga0207684_10101912
1053 Ga0207707_10120457
1054 Ga0207695_10028147
1055 Ga0207695_10034025
1056 Ga0207671_10007157
1057 Ga0207671_10026506
1058 Ga0207660_10001454
1059 Ga0207660_10117650
1060 Ga0207657_10018081
1061 Ga0207657_10023991
1062 Ga0207657_10029766
1063 Ga0207649_10000335
1064 Ga0207649_10027585
1065 Ga0207652_10051225
1066 Ga0207652_10110056
1067 Ga0207646_10069488
1068 Ga0207681_10001008
1069 Ga0207681_10002578
1070 Ga0207681_10042266
1071 Ga0207681_10071123
1072 Ga0207694_10016495
1073 Ga0207694_10034410
1074 Ga0207650_10001346
1075 Ga0207650_10003269
1076 Ga0207650_10077599
1077 Ga0207659_10000207
1078 Ga0207659_10019315
1079 Ga0207659_10040934
1080 Ga0207644_10003278
1081 Ga0207644_10005018
1082 Ga0207644_10017333
1083 Ga0207644_10020439
1084 Ga0207690_10000176
1085 Ga0207706_10061609
1086 Ga0207686_10004163
1087 Ga0207686_10014698
1088 Ga0207686_10103781
1089 Ga0207709_10007539
1090 Ga0207709_10012409
1091 Ga0207669_10002599
1092 Ga0207669_10005642
1093 Ga0207704_10037050
1094 Ga0207704_10040842
1095 Ga0207665_10069689
1096 Ga0207691_10002895
1097 Ga0207691_10003449
1098 Ga0207691_10008177
1099 Ga0207691_10009917
1100 Ga0207711_10019739
1101 Ga0207711_10033268
1102 Ga0207689_10003961
1103 Ga0207689_10070714
1104 Ga0207661_10012579
1105 Ga0207679_10001472
1106 Ga0207679_10050636
1107 Ga0207679_10158714
1108 Ga0207667_10027618
1109 Ga0207667_10051160
1110 Ga0207667_10058267
1111 Ga0207667_10131052
1112 Ga0207651_10008453
1113 Ga0207651_10009387
1114 Ga0207651_10040524
1115 Ga0207651_10041282
1116 Ga0207712_10013724
1117 Ga0207668_10013756
1118 Ga0207640_10012952
1119 Ga0207640_10024457
1120 Ga0207658_10012147
1121 Ga0207658_10028406
1122 Ga0207677_10055029
1123 Ga0207703_10004229
1124 Ga0207703_10011615
1125 Ga0207703_10065459
1126 Ga0207678_10007570
1127 Ga0207702_10001565
1128 Ga0207641_10006229
1129 Ga0207641_10011103
1130 Ga0207641_10032121
1131 Ga0207648_10001584
1132 Ga0207648_10010452
1133 Ga0207648_10010854
1134 Ga0207648_10011167
1135 Ga0207648_10061480
1136 Ga0207676_10095831
1137 Ga0207675_100042444
1138 Ga0207675_100058322
1139 Ga0207683_10012763
1140 Ga0207683_10038257
1141 Ga0207683_10098453
1142 Ga0207683_10154519
1143 Ga0207698_10073054
1144 Ga0207698_10142335
1145 Ga0209281_1000395
1146 Ga0209389_1010868
1147 Ga0209968_1000906
1148 Ga0209999_1007707
1149 Ga0209966_1000017
1150 Ga0209813_10012578
1151 Ga0209974_10000608
1152 Ga0209974_10017019
1153 Ga0268265_10158359
1154 Ga0268264_10010530
1155 Ga0268264_10034363
1156 Ga0265336_10000036
1157 Ga0307517_10072690
1158 Ga0307515_10000011
1159 Ga0307515_10000281
1160 Ga0307515_10000419
1161 Ga0307515_10031865
1162 Ga0307515_10073207
1163 Ga0265324_10000136
1164 Ga0307512_10040205
1165 Ga0316178_1131179
1166 Ga0265330_10000052
1167 Ga0265332_10000001
1168 Ga0265325_10010139
1169 Ga0265340_10059587
1170 Ga0265331_10003008
1171 Ga0265327_10000035
1172 Ga0265327_10016534
1173 Ga0307513_10025768
1174 Ga0307513_10034575
1175 Ga0307513_10075354
1176 Ga0307509_10020572
1177 Ga0307408_100032911
1178 Ga0307408_100056443
1179 Ga0307408_100064624
1180 Ga0307514_10000355
1181 Ga0307514_10006320
1182 Ga0265314_10000013
1183 Ga0307516_10000054
1184 Ga0307516_10001808
1185 Ga0307516_10001961
1186 Ga0307516_10005578
1187 Ga0307405_10034443
1188 Ga0307405_10061018
1189 Ga0307405_10100625
1190 Ga0307406_10007227
1191 Ga0307406_10056239
1192 Ga0307407_10016230
1193 Ga0307412_10015031
1194 Ga0307412_10026896
1195 Ga0307412_10138233
1196 Ga0307409_100004999
1197 Ga0307416_100077835
1198 Ga0307414_10038560
1199 Ga0307411_10003141
1200 Ga0307411_10090769
1201 Ga0307415_100047717
1202 Ga0373931_0002648
1203 Ga0373937_0016810
1204 Ga0373937_0090530
1205 Ga0373925_0048624
1206 Ga0395900_0001686
1207 Ga0395900_0032417
1208 Ga0395898_0002642
1209 Ga0395898_0005142
1210 Ga0395905_0014064
1211 Ga0395905_0109466
1212 Ga0395905_0147587
1213 Ga0395901_0040745
1214 Ga0395901_0072660
1215 Ga0436361_0028732
1216 Ga0436361_0099386
1217 Ga0436361_0479314
1218 Ga0436361_0504982
1219 Ga0436361_0816515
1220 Ga0436361_1043865
1221 Ga0436361_1149866
1222 Ga0439436_0009572
1223 Ga0439436_0016190
1224 Ga0439439_0002335
1225 Ga0439466_0006336
1226 Ga0439466_0013342
1227 Ga0439466_0019082
1228 Ga0439465_0006744
1229 Ga0439431_0001021
1230 Ga0439433_0007805
1231 Ga0439442_003465
1232 Ga0439442_004829
1233 Ga0439442_008074
1234 Ga0439445_0000222
1235 Ga0439445_0012752
1236 Ga0439432_005922
1237 Ga0439432_021684
1238 Ga0439449_0005925
1239 Ga0439449_0011708
1240 Ga0439449_0012922
1241 Ga0439452_012584
1242 Ga0439457_009566
1243 Ga0439457_009633
1244 Ga0439462_0004249
1245 Ga0439462_0006720
1246 Ga0450911_004418
1247 Ga0450919_000965
1248 Ga0450921_000014
1249 Ga0450923_001529
1250 Ga0450890_002246
1251 Ga0450894_002457
1252 Ga0450906_004008
1253 Ga0439446_0017256
1254 Ga0439446_0018498
1255 Ga0450908_000591
1256 Ga0450908_009850
1257 Ga0450909_003138
1258 Ga0439434_0011742
1259 Ga0439434_0015589
1260 Ga0439460_0009792
1261 Ga0450918_000077
1262 Ga0450918_003796
1263 Ga0451577_0003515
1264 Ga0451577_0009895
1265 Ga0451577_0014500
1266 Ga0451577_0024419
1267 Ga0451577_0089473
1268 Ga0451577_0125297
1269 Ga0451577_0153188
1270 Ga0466969_0000046
1271 Ga0466969_0067627
1272 Ga0453683_0035550
1273 Ga0453683_0089176
1274 Ga0466965_0008433
1275 Ga0466965_0035916
1276 Ga0466966_0003197
1277 Ga0466966_0011921
1278 Ga0466966_0016292
1279 Ga0466961_0007180
1280 Ga0466961_0147994
1281 Ga0466963_0062885
1282 Ga0466963_0086305
1283 Ga0466964_0006544
1284 Ga0453684_0000065
1285 Ga0453684_0001131
1286 Ga0453684_0010067
1287 Ga0453684_0032339
1288 Ga0453684_0082882
1289 Ga0453684_0198002
1290 Ga0466971_0043912
1291 Ga0466957_0112722
1292 Ga0466960_0042774
1293 Ga0466959_0000174
1294 Ga0466959_0026183
1295 Ga0451576_0000526
1296 Ga0451576_0003229
1297 Ga0451576_0024150
1298 Ga0451576_0049640
1299 Ga0466958_0066533
1300 Ga0495590_0033892
1301 Ga0495629_0070447
1302 Ga0495650_0017128
1303 Ga0495580_0111528
1304 Ga0495639_0004264
1305 Ga0495585_0043320
1306 Ga0495583_0000129
1307 Ga0495606_0053792
1308 Ga0495610_0007076
1309 Ga0495630_0052261
1310 Ga0495632_0004609
1311 Ga0495643_0027317
1312 Ga0495643_0030737
1313 Ga0495642_0020287
1314 Ga0495598_0005445
1315 Ga0495645_0050111
1316 Ga0495622_0020307
1317 Ga0495633_0007721
1318 Ga0495656_0002495
1319 Ga0495625_0009857
1320 Ga0495625_0012566
1321 Ga0495625_0044634
1322 Ga0495588_0060622
1323 Ga0495624_0037876
1324 Ga0495649_0000524
1325 Ga0495589_0005373
1326 Ga0495660_0016578
1327 Ga0495674_0197156
1328 Ga0495687_000174
1329 Ga0495684_0038701
1330 Ga0495686_0080121
1331 Ga0495593_0045358
1332 Ga0496101_0029043
1333 Ga0496102_0009157
1334 Ga0496102_0009561
1335 Ga0496102_0011400
1336 Ga0496103_0033383
1337 Ga0496104_0106928
1338 Ga0496104_0113229
1339 Ga0496105_0032115
1340 Ga0496105_0039421
1341 Ga0496107_0109186
1342 Ga0496108_0118815
1343 Ga0496109_0047302
1344 Ga0496109_0077567
1345 Ga0496109_0155807
1346 Ga0496109_0193157
1347 Ga0496109_0232931
1348 Ga0496110_0019147
1349 Ga0496110_0153617
1350 Ga0496111_0150933
1351 Ga0496113_0089270
1352 Ga0496114_0006241
1353 Ga0496121_0023358
1354 Ga0496122_0004537
1355 Ga0496123_0000160
1356 Ga0496124_0000108
1357 Ga0496124_0031147
1358 Ga0496124_0075218
1359 Ga0496125_0004332
1360 Ga0496125_0019117
1361 Ga0496125_0074777
1362 Ga0496125_0075095
1363 Ga0496126_0146301
1364 Ga0496126_0172256
1365 Ga0501308_000901
1366 Ga0501304_000399
1367 Ga0501032_0037757
1368 Ga0501034_0124759
1369 Ga0501043_0000002
1370 Ga0501043_0030215
1371 Ga0501046_0000008
1372 Ga0501047_0000003
1373 Ga0501048_0004029
1374 Ga0501198_000007
1375 Ga0501222_000005
1376 Ga0501257_015855
1377 Ga0501265_002543
1378 Ga0501035_0083199
1379 Ga0501035_0111195
1380 Ga0501044_0308243
1381 nmdc:mga03683_13349_c1
1382 nmdc:mga03683_15504_c1
1383 nmdc:mga03683_6266_c1
1384 nmdc:mga03683_7162_c1
1385 nmdc:mga03n38_16652_c1
1386 nmdc:mga03n38_26117_c1
1387 nmdc:mga00v17_87387_c1
1388 nmdc:mga0yw44_64343_c1
1389 nmdc:mga0yw44_8074_c1
1390 nmdc:mga0k408_1174_c1
1391 nmdc:mga0k408_12497_c1
1392 nmdc:mga0k408_35206_c1
1393 nmdc:mga0k408_3759_c1
1394 nmdc:mga0k408_396_c1
1395 nmdc:mga0k408_47579_c1
1396 nmdc:mga0k408_57467_c1
1397 nmdc:mga0k408_729_c1
1398 nmdc:mga0k408_7424_c1
1399 nmdc:mga0k408_892_c1
1400 nmdc:mga06z11_16470_c1
1401 nmdc:mga06z11_63094_c1
1402 nmdc:mga07m45_10995_c1
1403 nmdc:mga07m45_11599_c1
1404 nmdc:mga07m45_23016_c1
1405 nmdc:mga07m45_27970_c1
1406 nmdc:mga07m45_3610_c1
1407 nmdc:mga07m45_4843_c1
1408 nmdc:mga07m45_5171_c1
1409 nmdc:mga07m45_55744_c1
1410 nmdc:mga07m45_55905_c1
1411 nmdc:mga07m45_6993_c1
1412 nmdc:mga07m45_74089_c1
1413 nmdc:mga07m45_7711_c1
1414 nmdc:mga09592_2264_c1
1415 nmdc:mga0qj67_10871_c1
1416 nmdc:mga0sz30_14235_c1
1417 Ga0495601_0023250
1418 Ga0500635_0000030
1419 Ga0495619_0022578
1420 Ga0500578_0000025
1421 Ga0500562_015236
1422 Ga0500593_003896
1423 Ga0500595_018156
1424 Ga0500642_0032519
1425 Ga0500658_0001460
1426 Ga0500559_0005517
1427 Ga0500559_0012959
1428 Ga0500564_025252
1429 Ga0500568_0011402
1430 Ga0500568_0021802
1431 Ga0500590_035532
1432 Ga0500619_000014
1433 Ga0500622_0000890
1434 Ga0500622_0001306
1435 Ga0500622_0010205
1436 Ga0500636_0022800
1437 Ga0500661_003126
1438 Ga0466962_0002224
1439 2587725502
1440 2587734972
1441 2588290504
1442 2643970018
1443 2644143008
1444 2644164023
1445 2644244825
1446 2644271932
1447 2644338646
1448 2722881536
1449 2739249703
1450 2831864583
1451 2839144792
1452 2842678630
1453 2842733898
1454 2842752377
1455 2881103309
1456 2885193210
1457 2886851440
1458 2904452766
1459 2904460206
1460 2919463614
1461 2928117980
1462 2929525735
1463 2932424491
1464 2945945702
1465 2945975357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01551

Peptidase_M23

Peptidase family M23

391

486

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bh5-assembly4.cif.gz_D lytm domain of envc, an activator of cell wall amidases in escherichia coli 0.9574 311 406
4zyb-assembly3.cif.gz_C high resolution structure of m23 peptidase lytm with substrate analogue 0.9339 312 412
4qpb-assembly1.cif.gz_A catalytic domain of the antimicrobial peptidase lysostaphin from staphylococcus simulans crystallized in the absence of phosphate 0.9123 312 412
6tpi-assembly1.cif.gz_A envc bound to the ftsx periplasmic domain 0.8863 301 410
8tzl-assembly1.cif.gz_E cryo-em structure of vibrio cholerae ftse/ftsx/envc complex, full-length 0.8627 277 406
ID Description Score Start End Superfamily
4bh5D00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9574 311 406 2.70.70.10
af_O33599_157_316_2.70.70.10 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9548 311 409 2.70.70.10
1qwyA02 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.953 311 409 2.70.70.10
4zybC00 Mainly Beta;Distorted Sandwich;Glucose Permease (Domain IIA);Glucose Permease (Domain IIA) 0.9339 312 412 2.70.70.10
3sluA02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9247 172 280 3.10.450.350
ID Description Score Start End GO Terms
AF-A0A2S6U331-F1-model_v4 Peptidase M23 domain-containing protein 0.984 311 406 GO:0004222
AF-A0A1V2ZHL6-F1-model_v4 Peptidase M23 domain-containing protein 0.9788 313 405 GO:0004222
AF-A0A357N2G3-F1-model_v4 Peptidase M23 0.9773 331 406 GO:0004222
AF-A0A0G1P2M8-F1-model_v4 Peptidase M23 0.9752 332 406 GO:0004222
AF-A0A521UA26-F1-model_v4 M23 family metallopeptidase 0.9744 312 409 GO:0004222

Map