F478034
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 732 | 286 | 725 | 423 |
Family's Representative Sequence
| Representative Sequence | 3300025920|Ga0207649_10011117|Ga0207649_100111174 |
| Length | 366 |
| Sequence | MQVKANPNSAVIATLAKSGLGADVVSGGEYRRAIAAGVPSDKIVFSGVGKTEEEMRLALEGGLYQFNLESLSEAEMLSAVASSMGRTAPVGFRVNPDVGAGGHAKITTGAAENKFGIAIGEAIEAYARAAVLPRISVQGVAVHIGSQLTSLDPLKRAFRRVGELIAELRASGHDIAVADLGGGLGVPYDPDQPEEYGEMVRRIAGGWNARLVFEPGRLIVGNAGVLLSRVIRVKPGATDPFVIVDAAMNDLMRPALYDAWHRIEAVRPNSEMRVANVVGPVCETGDTFATARRMDEVAAGDLVVFRTAGAYAAAMSSTYNSRPLTPEVLVDGNKWAVVRPRIDVDRLIAGDRIPEWLSGCAQPSSS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 2 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 3 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 4 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 5 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 6 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 7 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 8 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 9 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 13 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 16 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 17 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 18 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 19 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 20 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 21 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 22 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 23 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 76 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 77 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 81 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 183 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 204 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 205 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 206 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 207 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 208 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 209 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 210 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 211 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 215 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 253 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 254 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 255 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 256 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 257 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 258 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 259 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 260 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 261 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 262 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 263 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 264 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 265 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 269 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 270 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 271 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 272 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 273 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 274 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 275 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 277 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 279 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 282 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 283 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 284 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 285 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 286 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.63 |
| Metatranscriptomes | 0.41 |
| Isolates | 0.96 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.46 |
| Nodule | 0 |
| Rhizoplane | 4.37 |
| Rhizosphere | 88.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.64 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000417 | 3300001904 | Bacteria | 8017 |
| 2 | JGI24752J21851_1000152 | 3300001976 | Bacteria | 9443 |
| 3 | JGI24740J21852_10001280 | 3300001979 | Bacteria | 11421 |
| 4 | JGI24739J22299_10016092 | 3300001989 | Bacteria | 2711 |
| 5 | JGI24739J22299_10048144 | 3300001989 | Bacteria | 1387 |
| 6 | JGI24737J22298_10000412 | 3300001990 | Bacteria | 14628 |
| 7 | JGI24737J22298_10002124 | 3300001990 | Bacteria | 7069 |
| 8 | JGI24737J22298_10008210 | 3300001990 | Bacteria | 3503 |
| 9 | JGI24743J22301_10004569 | 3300001991 | Bacteria | 2265 |
| 10 | JGI24735J21928_10004880 | 3300002067 | Bacteria | 4472 |
| 11 | JGI24750J21931_1000028 | 3300002070 | Bacteria | 19012 |
| 12 | JGI24745J21846_1002439 | 3300002073 | Bacteria | 1901 |
| 13 | JGI24748J21848_1000068 | 3300002074 | Bacteria | 37633 |
| 14 | JGI24738J21930_10008872 | 3300002075 | Bacteria | 2277 |
| 15 | JGI24749J21850_1000643 | 3300002076 | Bacteria | 5059 |
| 16 | JGI24744J21845_10001494 | 3300002077 | Bacteria | 4648 |
| 17 | JGI24034J26672_10000036 | 3300002239 | Bacteria | 84333 |
| 18 | JGI24742J22300_10001538 | 3300002244 | Bacteria | 3657 |
| 19 | JGI24742J22300_10001672 | 3300002244 | Bacteria | 3530 |
| 20 | JGI24751J29686_10000166 | 3300002459 | Bacteria | 30777 |
| 21 | rootL2_10273144 | 3300003322 | Bacteria | 1994 |
| 22 | Ga0065707_10081811 | 3300005295 | Bacteria | 37556 |
| 23 | Ga0070658_10001920 | 3300005327 | Bacteria | 17506 |
| 24 | Ga0070658_10049607 | 3300005327 | Bacteria | 3401 |
| 25 | Ga0070676_10001259 | 3300005328 | Bacteria | 12757 |
| 26 | Ga0070690_100000070 | 3300005330 | Bacteria | 50746 |
| 27 | Ga0070670_100000027 | 3300005331 | Bacteria | 186072 |
| 28 | Ga0070670_100000158 | 3300005331 | Bacteria | 62049 |
| 29 | Ga0070670_100016397 | 3300005331 | Bacteria | 6362 |
| 30 | Ga0070670_100041256 | 3300005331 | Bacteria | 3967 |
| 31 | Ga0070670_100139564 | 3300005331 | Bacteria | 2096 |
| 32 | Ga0070670_100145041 | 3300005331 | Bacteria | 2054 |
| 33 | Ga0070677_10010739 | 3300005333 | Bacteria | 3140 |
| 34 | Ga0068869_100002182 | 3300005334 | Bacteria | 11777 |
| 35 | Ga0070666_10000009 | 3300005335 | Bacteria | 279209 |
| 36 | Ga0070666_10003672 | 3300005335 | Bacteria | 9300 |
| 37 | Ga0070680_100000478 | 3300005336 | Bacteria | 27447 |
| 38 | Ga0070680_100004284 | 3300005336 | Bacteria | 10719 |
| 39 | Ga0070682_100015303 | 3300005337 | Bacteria | 4443 |
| 40 | Ga0068868_100000133 | 3300005338 | Bacteria | 47802 |
| 41 | Ga0068868_100007367 | 3300005338 | Bacteria | 7837 |
| 42 | Ga0068868_100026019 | 3300005338 | Bacteria | 4456 |
| 43 | Ga0068868_100042668 | 3300005338 | Bacteria | 3541 |
| 44 | Ga0068868_100086537 | 3300005338 | Bacteria | 2519 |
| 45 | Ga0070660_100001618 | 3300005339 | Bacteria | 15487 |
| 46 | Ga0070660_100003409 | 3300005339 | Bacteria | 10929 |
| 47 | Ga0070660_100004813 | 3300005339 | Bacteria | 9338 |
| 48 | Ga0070660_100006259 | 3300005339 | Bacteria | 8242 |
| 49 | Ga0070660_100017116 | 3300005339 | Bacteria | 5278 |
| 50 | Ga0070660_100020104 | 3300005339 | Bacteria | 4902 |
| 51 | Ga0070660_100104386 | 3300005339 | Bacteria | 2248 |
| 52 | Ga0070660_100154855 | 3300005339 | Bacteria | 1844 |
| 53 | Ga0070689_100048572 | 3300005340 | Bacteria | 3273 |
| 54 | Ga0070691_10001250 | 3300005341 | Bacteria | 10719 |
| 55 | Ga0070661_100000901 | 3300005344 | Bacteria | 21311 |
| 56 | Ga0070661_100023361 | 3300005344 | Bacteria | 4430 |
| 57 | Ga0070661_100032967 | 3300005344 | Bacteria | 3752 |
| 58 | Ga0070661_100044549 | 3300005344 | Bacteria | 3241 |
| 59 | Ga0070661_100071468 | 3300005344 | Bacteria | 2554 |
| 60 | Ga0070661_100077031 | 3300005344 | Bacteria | 2458 |
| 61 | Ga0070692_10021631 | 3300005345 | Bacteria | 3131 |
| 62 | Ga0070692_10070221 | 3300005345 | Bacteria | 1864 |
| 63 | Ga0070668_100000001 | 3300005347 | Bacteria | 275905 |
| 64 | Ga0070668_100003509 | 3300005347 | Bacteria | 11560 |
| 65 | Ga0070668_100082654 | 3300005347 | Bacteria | 2519 |
| 66 | Ga0070669_100000031 | 3300005353 | Bacteria | 154042 |
| 67 | Ga0070669_100003809 | 3300005353 | Bacteria | 10897 |
| 68 | Ga0070669_100030659 | 3300005353 | Bacteria | 3882 |
| 69 | Ga0070669_100062266 | 3300005353 | Bacteria | 2743 |
| 70 | Ga0070675_100021804 | 3300005354 | Bacteria | 5117 |
| 71 | Ga0070675_100030286 | 3300005354 | Bacteria | 4368 |
| 72 | Ga0070675_100065049 | 3300005354 | Bacteria | 3014 |
| 73 | Ga0070671_100000046 | 3300005355 | Bacteria | 84967 |
| 74 | Ga0070671_100002287 | 3300005355 | Bacteria | 14783 |
| 75 | Ga0070671_100011836 | 3300005355 | Bacteria | 7018 |
| 76 | Ga0070671_100014974 | 3300005355 | Bacteria | 6263 |
| 77 | Ga0070671_100023741 | 3300005355 | Bacteria | 5019 |
| 78 | Ga0070671_100029474 | 3300005355 | Bacteria | 4525 |
| 79 | Ga0070671_100082996 | 3300005355 | Bacteria | 2680 |
| 80 | Ga0070671_100115675 | 3300005355 | Bacteria | 2255 |
| 81 | Ga0070671_100181432 | 3300005355 | Bacteria | 1782 |
| 82 | Ga0070674_100002123 | 3300005356 | Bacteria | 10885 |
| 83 | Ga0070674_100020365 | 3300005356 | Bacteria | 4236 |
| 84 | Ga0070674_100038868 | 3300005356 | Bacteria | 3210 |
| 85 | Ga0070674_100054852 | 3300005356 | Bacteria | 2758 |
| 86 | Ga0070674_100057819 | 3300005356 | Bacteria | 2693 |
| 87 | Ga0070674_100115765 | 3300005356 | Bacteria | 1977 |
| 88 | Ga0070673_100000015 | 3300005364 | Bacteria | 118064 |
| 89 | Ga0070673_100002926 | 3300005364 | Bacteria | 10520 |
| 90 | Ga0070673_100005220 | 3300005364 | Bacteria | 8293 |
| 91 | Ga0070673_100005676 | 3300005364 | Bacteria | 8019 |
| 92 | Ga0070673_100100128 | 3300005364 | Bacteria | 2385 |
| 93 | Ga0070673_100201983 | 3300005364 | Bacteria | 1712 |
| 94 | Ga0070688_100000713 | 3300005365 | Bacteria | 16384 |
| 95 | Ga0070659_100002194 | 3300005366 | Bacteria | 13899 |
| 96 | Ga0070659_100005293 | 3300005366 | Bacteria | 9256 |
| 97 | Ga0070659_100015886 | 3300005366 | Bacteria | 5647 |
| 98 | Ga0070659_100018908 | 3300005366 | Bacteria | 5205 |
| 99 | Ga0070659_100035929 | 3300005366 | Bacteria | 3860 |
| 100 | Ga0070659_100053770 | 3300005366 | Bacteria | 3170 |
| 101 | Ga0070659_100067212 | 3300005366 | Bacteria | 2842 |
| 102 | Ga0070659_100116272 | 3300005366 | Bacteria | 2162 |
| 103 | Ga0070659_100219444 | 3300005366 | Bacteria | 1569 |
| 104 | Ga0070667_100000006 | 3300005367 | Bacteria | 336732 |
| 105 | Ga0070667_100000066 | 3300005367 | Bacteria | 134529 |
| 106 | Ga0070667_100000315 | 3300005367 | Bacteria | 54132 |
| 107 | Ga0070667_100007331 | 3300005367 | Bacteria | 9167 |
| 108 | Ga0070667_100009392 | 3300005367 | Bacteria | 8112 |
| 109 | Ga0070667_100012209 | 3300005367 | Bacteria | 7108 |
| 110 | Ga0070667_100022714 | 3300005367 | Bacteria | 5202 |
| 111 | Ga0070667_100030332 | 3300005367 | Bacteria | 4510 |
| 112 | Ga0070709_10008560 | 3300005434 | Bacteria | 5624 |
| 113 | Ga0070714_100032532 | 3300005435 | Bacteria | 4354 |
| 114 | Ga0070663_100003972 | 3300005455 | Bacteria | 8628 |
| 115 | Ga0070663_100074196 | 3300005455 | Bacteria | 2483 |
| 116 | Ga0070663_100111228 | 3300005455 | Bacteria | 2058 |
| 117 | Ga0070678_100002434 | 3300005456 | Bacteria | 10198 |
| 118 | Ga0070678_100018974 | 3300005456 | Bacteria | 4469 |
| 119 | Ga0070678_100315640 | 3300005456 | Bacteria | 1333 |
| 120 | Ga0070662_100001002 | 3300005457 | Bacteria | 17247 |
| 121 | Ga0070662_100023564 | 3300005457 | Bacteria | 4230 |
| 122 | Ga0070662_100024630 | 3300005457 | Bacteria | 4148 |
| 123 | Ga0070662_100106008 | 3300005457 | Bacteria | 2134 |
| 124 | Ga0070662_100179824 | 3300005457 | Bacteria | 1667 |
| 125 | Ga0068867_100000030 | 3300005459 | Bacteria | 86560 |
| 126 | Ga0068867_100024131 | 3300005459 | Bacteria | 4358 |
| 127 | Ga0068867_100083228 | 3300005459 | Bacteria | 2415 |
| 128 | Ga0070685_10000481 | 3300005466 | Bacteria | 23166 |
| 129 | Ga0070685_10017076 | 3300005466 | Bacteria | 3878 |
| 130 | Ga0070679_100000007 | 3300005530 | Bacteria | 195373 |
| 131 | Ga0070679_100044549 | 3300005530 | Bacteria | 4420 |
| 132 | Ga0070679_100306264 | 3300005530 | Bacteria | 1539 |
| 133 | Ga0070684_100017184 | 3300005535 | Bacteria | 5930 |
| 134 | Ga0068853_100004012 | 3300005539 | Bacteria | 11322 |
| 135 | Ga0068853_100009896 | 3300005539 | Bacteria | 7696 |
| 136 | Ga0068853_100012193 | 3300005539 | Bacteria | 6991 |
| 137 | Ga0068853_100080908 | 3300005539 | Bacteria | 2844 |
| 138 | Ga0068853_100083372 | 3300005539 | Bacteria | 2801 |
| 139 | Ga0068853_100100721 | 3300005539 | Bacteria | 2554 |
| 140 | Ga0070672_100017516 | 3300005543 | Bacteria | 5159 |
| 141 | Ga0070672_100028466 | 3300005543 | Bacteria | 4180 |
| 142 | Ga0070672_100113682 | 3300005543 | Bacteria | 2209 |
| 143 | Ga0070672_100121919 | 3300005543 | Bacteria | 2135 |
| 144 | Ga0070686_100000018 | 3300005544 | Bacteria | 140685 |
| 145 | Ga0070686_100000681 | 3300005544 | Bacteria | 19737 |
| 146 | Ga0070686_100012646 | 3300005544 | Bacteria | 4812 |
| 147 | Ga0070695_100056822 | 3300005545 | Bacteria | 2527 |
| 148 | Ga0070665_100000071 | 3300005548 | Bacteria | 200675 |
| 149 | Ga0070665_100005588 | 3300005548 | Bacteria | 12931 |
| 150 | Ga0070665_100079937 | 3300005548 | Bacteria | 3275 |
| 151 | Ga0068855_100234622 | 3300005563 | Bacteria | 2052 |
| 152 | Ga0068855_100329587 | 3300005563 | Bacteria | 1685 |
| 153 | Ga0070664_100005421 | 3300005564 | Bacteria | 10239 |
| 154 | Ga0070664_100007258 | 3300005564 | Bacteria | 8933 |
| 155 | Ga0070664_100090621 | 3300005564 | Bacteria | 2646 |
| 156 | Ga0070664_100109315 | 3300005564 | Bacteria | 2412 |
| 157 | Ga0070664_100116139 | 3300005564 | Bacteria | 2340 |
| 158 | Ga0070664_100123103 | 3300005564 | Bacteria | 2272 |
| 159 | Ga0068857_100016701 | 3300005577 | Bacteria | 6431 |
| 160 | Ga0068857_100084384 | 3300005577 | Bacteria | 2838 |
| 161 | Ga0068854_100000027 | 3300005578 | Bacteria | 117836 |
| 162 | Ga0068854_100013594 | 3300005578 | Bacteria | 5348 |
| 163 | Ga0068854_100016376 | 3300005578 | Bacteria | 4941 |
| 164 | Ga0068854_100088394 | 3300005578 | Bacteria | 2301 |
| 165 | Ga0068854_100134107 | 3300005578 | Bacteria | 1894 |
| 166 | Ga0068856_100010592 | 3300005614 | Bacteria | 8957 |
| 167 | Ga0068856_100036485 | 3300005614 | Bacteria | 4820 |
| 168 | Ga0068856_100043523 | 3300005614 | Bacteria | 4418 |
| 169 | Ga0068856_100363661 | 3300005614 | Bacteria | 1465 |
| 170 | Ga0068852_100001514 | 3300005616 | Bacteria | 15720 |
| 171 | Ga0068852_100013796 | 3300005616 | Bacteria | 6195 |
| 172 | Ga0068852_100015664 | 3300005616 | Bacteria | 5889 |
| 173 | Ga0068852_100036973 | 3300005616 | Bacteria | 4091 |
| 174 | Ga0068859_100003342 | 3300005617 | Bacteria | 16314 |
| 175 | Ga0068859_100047289 | 3300005617 | Bacteria | 4322 |
| 176 | Ga0068864_100000123 | 3300005618 | Bacteria | 75407 |
| 177 | Ga0068864_100001531 | 3300005618 | Bacteria | 19037 |
| 178 | Ga0068864_100002776 | 3300005618 | Bacteria | 14466 |
| 179 | Ga0068864_100004621 | 3300005618 | Bacteria | 11294 |
| 180 | Ga0068864_100014051 | 3300005618 | Bacteria | 6641 |
| 181 | Ga0068866_10046228 | 3300005718 | Bacteria | 2188 |
| 182 | Ga0068861_100026337 | 3300005719 | Bacteria | 4226 |
| 183 | Ga0068861_100084513 | 3300005719 | Bacteria | 2492 |
| 184 | Ga0068861_100154369 | 3300005719 | Bacteria | 1887 |
| 185 | Ga0068851_10014286 | 3300005834 | Bacteria | 3769 |
| 186 | Ga0068851_10022710 | 3300005834 | Bacteria | 3060 |
| 187 | Ga0068851_10042555 | 3300005834 | Bacteria | 2287 |
| 188 | Ga0068863_100000025 | 3300005841 | Bacteria | 186072 |
| 189 | Ga0068863_100000323 | 3300005841 | Bacteria | 48685 |
| 190 | Ga0068863_100002570 | 3300005841 | Bacteria | 17992 |
| 191 | Ga0068863_100004728 | 3300005841 | Bacteria | 13417 |
| 192 | Ga0068863_100005243 | 3300005841 | Bacteria | 12792 |
| 193 | Ga0068863_100011938 | 3300005841 | Bacteria | 8394 |
| 194 | Ga0068863_100130679 | 3300005841 | Bacteria | 2398 |
| 195 | Ga0068863_100251287 | 3300005841 | Bacteria | 1708 |
| 196 | Ga0068858_100000417 | 3300005842 | Bacteria | 44184 |
| 197 | Ga0068858_100001016 | 3300005842 | Bacteria | 28931 |
| 198 | Ga0068858_100006240 | 3300005842 | Bacteria | 11615 |
| 199 | Ga0068858_100010757 | 3300005842 | Bacteria | 8651 |
| 200 | Ga0068860_100000013 | 3300005843 | Bacteria | 323055 |
| 201 | Ga0068860_100000022 | 3300005843 | Bacteria | 279209 |
| 202 | Ga0068860_100000074 | 3300005843 | Bacteria | 173022 |
| 203 | Ga0068860_100067885 | 3300005843 | Bacteria | 3387 |
| 204 | Ga0068862_100000027 | 3300005844 | Bacteria | 186072 |
| 205 | Ga0068862_100000043 | 3300005844 | Bacteria | 164356 |
| 206 | Ga0068862_100000286 | 3300005844 | Bacteria | 55798 |
| 207 | Ga0068862_100000602 | 3300005844 | Bacteria | 37405 |
| 208 | Ga0081455_10000088 | 3300005937 | Bacteria | 98815 |
| 209 | Ga0081539_10069984 | 3300005985 | Bacteria | 1885 |
| 210 | Ga0075363_100012593 | 3300006048 | Bacteria | 4081 |
| 211 | Ga0070716_100027757 | 3300006173 | Bacteria | 3044 |
| 212 | Ga0075367_10022015 | 3300006178 | Bacteria | 3569 |
| 213 | Ga0075366_10122866 | 3300006195 | Bacteria | 1565 |
| 214 | Ga0097621_100002082 | 3300006237 | Bacteria | 13695 |
| 215 | Ga0097621_100005795 | 3300006237 | Bacteria | 8724 |
| 216 | Ga0075370_10005135 | 3300006353 | Bacteria | 6459 |
| 217 | Ga0075370_10026940 | 3300006353 | Bacteria | 3187 |
| 218 | Ga0068871_100011965 | 3300006358 | Bacteria | 6388 |
| 219 | Ga0075433_10028588 | 3300006852 | Bacteria | 4741 |
| 220 | Ga0068865_100000021 | 3300006881 | Bacteria | 103137 |
| 221 | Ga0068865_100003551 | 3300006881 | Bacteria | 9359 |
| 222 | Ga0068865_100171321 | 3300006881 | Bacteria | 1664 |
| 223 | Ga0097620_100003342 | 3300006931 | Bacteria | 16314 |
| 224 | Ga0097620_100047287 | 3300006931 | Bacteria | 4322 |
| 225 | Ga0105251_10000159 | 3300009011 | Bacteria | 68974 |
| 226 | Ga0105240_10152372 | 3300009093 | Bacteria | 2752 |
| 227 | Ga0105245_10036369 | 3300009098 | Bacteria | 4374 |
| 228 | Ga0105245_10208235 | 3300009098 | Bacteria | 1881 |
| 229 | Ga0105243_10000748 | 3300009148 | Bacteria | 31133 |
| 230 | Ga0105243_10047987 | 3300009148 | Bacteria | 3365 |
| 231 | Ga0105243_10161834 | 3300009148 | Bacteria | 1930 |
| 232 | Ga0105242_10000198 | 3300009176 | Bacteria | 46869 |
| 233 | Ga0105242_10069894 | 3300009176 | Bacteria | 2910 |
| 234 | Ga0105248_10000026 | 3300009177 | Bacteria | 257155 |
| 235 | Ga0105248_10002719 | 3300009177 | Bacteria | 19642 |
| 236 | Ga0105248_10006916 | 3300009177 | Bacteria | 12433 |
| 237 | Ga0105248_10009017 | 3300009177 | Bacteria | 10969 |
| 238 | Ga0105237_10009984 | 3300009545 | Bacteria | 10131 |
| 239 | Ga0105237_10086169 | 3300009545 | Bacteria | 3131 |
| 240 | Ga0105237_10119826 | 3300009545 | Bacteria | 2625 |
| 241 | Ga0105238_10010294 | 3300009551 | Bacteria | 9381 |
| 242 | Ga0105238_10010489 | 3300009551 | Bacteria | 9300 |
| 243 | Ga0105238_10105740 | 3300009551 | Bacteria | 2796 |
| 244 | Ga0105238_10191348 | 3300009551 | Bacteria | 2022 |
| 245 | Ga0105249_10000014 | 3300009553 | Bacteria | 283274 |
| 246 | Ga0105249_10000110 | 3300009553 | Bacteria | 111292 |
| 247 | Ga0105249_10059125 | 3300009553 | Bacteria | 3515 |
| 248 | Ga0105239_10038535 | 3300010375 | Bacteria | 5238 |
| 249 | Ga0105239_10079131 | 3300010375 | Bacteria | 3617 |
| 250 | Ga0105239_10286199 | 3300010375 | Bacteria | 1856 |
| 251 | Ga0105239_10300798 | 3300010375 | Bacteria | 1807 |
| 252 | Ga0105246_10002051 | 3300011119 | Bacteria | 12144 |
| 253 | Ga0105246_10032319 | 3300011119 | Bacteria | 3470 |
| 254 | Ga0105246_10034124 | 3300011119 | Bacteria | 3387 |
| 255 | Ga0157373_10003459 | 3300013100 | Bacteria | 11943 |
| 256 | Ga0157373_10048292 | 3300013100 | Bacteria | 3035 |
| 257 | Ga0157370_10122339 | 3300013104 | Bacteria | 2430 |
| 258 | Ga0157369_10001381 | 3300013105 | Bacteria | 29880 |
| 259 | Ga0157369_10079349 | 3300013105 | Bacteria | 3516 |
| 260 | Ga0157369_10286337 | 3300013105 | Bacteria | 1716 |
| 261 | Ga0157374_10003145 | 3300013296 | Bacteria | 13874 |
| 262 | Ga0157374_10166323 | 3300013296 | Bacteria | 2149 |
| 263 | Ga0157378_10010279 | 3300013297 | Bacteria | 8172 |
| 264 | Ga0157378_10068955 | 3300013297 | Bacteria | 3172 |
| 265 | Ga0157378_10078659 | 3300013297 | Bacteria | 2976 |
| 266 | Ga0163162_10027428 | 3300013306 | Bacteria | 5632 |
| 267 | Ga0163162_10066546 | 3300013306 | Bacteria | 3652 |
| 268 | Ga0163162_10188618 | 3300013306 | Bacteria | 2189 |
| 269 | Ga0157372_10009365 | 3300013307 | Bacteria | 10424 |
| 270 | Ga0157372_10112965 | 3300013307 | Bacteria | 3113 |
| 271 | Ga0157372_10194774 | 3300013307 | Bacteria | 2348 |
| 272 | Ga0157375_10002408 | 3300013308 | Bacteria | 16200 |
| 273 | Ga0157375_10007486 | 3300013308 | Bacteria | 9551 |
| 274 | Ga0157375_10021115 | 3300013308 | Bacteria | 5964 |
| 275 | Ga0157375_10056614 | 3300013308 | Bacteria | 3872 |
| 276 | Ga0157375_10088260 | 3300013308 | Bacteria | 3155 |
| 277 | Ga0163163_10029103 | 3300014325 | Bacteria | 5311 |
| 278 | Ga0157380_10000040 | 3300014326 | Bacteria | 76401 |
| 279 | Ga0157380_10000315 | 3300014326 | Bacteria | 29340 |
| 280 | Ga0157380_10000371 | 3300014326 | Bacteria | 27122 |
| 281 | Ga0157380_10243993 | 3300014326 | Bacteria | 1621 |
| 282 | Ga0157379_10006996 | 3300014968 | Bacteria | 9752 |
| 283 | Ga0157376_10000140 | 3300014969 | Bacteria | 49314 |
| 284 | Ga0163161_10000186 | 3300017792 | Bacteria | 57200 |
| 285 | Ga0206356_10876973 | 3300020070 | Bacteria | 1661 |
| 286 | Ga0206354_10216959 | 3300020081 | Bacteria | 3759 |
| 287 | Ga0206353_11106818 | 3300020082 | Bacteria | 6459 |
| 288 | Ga0213873_10000010 | 3300021358 | Bacteria | 223024 |
| 289 | Ga0213876_10000027 | 3300021384 | Bacteria | 223024 |
| 290 | Ga0213876_10003843 | 3300021384 | Bacteria | 8512 |
| 291 | Ga0213875_10000166 | 3300021388 | Bacteria | 68786 |
| 292 | Ga0209147_100298 | 3300025229 | Bacteria | 40972 |
| 293 | Ga0207656_10008550 | 3300025321 | Bacteria | 3773 |
| 294 | Ga0207713_1000491 | 3300025735 | Bacteria | 40778 |
| 295 | Ga0207682_10008709 | 3300025893 | Bacteria | 4013 |
| 296 | Ga0207710_10011345 | 3300025900 | Bacteria | 3751 |
| 297 | Ga0207688_10048536 | 3300025901 | Bacteria | 2372 |
| 298 | Ga0207680_10000007 | 3300025903 | Bacteria | 623574 |
| 299 | Ga0207680_10000821 | 3300025903 | Bacteria | 14643 |
| 300 | Ga0207680_10010099 | 3300025903 | Bacteria | 4712 |
| 301 | Ga0207680_10010579 | 3300025903 | Bacteria | 4620 |
| 302 | Ga0207647_10000627 | 3300025904 | Bacteria | 27507 |
| 303 | Ga0207647_10000748 | 3300025904 | Bacteria | 25450 |
| 304 | Ga0207647_10016672 | 3300025904 | Bacteria | 5008 |
| 305 | Ga0207647_10021518 | 3300025904 | Bacteria | 4304 |
| 306 | Ga0207647_10052537 | 3300025904 | Bacteria | 2515 |
| 307 | Ga0207647_10052658 | 3300025904 | Bacteria | 2511 |
| 308 | Ga0207699_10012553 | 3300025906 | Bacteria | 4311 |
| 309 | Ga0207645_10000523 | 3300025907 | Bacteria | 31917 |
| 310 | Ga0207705_10000025 | 3300025909 | Bacteria | 259826 |
| 311 | Ga0207705_10002730 | 3300025909 | Bacteria | 13529 |
| 312 | Ga0207705_10015976 | 3300025909 | Bacteria | 5389 |
| 313 | Ga0207705_10059980 | 3300025909 | Bacteria | 2747 |
| 314 | Ga0207654_10008184 | 3300025911 | Bacteria | 5274 |
| 315 | Ga0207695_10008658 | 3300025913 | Bacteria | 12698 |
| 316 | Ga0207695_10009684 | 3300025913 | Bacteria | 11865 |
| 317 | Ga0207671_10000350 | 3300025914 | Bacteria | 66648 |
| 318 | Ga0207671_10034430 | 3300025914 | Bacteria | 3762 |
| 319 | Ga0207660_10000536 | 3300025917 | Bacteria | 25438 |
| 320 | Ga0207660_10019298 | 3300025917 | Bacteria | 4555 |
| 321 | Ga0207657_10000594 | 3300025919 | Bacteria | 38336 |
| 322 | Ga0207657_10002675 | 3300025919 | Bacteria | 19218 |
| 323 | Ga0207657_10011581 | 3300025919 | Bacteria | 8749 |
| 324 | Ga0207657_10015100 | 3300025919 | Bacteria | 7501 |
| 325 | Ga0207657_10019526 | 3300025919 | Bacteria | 6433 |
| 326 | Ga0207657_10029764 | 3300025919 | Bacteria | 4965 |
| 327 | Ga0207657_10066617 | 3300025919 | Bacteria | 3065 |
| 328 | Ga0207657_10092883 | 3300025919 | Bacteria | 2514 |
| 329 | Ga0207657_10248180 | 3300025919 | Bacteria | 1420 |
| 330 | Ga0207649_10000074 | 3300025920 | Bacteria | 85018 |
| 331 | Ga0207649_10011117 | 3300025920 | Bacteria | 4955 |
| 332 | Ga0207649_10014515 | 3300025920 | Bacteria | 4412 |
| 333 | Ga0207652_10000001 | 3300025921 | Bacteria | 1006643 |
| 334 | Ga0207652_10000002 | 3300025921 | Bacteria | 878035 |
| 335 | Ga0207652_10014994 | 3300025921 | Bacteria | 6287 |
| 336 | Ga0207652_10095568 | 3300025921 | Bacteria | 2618 |
| 337 | Ga0207681_10000014 | 3300025923 | Bacteria | 353422 |
| 338 | Ga0207681_10000199 | 3300025923 | Bacteria | 47783 |
| 339 | Ga0207681_10015882 | 3300025923 | Bacteria | 4700 |
| 340 | Ga0207681_10018745 | 3300025923 | Bacteria | 4364 |
| 341 | Ga0207681_10049089 | 3300025923 | Bacteria | 2851 |
| 342 | Ga0207694_10004154 | 3300025924 | Bacteria | 11366 |
| 343 | Ga0207694_10095572 | 3300025924 | Bacteria | 2349 |
| 344 | Ga0207650_10000015 | 3300025925 | Bacteria | 369173 |
| 345 | Ga0207650_10000056 | 3300025925 | Bacteria | 157972 |
| 346 | Ga0207650_10005758 | 3300025925 | Bacteria | 8453 |
| 347 | Ga0207650_10061101 | 3300025925 | Bacteria | 2812 |
| 348 | Ga0207650_10069682 | 3300025925 | Bacteria | 2642 |
| 349 | Ga0207650_10151324 | 3300025925 | Bacteria | 1831 |
| 350 | Ga0207659_10012135 | 3300025926 | Bacteria | 5466 |
| 351 | Ga0207659_10019289 | 3300025926 | Bacteria | 4485 |
| 352 | Ga0207659_10088946 | 3300025926 | Bacteria | 2302 |
| 353 | Ga0207687_10029300 | 3300025927 | Bacteria | 3702 |
| 354 | Ga0207664_10039239 | 3300025929 | Bacteria | 3676 |
| 355 | Ga0207644_10000117 | 3300025931 | Bacteria | 58917 |
| 356 | Ga0207644_10000230 | 3300025931 | Bacteria | 38307 |
| 357 | Ga0207644_10000729 | 3300025931 | Bacteria | 20845 |
| 358 | Ga0207644_10001257 | 3300025931 | Bacteria | 16312 |
| 359 | Ga0207644_10004051 | 3300025931 | Bacteria | 9507 |
| 360 | Ga0207644_10009847 | 3300025931 | Bacteria | 6287 |
| 361 | Ga0207690_10002458 | 3300025932 | Bacteria | 11196 |
| 362 | Ga0207690_10017303 | 3300025932 | Bacteria | 4399 |
| 363 | Ga0207690_10084202 | 3300025932 | Bacteria | 2228 |
| 364 | Ga0207690_10103523 | 3300025932 | Bacteria | 2037 |
| 365 | Ga0207690_10164652 | 3300025932 | Bacteria | 1656 |
| 366 | Ga0207706_10003608 | 3300025933 | Bacteria | 14780 |
| 367 | Ga0207706_10011126 | 3300025933 | Bacteria | 8200 |
| 368 | Ga0207706_10034739 | 3300025933 | Bacteria | 4486 |
| 369 | Ga0207706_10035507 | 3300025933 | Bacteria | 4431 |
| 370 | Ga0207706_10036096 | 3300025933 | Bacteria | 4392 |
| 371 | Ga0207706_10099552 | 3300025933 | Bacteria | 2558 |
| 372 | Ga0207706_10117315 | 3300025933 | Bacteria | 2341 |
| 373 | Ga0207706_10132974 | 3300025933 | Bacteria | 2188 |
| 374 | Ga0207706_10146953 | 3300025933 | Bacteria | 2074 |
| 375 | Ga0207706_10181922 | 3300025933 | Bacteria | 1846 |
| 376 | Ga0207706_10214565 | 3300025933 | Bacteria | 1686 |
| 377 | Ga0207686_10000215 | 3300025934 | Bacteria | 44113 |
| 378 | Ga0207709_10000118 | 3300025935 | Bacteria | 122125 |
| 379 | Ga0207670_10004991 | 3300025936 | Bacteria | 7227 |
| 380 | Ga0207669_10025186 | 3300025937 | Bacteria | 3211 |
| 381 | Ga0207669_10041952 | 3300025937 | Bacteria | 2667 |
| 382 | Ga0207669_10046380 | 3300025937 | Bacteria | 2568 |
| 383 | Ga0207669_10067751 | 3300025937 | Bacteria | 2226 |
| 384 | Ga0207669_10162469 | 3300025937 | Bacteria | 1579 |
| 385 | Ga0207704_10000027 | 3300025938 | Bacteria | 122372 |
| 386 | Ga0207665_10022883 | 3300025939 | Bacteria | 4114 |
| 387 | Ga0207691_10006731 | 3300025940 | Bacteria | 11083 |
| 388 | Ga0207691_10010314 | 3300025940 | Bacteria | 8962 |
| 389 | Ga0207691_10015809 | 3300025940 | Bacteria | 7171 |
| 390 | Ga0207691_10032188 | 3300025940 | Bacteria | 4890 |
| 391 | Ga0207691_10047567 | 3300025940 | Bacteria | 3936 |
| 392 | Ga0207691_10152067 | 3300025940 | Bacteria | 2034 |
| 393 | Ga0207711_10000004 | 3300025941 | Bacteria | 870636 |
| 394 | Ga0207711_10000107 | 3300025941 | Bacteria | 87146 |
| 395 | Ga0207711_10000371 | 3300025941 | Bacteria | 47663 |
| 396 | Ga0207711_10000917 | 3300025941 | Bacteria | 28411 |
| 397 | Ga0207711_10002164 | 3300025941 | Bacteria | 17672 |
| 398 | Ga0207711_10013381 | 3300025941 | Bacteria | 6816 |
| 399 | Ga0207689_10000584 | 3300025942 | Bacteria | 34795 |
| 400 | Ga0207661_10047249 | 3300025944 | Bacteria | 3416 |
| 401 | Ga0207679_10002925 | 3300025945 | Bacteria | 10572 |
| 402 | Ga0207679_10004931 | 3300025945 | Bacteria | 8325 |
| 403 | Ga0207679_10006737 | 3300025945 | Bacteria | 7278 |
| 404 | Ga0207679_10036669 | 3300025945 | Bacteria | 3479 |
| 405 | Ga0207679_10112082 | 3300025945 | Bacteria | 2155 |
| 406 | Ga0207679_10197724 | 3300025945 | Bacteria | 1677 |
| 407 | Ga0207667_10003112 | 3300025949 | Bacteria | 20535 |
| 408 | Ga0207667_10016210 | 3300025949 | Bacteria | 8422 |
| 409 | Ga0207667_10024479 | 3300025949 | Bacteria | 6629 |
| 410 | Ga0207667_10097128 | 3300025949 | Bacteria | 3041 |
| 411 | Ga0207651_10000016 | 3300025960 | Bacteria | 122094 |
| 412 | Ga0207651_10000971 | 3300025960 | Bacteria | 12648 |
| 413 | Ga0207651_10004999 | 3300025960 | Bacteria | 6761 |
| 414 | Ga0207651_10007093 | 3300025960 | Bacteria | 5947 |
| 415 | Ga0207651_10033616 | 3300025960 | Bacteria | 3310 |
| 416 | Ga0207712_10000004 | 3300025961 | Bacteria | 614655 |
| 417 | Ga0207712_10000195 | 3300025961 | Bacteria | 62560 |
| 418 | Ga0207712_10000311 | 3300025961 | Bacteria | 44496 |
| 419 | Ga0207668_10000009 | 3300025972 | Bacteria | 188071 |
| 420 | Ga0207668_10004966 | 3300025972 | Bacteria | 7827 |
| 421 | Ga0207668_10008749 | 3300025972 | Bacteria | 6050 |
| 422 | Ga0207668_10019256 | 3300025972 | Bacteria | 4311 |
| 423 | Ga0207640_10000371 | 3300025981 | Bacteria | 29012 |
| 424 | Ga0207640_10007770 | 3300025981 | Bacteria | 5922 |
| 425 | Ga0207640_10028204 | 3300025981 | Bacteria | 3430 |
| 426 | Ga0207640_10031086 | 3300025981 | Bacteria | 3295 |
| 427 | Ga0207640_10080096 | 3300025981 | Bacteria | 2228 |
| 428 | Ga0207658_10000010 | 3300025986 | Bacteria | 240224 |
| 429 | Ga0207658_10000287 | 3300025986 | Bacteria | 52758 |
| 430 | Ga0207658_10000512 | 3300025986 | Bacteria | 35351 |
| 431 | Ga0207658_10000768 | 3300025986 | Bacteria | 27428 |
| 432 | Ga0207658_10003944 | 3300025986 | Bacteria | 10423 |
| 433 | Ga0207658_10005700 | 3300025986 | Bacteria | 8516 |
| 434 | Ga0207658_10017423 | 3300025986 | Bacteria | 4948 |
| 435 | Ga0207658_10096851 | 3300025986 | Bacteria | 2302 |
| 436 | Ga0207677_10000192 | 3300026023 | Bacteria | 49458 |
| 437 | Ga0207677_10006497 | 3300026023 | Bacteria | 6423 |
| 438 | Ga0207677_10049584 | 3300026023 | Bacteria | 2834 |
| 439 | Ga0207677_10088774 | 3300026023 | Bacteria | 2242 |
| 440 | Ga0207703_10000479 | 3300026035 | Bacteria | 41910 |
| 441 | Ga0207703_10001633 | 3300026035 | Bacteria | 20216 |
| 442 | Ga0207703_10006096 | 3300026035 | Bacteria | 9644 |
| 443 | Ga0207703_10040776 | 3300026035 | Bacteria | 3717 |
| 444 | Ga0207639_10003366 | 3300026041 | Bacteria | 10754 |
| 445 | Ga0207639_10006286 | 3300026041 | Bacteria | 8066 |
| 446 | Ga0207639_10012894 | 3300026041 | Bacteria | 5831 |
| 447 | Ga0207639_10014197 | 3300026041 | Bacteria | 5593 |
| 448 | Ga0207639_10054600 | 3300026041 | Bacteria | 3054 |
| 449 | Ga0207639_10059217 | 3300026041 | Bacteria | 2950 |
| 450 | Ga0207639_10149875 | 3300026041 | Bacteria | 1952 |
| 451 | Ga0207678_10011697 | 3300026067 | Bacteria | 7702 |
| 452 | Ga0207678_10024747 | 3300026067 | Bacteria | 5242 |
| 453 | Ga0207678_10045368 | 3300026067 | Bacteria | 3801 |
| 454 | Ga0207678_10057520 | 3300026067 | Bacteria | 3346 |
| 455 | Ga0207678_10072664 | 3300026067 | Bacteria | 2947 |
| 456 | Ga0207678_10104865 | 3300026067 | Bacteria | 2412 |
| 457 | Ga0207702_10003449 | 3300026078 | Bacteria | 14437 |
| 458 | Ga0207702_10005176 | 3300026078 | Bacteria | 11472 |
| 459 | Ga0207702_10009656 | 3300026078 | Bacteria | 8102 |
| 460 | Ga0207702_10383624 | 3300026078 | Bacteria | 1352 |
| 461 | Ga0207641_10000018 | 3300026088 | Bacteria | 298209 |
| 462 | Ga0207641_10000216 | 3300026088 | Bacteria | 74765 |
| 463 | Ga0207641_10000584 | 3300026088 | Bacteria | 40125 |
| 464 | Ga0207641_10002403 | 3300026088 | Bacteria | 17295 |
| 465 | Ga0207641_10017266 | 3300026088 | Bacteria | 5907 |
| 466 | Ga0207641_10021386 | 3300026088 | Bacteria | 5316 |
| 467 | Ga0207641_10024033 | 3300026088 | Bacteria | 5021 |
| 468 | Ga0207641_10036223 | 3300026088 | Bacteria | 4118 |
| 469 | Ga0207641_10112391 | 3300026088 | Bacteria | 2417 |
| 470 | Ga0207648_10000116 | 3300026089 | Bacteria | 77755 |
| 471 | Ga0207648_10004968 | 3300026089 | Bacteria | 13529 |
| 472 | Ga0207648_10005659 | 3300026089 | Bacteria | 12549 |
| 473 | Ga0207676_10000021 | 3300026095 | Bacteria | 296572 |
| 474 | Ga0207676_10000027 | 3300026095 | Bacteria | 245868 |
| 475 | Ga0207676_10002208 | 3300026095 | Bacteria | 14055 |
| 476 | Ga0207676_10002967 | 3300026095 | Bacteria | 12106 |
| 477 | Ga0207676_10007460 | 3300026095 | Bacteria | 7760 |
| 478 | Ga0207676_10016018 | 3300026095 | Bacteria | 5424 |
| 479 | Ga0207674_10000065 | 3300026116 | Bacteria | 109485 |
| 480 | Ga0207674_10003373 | 3300026116 | Bacteria | 19614 |
| 481 | Ga0207674_10024950 | 3300026116 | Bacteria | 6381 |
| 482 | Ga0207674_10038465 | 3300026116 | Bacteria | 4963 |
| 483 | Ga0207675_100000777 | 3300026118 | Bacteria | 31865 |
| 484 | Ga0207675_100003380 | 3300026118 | Bacteria | 15596 |
| 485 | Ga0207675_100056121 | 3300026118 | Bacteria | 3674 |
| 486 | Ga0207675_100143806 | 3300026118 | Bacteria | 2267 |
| 487 | Ga0207683_10002092 | 3300026121 | Bacteria | 17578 |
| 488 | Ga0207683_10030447 | 3300026121 | Bacteria | 4677 |
| 489 | Ga0207698_10000116 | 3300026142 | Bacteria | 49993 |
| 490 | Ga0207698_10001553 | 3300026142 | Bacteria | 13380 |
| 491 | Ga0207698_10097892 | 3300026142 | Bacteria | 2422 |
| 492 | Ga0209813_10000468 | 3300027866 | Bacteria | 9700 |
| 493 | Ga0268266_10000040 | 3300028379 | Bacteria | 323843 |
| 494 | Ga0268266_10017275 | 3300028379 | Bacteria | 6159 |
| 495 | Ga0268266_10071681 | 3300028379 | Bacteria | 3003 |
| 496 | Ga0268266_10147933 | 3300028379 | Bacteria | 2114 |
| 497 | Ga0268266_10260066 | 3300028379 | Bacteria | 1608 |
| 498 | Ga0268265_10000013 | 3300028380 | Bacteria | 341536 |
| 499 | Ga0268265_10000042 | 3300028380 | Bacteria | 186086 |
| 500 | Ga0268265_10000294 | 3300028380 | Bacteria | 56208 |
| 501 | Ga0268265_10000324 | 3300028380 | Bacteria | 52110 |
| 502 | Ga0268264_10000003 | 3300028381 | Bacteria | 1141976 |
| 503 | Ga0268264_10000039 | 3300028381 | Bacteria | 376641 |
| 504 | Ga0268264_10000070 | 3300028381 | Bacteria | 268524 |
| 505 | Ga0268264_10003561 | 3300028381 | Bacteria | 13410 |
| 506 | Ga0268264_10035653 | 3300028381 | Bacteria | 4095 |
| 507 | Ga0307408_100187469 | 3300031548 | Bacteria | 1664 |
| 508 | Ga0307408_100218984 | 3300031548 | Bacteria | 1552 |
| 509 | Ga0307405_10077121 | 3300031731 | Bacteria | 2164 |
| 510 | Ga0307405_10171692 | 3300031731 | Bacteria | 1547 |
| 511 | Ga0307410_10016039 | 3300031852 | Bacteria | 4456 |
| 512 | Ga0307410_10027751 | 3300031852 | Bacteria | 3580 |
| 513 | Ga0307406_10147757 | 3300031901 | Bacteria | 1673 |
| 514 | Ga0307412_10009822 | 3300031911 | Bacteria | 5496 |
| 515 | Ga0307412_10022920 | 3300031911 | Bacteria | 3834 |
| 516 | Ga0307409_100031642 | 3300031995 | Bacteria | 3822 |
| 517 | Ga0307409_100095582 | 3300031995 | Bacteria | 2449 |
| 518 | Ga0307416_100000451 | 3300032002 | Bacteria | 21079 |
| 519 | Ga0307414_10188259 | 3300032004 | Bacteria | 1667 |
| 520 | Ga0307411_10016140 | 3300032005 | Bacteria | 4222 |
| 521 | Ga0373954_0038206 | 3300035118 | Bacteria | 2232 |
| 522 | Ga0373955_0065392 | 3300035172 | Bacteria | 2019 |
| 523 | Ga0373935_0111026 | 3300035692 | Bacteria | 1820 |
| 524 | Ga0373927_0062106 | 3300035695 | Bacteria | 2416 |
| 525 | Ga0373947_0072005 | 3300035725 | Bacteria | 2121 |
| 526 | Ga0373925_0035087 | 3300037068 | Bacteria | 3699 |
| 527 | Ga0395899_0000113 | 3300037312 | Bacteria | 136163 |
| 528 | Ga0395899_0003756 | 3300037312 | Bacteria | 11991 |
| 529 | Ga0395899_0011074 | 3300037312 | Bacteria | 6907 |
| 530 | Ga0395899_0014804 | 3300037312 | Bacteria | 5953 |
| 531 | Ga0395899_0099019 | 3300037312 | Bacteria | 2106 |
| 532 | Ga0395899_0198413 | 3300037312 | Bacteria | 1401 |
| 533 | Ga0395900_0005823 | 3300037418 | Bacteria | 12875 |
| 534 | Ga0395900_0009694 | 3300037418 | Bacteria | 9868 |
| 535 | Ga0395900_0013203 | 3300037418 | Bacteria | 8444 |
| 536 | Ga0395900_0016968 | 3300037418 | Bacteria | 7431 |
| 537 | Ga0395900_0017452 | 3300037418 | Bacteria | 7327 |
| 538 | Ga0395900_0049587 | 3300037418 | Bacteria | 4325 |
| 539 | Ga0395900_0084351 | 3300037418 | Bacteria | 3264 |
| 540 | Ga0395900_0121935 | 3300037418 | Bacteria | 2674 |
| 541 | Ga0395900_0156331 | 3300037418 | Bacteria | 2329 |
| 542 | Ga0395900_0163281 | 3300037418 | Bacteria | 2271 |
| 543 | Ga0395900_0433894 | 3300037418 | Bacteria | 1272 |
| 544 | Ga0395898_0000306 | 3300037466 | Bacteria | 115940 |
| 545 | Ga0395898_0001326 | 3300037466 | Bacteria | 35892 |
| 546 | Ga0395898_0005605 | 3300037466 | Bacteria | 13532 |
| 547 | Ga0395898_0014197 | 3300037466 | Bacteria | 8191 |
| 548 | Ga0395898_0015973 | 3300037466 | Bacteria | 7691 |
| 549 | Ga0395898_0017925 | 3300037466 | Bacteria | 7224 |
| 550 | Ga0395898_0034479 | 3300037466 | Bacteria | 5044 |
| 551 | Ga0395898_0086885 | 3300037466 | Bacteria | 3013 |
| 552 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 553 | Ga0395905_0000958 | 3300037471 | Bacteria | 37063 |
| 554 | Ga0395905_0001046 | 3300037471 | Bacteria | 35041 |
| 555 | Ga0395905_0001585 | 3300037471 | Bacteria | 27082 |
| 556 | Ga0395905_0010210 | 3300037471 | Bacteria | 9150 |
| 557 | Ga0395905_0010767 | 3300037471 | Bacteria | 8864 |
| 558 | Ga0395905_0010864 | 3300037471 | Bacteria | 8818 |
| 559 | Ga0395905_0016800 | 3300037471 | Bacteria | 6952 |
| 560 | Ga0395905_0017713 | 3300037471 | Bacteria | 6763 |
| 561 | Ga0395905_0021098 | 3300037471 | Bacteria | 6169 |
| 562 | Ga0395905_0022485 | 3300037471 | Bacteria | 5963 |
| 563 | Ga0395905_0024565 | 3300037471 | Bacteria | 5687 |
| 564 | Ga0395905_0081103 | 3300037471 | Bacteria | 3040 |
| 565 | Ga0395905_0095924 | 3300037471 | Bacteria | 2784 |
| 566 | Ga0395905_0158549 | 3300037471 | Bacteria | 2128 |
| 567 | Ga0395905_0188144 | 3300037471 | Bacteria | 1937 |
| 568 | Ga0395905_0233620 | 3300037471 | Bacteria | 1719 |
| 569 | Ga0395905_0291905 | 3300037471 | Bacteria | 1517 |
| 570 | Ga0436364_0545952 | 3300037853 | Bacteria | 79385 |
| 571 | Ga0395901_0002169 | 3300038443 | Bacteria | 20042 |
| 572 | Ga0395901_0007143 | 3300038443 | Bacteria | 11272 |
| 573 | Ga0395901_0011649 | 3300038443 | Bacteria | 8906 |
| 574 | Ga0395901_0018318 | 3300038443 | Bacteria | 7149 |
| 575 | Ga0395901_0033170 | 3300038443 | Bacteria | 5328 |
| 576 | Ga0395901_0116375 | 3300038443 | Bacteria | 2808 |
| 577 | Ga0395901_0142808 | 3300038443 | Bacteria | 2516 |
| 578 | Ga0395901_0188110 | 3300038443 | Bacteria | 2165 |
| 579 | Ga0395901_0190683 | 3300038443 | Bacteria | 2150 |
| 580 | Ga0395901_0388375 | 3300038443 | Bacteria | 1435 |
| 581 | Ga0436365_0234449 | 3300039437 | Bacteria | 99419 |
| 582 | Ga0436365_0257345 | 3300039437 | Bacteria | 14502 |
| 583 | Ga0436365_1536714 | 3300039437 | Bacteria | 19921 |
| 584 | Ga0436365_1577285 | 3300039437 | Bacteria | 4503 |
| 585 | Ga0436362_0553655 | 3300039453 | Bacteria | 122937 |
| 586 | Ga0451853_1219635 | 3300041512 | Bacteria | 1969 |
| 587 | Ga0439448_0002715 | 3300042005 | Bacteria | 4840 |
| 588 | Ga0439448_0011074 | 3300042005 | Bacteria | 2683 |
| 589 | Ga0439432_025571 | 3300042006 | Bacteria | 1936 |
| 590 | Ga0439449_0011365 | 3300042007 | Bacteria | 3350 |
| 591 | Ga0439455_0001188 | 3300042012 | Bacteria | 4232 |
| 592 | Ga0439458_0000636 | 3300042157 | Bacteria | 9077 |
| 593 | Ga0439458_0003580 | 3300042157 | Bacteria | 3623 |
| 594 | Ga0466969_0002833 | 3300044656 | Bacteria | 9276 |
| 595 | Ga0466972_0002118 | 3300044658 | Bacteria | 9742 |
| 596 | Ga0466972_0081581 | 3300044658 | Bacteria | 1540 |
| 597 | Ga0466966_0047414 | 3300044684 | Bacteria | 2740 |
| 598 | Ga0466966_0085199 | 3300044684 | Bacteria | 1964 |
| 599 | Ga0466963_0054244 | 3300044694 | Bacteria | 2663 |
| 600 | Ga0466964_0020584 | 3300044706 | Bacteria | 2542 |
| 601 | Ga0466971_0020675 | 3300044719 | Bacteria | 2926 |
| 602 | Ga0466971_0024385 | 3300044719 | Bacteria | 2699 |
| 603 | Ga0466971_0039941 | 3300044719 | Bacteria | 2107 |
| 604 | Ga0466970_0002773 | 3300044765 | Bacteria | 8455 |
| 605 | Ga0466970_0004904 | 3300044765 | Bacteria | 6606 |
| 606 | Ga0466957_0001053 | 3300044842 | Bacteria | 14217 |
| 607 | Ga0466957_0068693 | 3300044842 | Bacteria | 2188 |
| 608 | Ga0466957_0089149 | 3300044842 | Bacteria | 1931 |
| 609 | Ga0466960_0017036 | 3300044901 | Bacteria | 3162 |
| 610 | Ga0466960_0017817 | 3300044901 | Bacteria | 3104 |
| 611 | Ga0466959_0022449 | 3300045049 | Bacteria | 4666 |
| 612 | Ga0466959_0041638 | 3300045049 | Bacteria | 3390 |
| 613 | Ga0466959_0046724 | 3300045049 | Bacteria | 3185 |
| 614 | Ga0466958_0005075 | 3300045836 | Bacteria | 7035 |
| 615 | Ga0466958_0029566 | 3300045836 | Bacteria | 3251 |
| 616 | Ga0466967_0145127 | 3300045976 | Bacteria | 2213 |
| 617 | Ga0466967_0148693 | 3300045976 | Bacteria | 2187 |
| 618 | Ga0466967_0209156 | 3300045976 | Bacteria | 1850 |
| 619 | Ga0466967_0350196 | 3300045976 | Bacteria | 1429 |
| 620 | Ga0495617_006653 | 3300046452 | Bacteria | 4040 |
| 621 | Ga0495627_000024 | 3300046453 | Bacteria | 250480 |
| 622 | Ga0495610_0000053 | 3300046512 | Bacteria | 142545 |
| 623 | Ga0495637_0002826 | 3300046520 | Bacteria | 9411 |
| 624 | Ga0495648_0009993 | 3300046524 | Bacteria | 7279 |
| 625 | Ga0495648_0060033 | 3300046524 | Bacteria | 2265 |
| 626 | Ga0495663_0011834 | 3300046525 | Bacteria | 2431 |
| 627 | Ga0495663_0043540 | 3300046525 | Bacteria | 1371 |
| 628 | Ga0495654_0000620 | 3300046530 | Bacteria | 28271 |
| 629 | Ga0495598_0000194 | 3300046537 | Bacteria | 10705 |
| 630 | Ga0495621_0002136 | 3300046539 | Bacteria | 5246 |
| 631 | Ga0495668_0001088 | 3300046616 | Bacteria | 28328 |
| 632 | Ga0495668_0023290 | 3300046616 | Bacteria | 3534 |
| 633 | Ga0495668_0048007 | 3300046616 | Bacteria | 2369 |
| 634 | Ga0495668_0093322 | 3300046616 | Bacteria | 1648 |
| 635 | Ga0495669_0000599 | 3300046684 | Bacteria | 15785 |
| 636 | Ga0495669_0001837 | 3300046684 | Bacteria | 8692 |
| 637 | Ga0495669_0030328 | 3300046684 | Bacteria | 2374 |
| 638 | Ga0495670_0038423 | 3300046691 | Bacteria | 2386 |
| 639 | Ga0495683_0070833 | 3300047323 | Bacteria | 1712 |
| 640 | Ga0495681_0000099 | 3300047470 | Bacteria | 75808 |
| 641 | Ga0495681_0001636 | 3300047470 | Bacteria | 16634 |
| 642 | Ga0495686_0119377 | 3300047472 | Bacteria | 1573 |
| 643 | Ga0495602_0016614 | 3300048088 | Bacteria | 7398 |
| 644 | Ga0496100_0088838 | 3300048903 | Bacteria | 2104 |
| 645 | Ga0496101_0000533 | 3300048904 | Bacteria | 23349 |
| 646 | Ga0496101_0037290 | 3300048904 | Bacteria | 3448 |
| 647 | Ga0496102_0000010 | 3300048905 | Bacteria | 324617 |
| 648 | Ga0496102_0036921 | 3300048905 | Bacteria | 4405 |
| 649 | Ga0496102_0194181 | 3300048905 | Bacteria | 1913 |
| 650 | Ga0496103_0000029 | 3300048906 | Bacteria | 213326 |
| 651 | Ga0496103_0001191 | 3300048906 | Bacteria | 17849 |
| 652 | Ga0496103_0064099 | 3300048906 | Bacteria | 2290 |
| 653 | Ga0496104_0017717 | 3300048907 | Bacteria | 6492 |
| 654 | Ga0496105_0004359 | 3300048908 | Bacteria | 10652 |
| 655 | Ga0496106_0007216 | 3300048909 | Bacteria | 8210 |
| 656 | Ga0496106_0063212 | 3300048909 | Bacteria | 2813 |
| 657 | Ga0496107_0005864 | 3300048910 | Bacteria | 8410 |
| 658 | Ga0496107_0079859 | 3300048910 | Bacteria | 2385 |
| 659 | Ga0496107_0133137 | 3300048910 | Bacteria | 1836 |
| 660 | Ga0496108_0000482 | 3300048911 | Bacteria | 31959 |
| 661 | Ga0496108_0004124 | 3300048911 | Bacteria | 11674 |
| 662 | Ga0496108_0006891 | 3300048911 | Bacteria | 9196 |
| 663 | Ga0496108_0224247 | 3300048911 | Bacteria | 1633 |
| 664 | Ga0496109_0002603 | 3300048912 | Bacteria | 15119 |
| 665 | Ga0496109_0027863 | 3300048912 | Bacteria | 5049 |
| 666 | Ga0496110_0000347 | 3300048913 | Bacteria | 30884 |
| 667 | Ga0496110_0006617 | 3300048913 | Bacteria | 9207 |
| 668 | Ga0496110_0080420 | 3300048913 | Bacteria | 2904 |
| 669 | Ga0496111_0010584 | 3300048914 | Bacteria | 6197 |
| 670 | Ga0496112_0003652 | 3300048915 | Bacteria | 12820 |
| 671 | Ga0496112_0005111 | 3300048915 | Bacteria | 11272 |
| 672 | Ga0496112_0006181 | 3300048915 | Bacteria | 10476 |
| 673 | Ga0496112_0008504 | 3300048915 | Bacteria | 9196 |
| 674 | Ga0496113_0018020 | 3300048916 | Bacteria | 4912 |
| 675 | Ga0496113_0171660 | 3300048916 | Bacteria | 1717 |
| 676 | Ga0496116_0000942 | 3300048919 | Bacteria | 35835 |
| 677 | Ga0496116_0049461 | 3300048919 | Bacteria | 2812 |
| 678 | Ga0496117_0000037 | 3300048920 | Bacteria | 324960 |
| 679 | Ga0496117_0007661 | 3300048920 | Bacteria | 10460 |
| 680 | Ga0496117_0062597 | 3300048920 | Bacteria | 2549 |
| 681 | Ga0496118_0000034 | 3300048921 | Bacteria | 322764 |
| 682 | Ga0496118_0000689 | 3300048921 | Bacteria | 54897 |
| 683 | Ga0496118_0010460 | 3300048921 | Bacteria | 9187 |
| 684 | Ga0496119_0015128 | 3300048922 | Bacteria | 5972 |
| 685 | Ga0496119_0016847 | 3300048922 | Bacteria | 5531 |
| 686 | Ga0496120_0011194 | 3300048923 | Bacteria | 6191 |
| 687 | Ga0496120_0018136 | 3300048923 | Bacteria | 4544 |
| 688 | Ga0496121_0001024 | 3300048924 | Bacteria | 49819 |
| 689 | Ga0496121_0051640 | 3300048924 | Bacteria | 3461 |
| 690 | Ga0496122_0001502 | 3300048925 | Bacteria | 37251 |
| 691 | Ga0496123_0002683 | 3300048926 | Bacteria | 21419 |
| 692 | Ga0496124_0000033 | 3300048927 | Bacteria | 330586 |
| 693 | Ga0496124_0097996 | 3300048927 | Bacteria | 2379 |
| 694 | Ga0496125_0008402 | 3300048928 | Bacteria | 10816 |
| 695 | Ga0496125_0050350 | 3300048928 | Bacteria | 3450 |
| 696 | Ga0496125_0066069 | 3300048928 | Bacteria | 2861 |
| 697 | Ga0496125_0071020 | 3300048928 | Bacteria | 2722 |
| 698 | Ga0496126_0022584 | 3300048929 | Bacteria | 6117 |
| 699 | Ga0501290_000215 | 3300049513 | Bacteria | 9570 |
| 700 | Ga0501292_000181 | 3300049515 | Bacteria | 10084 |
| 701 | Ga0501046_0040917 | 3300049580 | Bacteria | 3701 |
| 702 | Ga0501068_0060266 | 3300049584 | Bacteria | 2304 |
| 703 | Ga0501227_005214 | 3300049665 | Bacteria | 2786 |
| 704 | Ga0501235_002586 | 3300049669 | Bacteria | 3892 |
| 705 | Ga0501261_000172 | 3300049690 | Bacteria | 9210 |
| 706 | Ga0501225_0002320 | 3300049705 | Bacteria | 5876 |
| 707 | Ga0501234_008130 | 3300049707 | Bacteria | 1640 |
| 708 | Ga0501245_001140 | 3300049708 | Bacteria | 3426 |
| 709 | Ga0501279_000144 | 3300049775 | Bacteria | 10040 |
| 710 | Ga0501280_000005 | 3300049776 | Bacteria | 85174 |
| 711 | Ga0501044_0140596 | 3300049823 | Bacteria | 2403 |
| 712 | nmdc:mga0k408_39192_c1 | 3300050493 | Bacteria | 2721 |
| 713 | nmdc:mga06z11_348_c1 | 3300050494 | Bacteria | 17434 |
| 714 | nmdc:mga04h51_137_c1 | 3300050495 | Bacteria | 21470 |
| 715 | nmdc:mga07m45_43381_c1 | 3300050496 | Bacteria | 2521 |
| 716 | nmdc:mga07m45_64284_c1 | 3300050496 | Bacteria | 2082 |
| 717 | nmdc:mga0a205_802_c1 | 3300050515 | Bacteria | 25500 |
| 718 | Ga0500643_000305 | 3300053087 | Bacteria | 40867 |
| 719 | Ga0500562_010370 | 3300053108 | Bacteria | 2362 |
| 720 | Ga0500592_000757 | 3300053116 | Bacteria | 5295 |
| 721 | Ga0500592_009042 | 3300053116 | Bacteria | 1582 |
| 722 | Ga0500624_000018 | 3300053157 | Bacteria | 131677 |
| 723 | Ga0500627_0000110 | 3300053158 | Bacteria | 26911 |
| 724 | Ga0466962_0004085 | 3300061719 | Bacteria | 6991 |
| 725 | Ga0466962_0008275 | 3300061719 | Bacteria | 4983 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025920 | Ga0207649_10011117 | Ga0207649_100111174 | 357 |
| 2 | 3300045976 | Ga0466967_0350196 | Ga0466967_0350196_13_1122 | 360 |
| 3 | 3300047323 | Ga0495683_0070833 | Ga0495683_0070833_480_1598 | 362 |
| 4 | 3300003322 | rootL2_10273144 | rootL2_102731443 | 363 |
| 5 | 3300021358 | Ga0213873_10000010 | Ga0213873_10000010122 | 381 |
| 6 | 3300021384 | Ga0213876_10000027 | Ga0213876_10000027122 | 381 |
| 7 | 3300039437 | Ga0436365_0234449 | Ga0436365_0234449_90300_91559 | 381 |
| 8 | 3300039453 | Ga0436362_0553655 | Ga0436362_0553655_60478_61737 | 381 |
| 9 | 3300025933 | Ga0207706_10146953 | Ga0207706_101469533 | 383 |
| 10 | 3300037418 | Ga0395900_0433894 | Ga0395900_0433894_82_1260 | 383 |
| 11 | 3300045049 | Ga0466959_0046724 | Ga0466959_0046724_46_1224 | 383 |
| 12 | 3300049707 | Ga0501234_008130 | Ga0501234_008130_235_1467 | 391 |
| 13 | 3300025919 | Ga0207657_10066617 | Ga0207657_100666173 | 393 |
| 14 | 3300005338 | Ga0068868_100086537 | Ga0068868_1000865372 | 398 |
| 15 | 3300005344 | Ga0070661_100077031 | Ga0070661_1000770312 | 398 |
| 16 | 3300005577 | Ga0068857_100084384 | Ga0068857_1000843842 | 398 |
| 17 | 3300006852 | Ga0075433_10028588 | Ga0075433_100285883 | 398 |
| 18 | 3300026023 | Ga0207677_10088774 | Ga0207677_100887742 | 398 |
| 19 | 3300026088 | Ga0207641_10112391 | Ga0207641_101123912 | 398 |
| 20 | 3300026116 | Ga0207674_10024950 | Ga0207674_100249504 | 398 |
| 21 | 3300050515 | nmdc:mga0a205_802_c1 | nmdc:mga0a205_802_c1_7615_8901 | 398 |
| 22 | 3300047472 | Ga0495686_0119377 | Ga0495686_0119377_144_1433 | 399 |
| 23 | 3300011119 | Ga0105246_10034124 | Ga0105246_100341242 | 400 |
| 24 | 3300005347 | Ga0070668_100082654 | Ga0070668_1000826542 | 401 |
| 25 | 3300005366 | Ga0070659_100002194 | Ga0070659_10000219412 | 401 |
| 26 | 3300005457 | Ga0070662_100001002 | Ga0070662_10000100216 | 401 |
| 27 | 3300005543 | Ga0070672_100028466 | Ga0070672_1000284663 | 401 |
| 28 | 3300005563 | Ga0068855_100329587 | Ga0068855_1003295871 | 401 |
| 29 | 3300005843 | Ga0068860_100067885 | Ga0068860_1000678852 | 401 |
| 30 | 3300009093 | Ga0105240_10152372 | Ga0105240_101523722 | 401 |
| 31 | 3300010375 | Ga0105239_10079131 | Ga0105239_100791313 | 401 |
| 32 | 3300013308 | Ga0157375_10056614 | Ga0157375_100566143 | 401 |
| 33 | 3300025904 | Ga0207647_10000627 | Ga0207647_100006273 | 401 |
| 34 | 3300025933 | Ga0207706_10011126 | Ga0207706_100111267 | 401 |
| 35 | 3300025961 | Ga0207712_10000195 | Ga0207712_1000019542 | 401 |
| 36 | 3300028381 | Ga0268264_10003561 | Ga0268264_100035619 | 401 |
| 37 | 3300005366 | Ga0070659_100035929 | Ga0070659_1000359292 | 402 |
| 38 | 3300005344 | Ga0070661_100023361 | Ga0070661_1000233613 | 403 |
| 39 | 3300005543 | Ga0070672_100113682 | Ga0070672_1001136822 | 403 |
| 40 | 3300005545 | Ga0070695_100056822 | Ga0070695_1000568222 | 403 |
| 41 | 3300009148 | Ga0105243_10161834 | Ga0105243_101618342 | 403 |
| 42 | 3300025893 | Ga0207682_10008709 | Ga0207682_100087092 | 403 |
| 43 | 3300025920 | Ga0207649_10014515 | Ga0207649_100145153 | 403 |
| 44 | 3300025925 | Ga0207650_10151324 | Ga0207650_101513242 | 403 |
| 45 | 3300025933 | Ga0207706_10034739 | Ga0207706_100347392 | 403 |
| 46 | 3300025940 | Ga0207691_10047567 | Ga0207691_100475672 | 403 |
| 47 | 3300025945 | Ga0207679_10004931 | Ga0207679_100049316 | 403 |
| 48 | 3300002067 | JGI24735J21928_10004880 | JGI24735J21928_100048803 | 404 |
| 49 | 3300005331 | Ga0070670_100016397 | Ga0070670_1000163972 | 404 |
| 50 | 3300005336 | Ga0070680_100004284 | Ga0070680_1000042844 | 404 |
| 51 | 3300005337 | Ga0070682_100015303 | Ga0070682_1000153033 | 404 |
| 52 | 3300005339 | Ga0070660_100006259 | Ga0070660_1000062596 | 404 |
| 53 | 3300005341 | Ga0070691_10001250 | Ga0070691_100012505 | 404 |
| 54 | 3300005344 | Ga0070661_100044549 | Ga0070661_1000445491 | 404 |
| 55 | 3300005355 | Ga0070671_100002287 | Ga0070671_1000022877 | 404 |
| 56 | 3300005356 | Ga0070674_100038868 | Ga0070674_1000388682 | 404 |
| 57 | 3300005364 | Ga0070673_100201983 | Ga0070673_1002019832 | 404 |
| 58 | 3300005366 | Ga0070659_100005293 | Ga0070659_1000052931 | 404 |
| 59 | 3300005457 | Ga0070662_100023564 | Ga0070662_1000235644 | 404 |
| 60 | 3300005535 | Ga0070684_100017184 | Ga0070684_1000171843 | 404 |
| 61 | 3300005539 | Ga0068853_100004012 | Ga0068853_1000040125 | 404 |
| 62 | 3300005564 | Ga0070664_100007258 | Ga0070664_1000072589 | 404 |
| 63 | 3300005578 | Ga0068854_100013594 | Ga0068854_1000135943 | 404 |
| 64 | 3300005614 | Ga0068856_100010592 | Ga0068856_1000105923 | 404 |
| 65 | 3300005616 | Ga0068852_100036973 | Ga0068852_1000369732 | 404 |
| 66 | 3300005618 | Ga0068864_100001531 | Ga0068864_10000153110 | 404 |
| 67 | 3300005834 | Ga0068851_10022710 | Ga0068851_100227103 | 404 |
| 68 | 3300009177 | Ga0105248_10002719 | Ga0105248_1000271911 | 404 |
| 69 | 3300009545 | Ga0105237_10009984 | Ga0105237_100099844 | 404 |
| 70 | 3300009551 | Ga0105238_10010294 | Ga0105238_100102949 | 404 |
| 71 | 3300013307 | Ga0157372_10009365 | Ga0157372_100093659 | 404 |
| 72 | 3300025904 | Ga0207647_10016672 | Ga0207647_100166723 | 404 |
| 73 | 3300025909 | Ga0207705_10002730 | Ga0207705_100027308 | 404 |
| 74 | 3300025913 | Ga0207695_10008658 | Ga0207695_100086587 | 404 |
| 75 | 3300025914 | Ga0207671_10034430 | Ga0207671_100344303 | 404 |
| 76 | 3300025917 | Ga0207660_10019298 | Ga0207660_100192983 | 404 |
| 77 | 3300025919 | Ga0207657_10000594 | Ga0207657_100005949 | 404 |
| 78 | 3300025921 | Ga0207652_10095568 | Ga0207652_100955682 | 404 |
| 79 | 3300025931 | Ga0207644_10001257 | Ga0207644_1000125715 | 404 |
| 80 | 3300025932 | Ga0207690_10002458 | Ga0207690_100024584 | 404 |
| 81 | 3300025933 | Ga0207706_10035507 | Ga0207706_100355072 | 404 |
| 82 | 3300025937 | Ga0207669_10067751 | Ga0207669_100677512 | 404 |
| 83 | 3300025944 | Ga0207661_10047249 | Ga0207661_100472491 | 404 |
| 84 | 3300025949 | Ga0207667_10003112 | Ga0207667_100031127 | 404 |
| 85 | 3300025981 | Ga0207640_10007770 | Ga0207640_100077705 | 404 |
| 86 | 3300026041 | Ga0207639_10003366 | Ga0207639_100033664 | 404 |
| 87 | 3300026067 | Ga0207678_10024747 | Ga0207678_100247473 | 404 |
| 88 | 3300026078 | Ga0207702_10005176 | Ga0207702_100051769 | 404 |
| 89 | 3300026088 | Ga0207641_10021386 | Ga0207641_100213867 | 404 |
| 90 | 3300026116 | Ga0207674_10003373 | Ga0207674_1000337315 | 404 |
| 91 | 3300026142 | Ga0207698_10001553 | Ga0207698_100015531 | 404 |
| 92 | 3300037312 | Ga0395899_0011074 | Ga0395899_0011074_3007_4293 | 404 |
| 93 | 3300037312 | Ga0395899_0198413 | Ga0395899_0198413_124_1365 | 404 |
| 94 | 3300037466 | Ga0395898_0005605 | Ga0395898_0005605_5400_6686 | 404 |
| 95 | 3300048911 | Ga0496108_0004124 | Ga0496108_0004124_6655_7941 | 404 |
| 96 | 3300048915 | Ga0496112_0006181 | Ga0496112_0006181_5435_6721 | 404 |
| 97 | 3300005356 | Ga0070674_100115765 | Ga0070674_1001157651 | 405 |
| 98 | 3300005539 | Ga0068853_100083372 | Ga0068853_1000833723 | 405 |
| 99 | 3300013307 | Ga0157372_10194774 | Ga0157372_101947742 | 405 |
| 100 | 3300014326 | Ga0157380_10243993 | Ga0157380_102439932 | 405 |
| 101 | 3300020081 | Ga0206354_10216959 | Ga0206354_102169593 | 405 |
| 102 | 3300020082 | Ga0206353_11106818 | Ga0206353_111068182 | 405 |
| 103 | 3300025937 | Ga0207669_10041952 | Ga0207669_100419522 | 405 |
| 104 | 3300025940 | Ga0207691_10032188 | Ga0207691_100321884 | 405 |
| 105 | 3300037418 | Ga0395900_0156331 | Ga0395900_0156331_771_2045 | 405 |
| 106 | 3300048911 | Ga0496108_0224247 | Ga0496108_0224247_282_1550 | 408 |
| 107 | 3300001904 | JGI24736J21556_1000417 | JGI24736J21556_10004174 | 409 |
| 108 | 3300001976 | JGI24752J21851_1000152 | JGI24752J21851_10001527 | 409 |
| 109 | 3300001979 | JGI24740J21852_10001280 | JGI24740J21852_100012803 | 409 |
| 110 | 3300001989 | JGI24739J22299_10016092 | JGI24739J22299_100160922 | 409 |
| 111 | 3300001989 | JGI24739J22299_10048144 | JGI24739J22299_100481441 | 409 |
| 112 | 3300001990 | JGI24737J22298_10000412 | JGI24737J22298_100004127 | 409 |
| 113 | 3300001990 | JGI24737J22298_10002124 | JGI24737J22298_100021242 | 409 |
| 114 | 3300001990 | JGI24737J22298_10008210 | JGI24737J22298_100082102 | 409 |
| 115 | 3300001991 | JGI24743J22301_10004569 | JGI24743J22301_100045692 | 409 |
| 116 | 3300002070 | JGI24750J21931_1000028 | JGI24750J21931_100002814 | 409 |
| 117 | 3300002073 | JGI24745J21846_1002439 | JGI24745J21846_10024392 | 409 |
| 118 | 3300002074 | JGI24748J21848_1000068 | JGI24748J21848_100006812 | 409 |
| 119 | 3300002075 | JGI24738J21930_10008872 | JGI24738J21930_100088722 | 409 |
| 120 | 3300002076 | JGI24749J21850_1000643 | JGI24749J21850_10006436 | 409 |
| 121 | 3300002077 | JGI24744J21845_10001494 | JGI24744J21845_100014943 | 409 |
| 122 | 3300002239 | JGI24034J26672_10000036 | JGI24034J26672_1000003611 | 409 |
| 123 | 3300002244 | JGI24742J22300_10001538 | JGI24742J22300_100015384 | 409 |
| 124 | 3300002244 | JGI24742J22300_10001672 | JGI24742J22300_100016724 | 409 |
| 125 | 3300002459 | JGI24751J29686_10000166 | JGI24751J29686_100001664 | 409 |
| 126 | 3300005295 | Ga0065707_10081811 | Ga0065707_1008181120 | 409 |
| 127 | 3300005327 | Ga0070658_10001920 | Ga0070658_1000192010 | 409 |
| 128 | 3300005327 | Ga0070658_10049607 | Ga0070658_100496074 | 409 |
| 129 | 3300005328 | Ga0070676_10001259 | Ga0070676_100012599 | 409 |
| 130 | 3300005330 | Ga0070690_100000070 | Ga0070690_10000007018 | 409 |
| 131 | 3300005331 | Ga0070670_100000027 | Ga0070670_10000002739 | 409 |
| 132 | 3300005331 | Ga0070670_100000158 | Ga0070670_10000015850 | 409 |
| 133 | 3300005331 | Ga0070670_100041256 | Ga0070670_1000412564 | 409 |
| 134 | 3300005331 | Ga0070670_100139564 | Ga0070670_1001395642 | 409 |
| 135 | 3300005331 | Ga0070670_100145041 | Ga0070670_1001450412 | 409 |
| 136 | 3300005333 | Ga0070677_10010739 | Ga0070677_100107393 | 409 |
| 137 | 3300005334 | Ga0068869_100002182 | Ga0068869_1000021822 | 409 |
| 138 | 3300005335 | Ga0070666_10000009 | Ga0070666_1000000936 | 409 |
| 139 | 3300005335 | Ga0070666_10003672 | Ga0070666_100036726 | 409 |
| 140 | 3300005336 | Ga0070680_100000478 | Ga0070680_1000004785 | 409 |
| 141 | 3300005338 | Ga0068868_100000133 | Ga0068868_10000013315 | 409 |
| 142 | 3300005338 | Ga0068868_100007367 | Ga0068868_1000073673 | 409 |
| 143 | 3300005338 | Ga0068868_100026019 | Ga0068868_1000260192 | 409 |
| 144 | 3300005338 | Ga0068868_100042668 | Ga0068868_1000426681 | 409 |
| 145 | 3300005339 | Ga0070660_100001618 | Ga0070660_10000161812 | 409 |
| 146 | 3300005339 | Ga0070660_100003409 | Ga0070660_1000034094 | 409 |
| 147 | 3300005339 | Ga0070660_100004813 | Ga0070660_1000048133 | 409 |
| 148 | 3300005339 | Ga0070660_100017116 | Ga0070660_1000171162 | 409 |
| 149 | 3300005339 | Ga0070660_100020104 | Ga0070660_1000201045 | 409 |
| 150 | 3300005339 | Ga0070660_100104386 | Ga0070660_1001043862 | 409 |
| 151 | 3300005339 | Ga0070660_100154855 | Ga0070660_1001548552 | 409 |
| 152 | 3300005340 | Ga0070689_100048572 | Ga0070689_1000485722 | 409 |
| 153 | 3300005344 | Ga0070661_100000901 | Ga0070661_1000009016 | 409 |
| 154 | 3300005344 | Ga0070661_100032967 | Ga0070661_1000329672 | 409 |
| 155 | 3300005344 | Ga0070661_100071468 | Ga0070661_1000714683 | 409 |
| 156 | 3300005345 | Ga0070692_10021631 | Ga0070692_100216312 | 409 |
| 157 | 3300005345 | Ga0070692_10070221 | Ga0070692_100702211 | 409 |
| 158 | 3300005347 | Ga0070668_100000001 | Ga0070668_1000000013 | 409 |
| 159 | 3300005347 | Ga0070668_100003509 | Ga0070668_1000035096 | 409 |
| 160 | 3300005353 | Ga0070669_100000031 | Ga0070669_100000031126 | 409 |
| 161 | 3300005353 | Ga0070669_100003809 | Ga0070669_1000038095 | 409 |
| 162 | 3300005353 | Ga0070669_100030659 | Ga0070669_1000306593 | 409 |
| 163 | 3300005353 | Ga0070669_100062266 | Ga0070669_1000622663 | 409 |
| 164 | 3300005354 | Ga0070675_100021804 | Ga0070675_1000218046 | 409 |
| 165 | 3300005354 | Ga0070675_100030286 | Ga0070675_1000302862 | 409 |
| 166 | 3300005354 | Ga0070675_100065049 | Ga0070675_1000650492 | 409 |
| 167 | 3300005355 | Ga0070671_100000046 | Ga0070671_10000004619 | 409 |
| 168 | 3300005355 | Ga0070671_100011836 | Ga0070671_1000118365 | 409 |
| 169 | 3300005355 | Ga0070671_100014974 | Ga0070671_1000149742 | 409 |
| 170 | 3300005355 | Ga0070671_100023741 | Ga0070671_1000237413 | 409 |
| 171 | 3300005355 | Ga0070671_100029474 | Ga0070671_1000294743 | 409 |
| 172 | 3300005355 | Ga0070671_100082996 | Ga0070671_1000829962 | 409 |
| 173 | 3300005355 | Ga0070671_100115675 | Ga0070671_1001156752 | 409 |
| 174 | 3300005355 | Ga0070671_100181432 | Ga0070671_1001814322 | 409 |
| 175 | 3300005356 | Ga0070674_100002123 | Ga0070674_1000021236 | 409 |
| 176 | 3300005356 | Ga0070674_100020365 | Ga0070674_1000203652 | 409 |
| 177 | 3300005356 | Ga0070674_100054852 | Ga0070674_1000548523 | 409 |
| 178 | 3300005356 | Ga0070674_100057819 | Ga0070674_1000578192 | 409 |
| 179 | 3300005364 | Ga0070673_100000015 | Ga0070673_10000001528 | 409 |
| 180 | 3300005364 | Ga0070673_100002926 | Ga0070673_1000029269 | 409 |
| 181 | 3300005364 | Ga0070673_100005220 | Ga0070673_1000052206 | 409 |
| 182 | 3300005364 | Ga0070673_100005676 | Ga0070673_1000056762 | 409 |
| 183 | 3300005364 | Ga0070673_100100128 | Ga0070673_1001001282 | 409 |
| 184 | 3300005365 | Ga0070688_100000713 | Ga0070688_1000007135 | 409 |
| 185 | 3300005366 | Ga0070659_100015886 | Ga0070659_1000158862 | 409 |
| 186 | 3300005366 | Ga0070659_100018908 | Ga0070659_1000189083 | 409 |
| 187 | 3300005366 | Ga0070659_100053770 | Ga0070659_1000537703 | 409 |
| 188 | 3300005366 | Ga0070659_100067212 | Ga0070659_1000672122 | 409 |
| 189 | 3300005366 | Ga0070659_100116272 | Ga0070659_1001162722 | 409 |
| 190 | 3300005366 | Ga0070659_100219444 | Ga0070659_1002194442 | 409 |
| 191 | 3300005367 | Ga0070667_100000006 | Ga0070667_100000006230 | 409 |
| 192 | 3300005367 | Ga0070667_100000066 | Ga0070667_10000006621 | 409 |
| 193 | 3300005367 | Ga0070667_100000315 | Ga0070667_10000031526 | 409 |
| 194 | 3300005367 | Ga0070667_100007331 | Ga0070667_1000073315 | 409 |
| 195 | 3300005367 | Ga0070667_100009392 | Ga0070667_1000093923 | 409 |
| 196 | 3300005367 | Ga0070667_100012209 | Ga0070667_1000122092 | 409 |
| 197 | 3300005367 | Ga0070667_100022714 | Ga0070667_1000227146 | 409 |
| 198 | 3300005367 | Ga0070667_100030332 | Ga0070667_1000303322 | 409 |
| 199 | 3300005434 | Ga0070709_10008560 | Ga0070709_100085602 | 409 |
| 200 | 3300005435 | Ga0070714_100032532 | Ga0070714_1000325325 | 409 |
| 201 | 3300005455 | Ga0070663_100003972 | Ga0070663_1000039727 | 409 |
| 202 | 3300005455 | Ga0070663_100074196 | Ga0070663_1000741962 | 409 |
| 203 | 3300005455 | Ga0070663_100111228 | Ga0070663_1001112282 | 409 |
| 204 | 3300005456 | Ga0070678_100002434 | Ga0070678_1000024346 | 409 |
| 205 | 3300005456 | Ga0070678_100018974 | Ga0070678_1000189742 | 409 |
| 206 | 3300005456 | Ga0070678_100315640 | Ga0070678_1003156401 | 409 |
| 207 | 3300005457 | Ga0070662_100024630 | Ga0070662_1000246303 | 409 |
| 208 | 3300005457 | Ga0070662_100106008 | Ga0070662_1001060082 | 409 |
| 209 | 3300005457 | Ga0070662_100179824 | Ga0070662_1001798242 | 409 |
| 210 | 3300005459 | Ga0068867_100000030 | Ga0068867_10000003054 | 409 |
| 211 | 3300005459 | Ga0068867_100024131 | Ga0068867_1000241314 | 409 |
| 212 | 3300005459 | Ga0068867_100083228 | Ga0068867_1000832282 | 409 |
| 213 | 3300005466 | Ga0070685_10000481 | Ga0070685_1000048112 | 409 |
| 214 | 3300005466 | Ga0070685_10017076 | Ga0070685_100170763 | 409 |
| 215 | 3300005530 | Ga0070679_100000007 | Ga0070679_100000007131 | 409 |
| 216 | 3300005530 | Ga0070679_100044549 | Ga0070679_1000445492 | 409 |
| 217 | 3300005530 | Ga0070679_100306264 | Ga0070679_1003062641 | 409 |
| 218 | 3300005539 | Ga0068853_100009896 | Ga0068853_1000098966 | 409 |
| 219 | 3300005539 | Ga0068853_100012193 | Ga0068853_1000121931 | 409 |
| 220 | 3300005539 | Ga0068853_100080908 | Ga0068853_1000809082 | 409 |
| 221 | 3300005539 | Ga0068853_100100721 | Ga0068853_1001007212 | 409 |
| 222 | 3300005543 | Ga0070672_100017516 | Ga0070672_1000175165 | 409 |
| 223 | 3300005543 | Ga0070672_100121919 | Ga0070672_1001219192 | 409 |
| 224 | 3300005544 | Ga0070686_100000018 | Ga0070686_10000001811 | 409 |
| 225 | 3300005544 | Ga0070686_100000681 | Ga0070686_10000068112 | 409 |
| 226 | 3300005544 | Ga0070686_100012646 | Ga0070686_1000126462 | 409 |
| 227 | 3300005548 | Ga0070665_100000071 | Ga0070665_100000071154 | 409 |
| 228 | 3300005548 | Ga0070665_100005588 | Ga0070665_10000558811 | 409 |
| 229 | 3300005548 | Ga0070665_100079937 | Ga0070665_1000799372 | 409 |
| 230 | 3300005563 | Ga0068855_100234622 | Ga0068855_1002346221 | 409 |
| 231 | 3300005564 | Ga0070664_100005421 | Ga0070664_1000054216 | 409 |
| 232 | 3300005564 | Ga0070664_100090621 | Ga0070664_1000906212 | 409 |
| 233 | 3300005564 | Ga0070664_100109315 | Ga0070664_1001093152 | 409 |
| 234 | 3300005564 | Ga0070664_100116139 | Ga0070664_1001161392 | 409 |
| 235 | 3300005564 | Ga0070664_100123103 | Ga0070664_1001231033 | 409 |
| 236 | 3300005577 | Ga0068857_100016701 | Ga0068857_1000167014 | 409 |
| 237 | 3300005578 | Ga0068854_100000027 | Ga0068854_10000002749 | 409 |
| 238 | 3300005578 | Ga0068854_100016376 | Ga0068854_1000163764 | 409 |
| 239 | 3300005578 | Ga0068854_100088394 | Ga0068854_1000883942 | 409 |
| 240 | 3300005578 | Ga0068854_100134107 | Ga0068854_1001341072 | 409 |
| 241 | 3300005614 | Ga0068856_100036485 | Ga0068856_1000364853 | 409 |
| 242 | 3300005614 | Ga0068856_100043523 | Ga0068856_1000435233 | 409 |
| 243 | 3300005614 | Ga0068856_100363661 | Ga0068856_1003636611 | 409 |
| 244 | 3300005616 | Ga0068852_100001514 | Ga0068852_10000151411 | 409 |
| 245 | 3300005616 | Ga0068852_100013796 | Ga0068852_1000137963 | 409 |
| 246 | 3300005616 | Ga0068852_100015664 | Ga0068852_1000156646 | 409 |
| 247 | 3300005617 | Ga0068859_100003342 | Ga0068859_10000334212 | 409 |
| 248 | 3300005617 | Ga0068859_100047289 | Ga0068859_1000472892 | 409 |
| 249 | 3300005618 | Ga0068864_100000123 | Ga0068864_10000012350 | 409 |
| 250 | 3300005618 | Ga0068864_100002776 | Ga0068864_1000027763 | 409 |
| 251 | 3300005618 | Ga0068864_100004621 | Ga0068864_1000046217 | 409 |
| 252 | 3300005618 | Ga0068864_100014051 | Ga0068864_1000140513 | 409 |
| 253 | 3300005718 | Ga0068866_10046228 | Ga0068866_100462282 | 409 |
| 254 | 3300005719 | Ga0068861_100026337 | Ga0068861_1000263373 | 409 |
| 255 | 3300005719 | Ga0068861_100084513 | Ga0068861_1000845132 | 409 |
| 256 | 3300005719 | Ga0068861_100154369 | Ga0068861_1001543691 | 409 |
| 257 | 3300005834 | Ga0068851_10014286 | Ga0068851_100142864 | 409 |
| 258 | 3300005834 | Ga0068851_10042555 | Ga0068851_100425552 | 409 |
| 259 | 3300005841 | Ga0068863_100000025 | Ga0068863_100000025173 | 409 |
| 260 | 3300005841 | Ga0068863_100000323 | Ga0068863_10000032332 | 409 |
| 261 | 3300005841 | Ga0068863_100002570 | Ga0068863_1000025706 | 409 |
| 262 | 3300005841 | Ga0068863_100004728 | Ga0068863_1000047283 | 409 |
| 263 | 3300005841 | Ga0068863_100005243 | Ga0068863_1000052434 | 409 |
| 264 | 3300005841 | Ga0068863_100011938 | Ga0068863_1000119382 | 409 |
| 265 | 3300005841 | Ga0068863_100130679 | Ga0068863_1001306792 | 409 |
| 266 | 3300005841 | Ga0068863_100251287 | Ga0068863_1002512872 | 409 |
| 267 | 3300005842 | Ga0068858_100000417 | Ga0068858_10000041712 | 409 |
| 268 | 3300005842 | Ga0068858_100001016 | Ga0068858_1000010168 | 409 |
| 269 | 3300005842 | Ga0068858_100006240 | Ga0068858_1000062403 | 409 |
| 270 | 3300005842 | Ga0068858_100010757 | Ga0068858_1000107572 | 409 |
| 271 | 3300005843 | Ga0068860_100000013 | Ga0068860_100000013140 | 409 |
| 272 | 3300005843 | Ga0068860_100000022 | Ga0068860_10000002237 | 409 |
| 273 | 3300005843 | Ga0068860_100000074 | Ga0068860_10000007471 | 409 |
| 274 | 3300005844 | Ga0068862_100000027 | Ga0068862_10000002740 | 409 |
| 275 | 3300005844 | Ga0068862_100000043 | Ga0068862_100000043142 | 409 |
| 276 | 3300005844 | Ga0068862_100000286 | Ga0068862_10000028615 | 409 |
| 277 | 3300005844 | Ga0068862_100000602 | Ga0068862_1000006027 | 409 |
| 278 | 3300005937 | Ga0081455_10000088 | Ga0081455_1000008844 | 409 |
| 279 | 3300005985 | Ga0081539_10069984 | Ga0081539_100699842 | 409 |
| 280 | 3300006048 | Ga0075363_100012593 | Ga0075363_1000125934 | 409 |
| 281 | 3300006173 | Ga0070716_100027757 | Ga0070716_1000277572 | 409 |
| 282 | 3300006178 | Ga0075367_10022015 | Ga0075367_100220153 | 409 |
| 283 | 3300006195 | Ga0075366_10122866 | Ga0075366_101228662 | 409 |
| 284 | 3300006237 | Ga0097621_100002082 | Ga0097621_1000020828 | 409 |
| 285 | 3300006237 | Ga0097621_100005795 | Ga0097621_1000057957 | 409 |
| 286 | 3300006353 | Ga0075370_10005135 | Ga0075370_100051355 | 409 |
| 287 | 3300006353 | Ga0075370_10026940 | Ga0075370_100269403 | 409 |
| 288 | 3300006358 | Ga0068871_100011965 | Ga0068871_1000119653 | 409 |
| 289 | 3300006881 | Ga0068865_100000021 | Ga0068865_10000002128 | 409 |
| 290 | 3300006881 | Ga0068865_100003551 | Ga0068865_1000035519 | 409 |
| 291 | 3300006881 | Ga0068865_100171321 | Ga0068865_1001713212 | 409 |
| 292 | 3300006931 | Ga0097620_100003342 | Ga0097620_10000334212 | 409 |
| 293 | 3300006931 | Ga0097620_100047287 | Ga0097620_1000472872 | 409 |
| 294 | 3300009011 | Ga0105251_10000159 | Ga0105251_1000015940 | 409 |
| 295 | 3300009098 | Ga0105245_10036369 | Ga0105245_100363694 | 409 |
| 296 | 3300009098 | Ga0105245_10208235 | Ga0105245_102082352 | 409 |
| 297 | 3300009148 | Ga0105243_10000748 | Ga0105243_1000074810 | 409 |
| 298 | 3300009148 | Ga0105243_10047987 | Ga0105243_100479871 | 409 |
| 299 | 3300009176 | Ga0105242_10000198 | Ga0105242_1000019819 | 409 |
| 300 | 3300009176 | Ga0105242_10069894 | Ga0105242_100698942 | 409 |
| 301 | 3300009177 | Ga0105248_10000026 | Ga0105248_10000026189 | 409 |
| 302 | 3300009177 | Ga0105248_10006916 | Ga0105248_100069167 | 409 |
| 303 | 3300009177 | Ga0105248_10009017 | Ga0105248_100090176 | 409 |
| 304 | 3300009545 | Ga0105237_10086169 | Ga0105237_100861693 | 409 |
| 305 | 3300009545 | Ga0105237_10119826 | Ga0105237_101198263 | 409 |
| 306 | 3300009551 | Ga0105238_10010489 | Ga0105238_100104892 | 409 |
| 307 | 3300009551 | Ga0105238_10105740 | Ga0105238_101057403 | 409 |
| 308 | 3300009551 | Ga0105238_10191348 | Ga0105238_101913482 | 409 |
| 309 | 3300009553 | Ga0105249_10000014 | Ga0105249_1000001437 | 409 |
| 310 | 3300009553 | Ga0105249_10000110 | Ga0105249_1000011053 | 409 |
| 311 | 3300009553 | Ga0105249_10059125 | Ga0105249_100591252 | 409 |
| 312 | 3300010375 | Ga0105239_10038535 | Ga0105239_100385356 | 409 |
| 313 | 3300010375 | Ga0105239_10286199 | Ga0105239_102861993 | 409 |
| 314 | 3300010375 | Ga0105239_10300798 | Ga0105239_103007982 | 409 |
| 315 | 3300011119 | Ga0105246_10002051 | Ga0105246_100020514 | 409 |
| 316 | 3300011119 | Ga0105246_10032319 | Ga0105246_100323193 | 409 |
| 317 | 3300013100 | Ga0157373_10003459 | Ga0157373_100034592 | 409 |
| 318 | 3300013100 | Ga0157373_10048292 | Ga0157373_100482922 | 409 |
| 319 | 3300013104 | Ga0157370_10122339 | Ga0157370_101223393 | 409 |
| 320 | 3300013105 | Ga0157369_10001381 | Ga0157369_100013812 | 409 |
| 321 | 3300013105 | Ga0157369_10079349 | Ga0157369_100793492 | 409 |
| 322 | 3300013105 | Ga0157369_10286337 | Ga0157369_102863372 | 409 |
| 323 | 3300013296 | Ga0157374_10003145 | Ga0157374_100031456 | 409 |
| 324 | 3300013296 | Ga0157374_10166323 | Ga0157374_101663232 | 409 |
| 325 | 3300013297 | Ga0157378_10010279 | Ga0157378_100102792 | 409 |
| 326 | 3300013297 | Ga0157378_10068955 | Ga0157378_100689553 | 409 |
| 327 | 3300013297 | Ga0157378_10078659 | Ga0157378_100786591 | 409 |
| 328 | 3300013306 | Ga0163162_10027428 | Ga0163162_100274287 | 409 |
| 329 | 3300013306 | Ga0163162_10066546 | Ga0163162_100665464 | 409 |
| 330 | 3300013306 | Ga0163162_10188618 | Ga0163162_101886182 | 409 |
| 331 | 3300013307 | Ga0157372_10112965 | Ga0157372_101129651 | 409 |
| 332 | 3300013308 | Ga0157375_10002408 | Ga0157375_1000240810 | 409 |
| 333 | 3300013308 | Ga0157375_10007486 | Ga0157375_100074863 | 409 |
| 334 | 3300013308 | Ga0157375_10021115 | Ga0157375_100211156 | 409 |
| 335 | 3300013308 | Ga0157375_10088260 | Ga0157375_100882602 | 409 |
| 336 | 3300014325 | Ga0163163_10029103 | Ga0163163_100291035 | 409 |
| 337 | 3300014326 | Ga0157380_10000040 | Ga0157380_1000004029 | 409 |
| 338 | 3300014326 | Ga0157380_10000315 | Ga0157380_1000031516 | 409 |
| 339 | 3300014326 | Ga0157380_10000371 | Ga0157380_1000037111 | 409 |
| 340 | 3300014968 | Ga0157379_10006996 | Ga0157379_100069965 | 409 |
| 341 | 3300014969 | Ga0157376_10000140 | Ga0157376_1000014014 | 409 |
| 342 | 3300017792 | Ga0163161_10000186 | Ga0163161_1000018611 | 409 |
| 343 | 3300020070 | Ga0206356_10876973 | Ga0206356_108769732 | 409 |
| 344 | 3300021384 | Ga0213876_10003843 | Ga0213876_100038437 | 409 |
| 345 | 3300021388 | Ga0213875_10000166 | Ga0213875_1000016616 | 409 |
| 346 | 3300025229 | Ga0209147_100298 | Ga0209147_10029813 | 409 |
| 347 | 3300025321 | Ga0207656_10008550 | Ga0207656_100085502 | 409 |
| 348 | 3300025735 | Ga0207713_1000491 | Ga0207713_100049119 | 409 |
| 349 | 3300025900 | Ga0207710_10011345 | Ga0207710_100113452 | 409 |
| 350 | 3300025901 | Ga0207688_10048536 | Ga0207688_100485362 | 409 |
| 351 | 3300025903 | Ga0207680_10000007 | Ga0207680_10000007242 | 409 |
| 352 | 3300025903 | Ga0207680_10000821 | Ga0207680_100008217 | 409 |
| 353 | 3300025903 | Ga0207680_10010099 | Ga0207680_100100995 | 409 |
| 354 | 3300025903 | Ga0207680_10010579 | Ga0207680_100105794 | 409 |
| 355 | 3300025904 | Ga0207647_10000748 | Ga0207647_1000074815 | 409 |
| 356 | 3300025904 | Ga0207647_10021518 | Ga0207647_100215184 | 409 |
| 357 | 3300025904 | Ga0207647_10052537 | Ga0207647_100525372 | 409 |
| 358 | 3300025904 | Ga0207647_10052658 | Ga0207647_100526581 | 409 |
| 359 | 3300025906 | Ga0207699_10012553 | Ga0207699_100125533 | 409 |
| 360 | 3300025907 | Ga0207645_10000523 | Ga0207645_1000052310 | 409 |
| 361 | 3300025909 | Ga0207705_10000025 | Ga0207705_1000002524 | 409 |
| 362 | 3300025909 | Ga0207705_10015976 | Ga0207705_100159766 | 409 |
| 363 | 3300025909 | Ga0207705_10059980 | Ga0207705_100599801 | 409 |
| 364 | 3300025911 | Ga0207654_10008184 | Ga0207654_100081846 | 409 |
| 365 | 3300025913 | Ga0207695_10009684 | Ga0207695_1000968411 | 409 |
| 366 | 3300025914 | Ga0207671_10000350 | Ga0207671_100003503 | 409 |
| 367 | 3300025917 | Ga0207660_10000536 | Ga0207660_1000053623 | 409 |
| 368 | 3300025919 | Ga0207657_10002675 | Ga0207657_100026758 | 409 |
| 369 | 3300025919 | Ga0207657_10011581 | Ga0207657_100115813 | 409 |
| 370 | 3300025919 | Ga0207657_10015100 | Ga0207657_100151008 | 409 |
| 371 | 3300025919 | Ga0207657_10019526 | Ga0207657_100195263 | 409 |
| 372 | 3300025919 | Ga0207657_10029764 | Ga0207657_100297643 | 409 |
| 373 | 3300025919 | Ga0207657_10092883 | Ga0207657_100928832 | 409 |
| 374 | 3300025919 | Ga0207657_10248180 | Ga0207657_102481802 | 409 |
| 375 | 3300025920 | Ga0207649_10000074 | Ga0207649_1000007445 | 409 |
| 376 | 3300025921 | Ga0207652_10000001 | Ga0207652_10000001717 | 409 |
| 377 | 3300025921 | Ga0207652_10000002 | Ga0207652_1000000210 | 409 |
| 378 | 3300025921 | Ga0207652_10014994 | Ga0207652_100149945 | 409 |
| 379 | 3300025923 | Ga0207681_10000014 | Ga0207681_10000014331 | 409 |
| 380 | 3300025923 | Ga0207681_10000199 | Ga0207681_1000019936 | 409 |
| 381 | 3300025923 | Ga0207681_10015882 | Ga0207681_100158824 | 409 |
| 382 | 3300025923 | Ga0207681_10018745 | Ga0207681_100187453 | 409 |
| 383 | 3300025923 | Ga0207681_10049089 | Ga0207681_100490893 | 409 |
| 384 | 3300025924 | Ga0207694_10004154 | Ga0207694_100041543 | 409 |
| 385 | 3300025924 | Ga0207694_10095572 | Ga0207694_100955722 | 409 |
| 386 | 3300025925 | Ga0207650_10000015 | Ga0207650_10000015344 | 409 |
| 387 | 3300025925 | Ga0207650_10000056 | Ga0207650_100000567 | 409 |
| 388 | 3300025925 | Ga0207650_10005758 | Ga0207650_100057587 | 409 |
| 389 | 3300025925 | Ga0207650_10061101 | Ga0207650_100611012 | 409 |
| 390 | 3300025925 | Ga0207650_10069682 | Ga0207650_100696822 | 409 |
| 391 | 3300025926 | Ga0207659_10012135 | Ga0207659_100121355 | 409 |
| 392 | 3300025926 | Ga0207659_10019289 | Ga0207659_100192892 | 409 |
| 393 | 3300025926 | Ga0207659_10088946 | Ga0207659_100889462 | 409 |
| 394 | 3300025927 | Ga0207687_10029300 | Ga0207687_100293005 | 409 |
| 395 | 3300025929 | Ga0207664_10039239 | Ga0207664_100392392 | 409 |
| 396 | 3300025931 | Ga0207644_10000117 | Ga0207644_1000011710 | 409 |
| 397 | 3300025931 | Ga0207644_10000230 | Ga0207644_100002309 | 409 |
| 398 | 3300025931 | Ga0207644_10000729 | Ga0207644_1000072911 | 409 |
| 399 | 3300025931 | Ga0207644_10004051 | Ga0207644_100040517 | 409 |
| 400 | 3300025931 | Ga0207644_10009847 | Ga0207644_100098472 | 409 |
| 401 | 3300025932 | Ga0207690_10017303 | Ga0207690_100173033 | 409 |
| 402 | 3300025932 | Ga0207690_10084202 | Ga0207690_100842022 | 409 |
| 403 | 3300025932 | Ga0207690_10103523 | Ga0207690_101035232 | 409 |
| 404 | 3300025932 | Ga0207690_10164652 | Ga0207690_101646522 | 409 |
| 405 | 3300025933 | Ga0207706_10003608 | Ga0207706_100036087 | 409 |
| 406 | 3300025933 | Ga0207706_10036096 | Ga0207706_100360963 | 409 |
| 407 | 3300025933 | Ga0207706_10099552 | Ga0207706_100995522 | 409 |
| 408 | 3300025933 | Ga0207706_10117315 | Ga0207706_101173152 | 409 |
| 409 | 3300025933 | Ga0207706_10132974 | Ga0207706_101329742 | 409 |
| 410 | 3300025933 | Ga0207706_10181922 | Ga0207706_101819222 | 409 |
| 411 | 3300025933 | Ga0207706_10214565 | Ga0207706_102145652 | 409 |
| 412 | 3300025934 | Ga0207686_10000215 | Ga0207686_1000021527 | 409 |
| 413 | 3300025935 | Ga0207709_10000118 | Ga0207709_1000011832 | 409 |
| 414 | 3300025936 | Ga0207670_10004991 | Ga0207670_100049913 | 409 |
| 415 | 3300025937 | Ga0207669_10025186 | Ga0207669_100251862 | 409 |
| 416 | 3300025937 | Ga0207669_10046380 | Ga0207669_100463802 | 409 |
| 417 | 3300025937 | Ga0207669_10162469 | Ga0207669_101624692 | 409 |
| 418 | 3300025938 | Ga0207704_10000027 | Ga0207704_1000002732 | 409 |
| 419 | 3300025939 | Ga0207665_10022883 | Ga0207665_100228834 | 409 |
| 420 | 3300025940 | Ga0207691_10006731 | Ga0207691_100067315 | 409 |
| 421 | 3300025940 | Ga0207691_10010314 | Ga0207691_100103148 | 409 |
| 422 | 3300025940 | Ga0207691_10015809 | Ga0207691_100158094 | 409 |
| 423 | 3300025940 | Ga0207691_10152067 | Ga0207691_101520672 | 409 |
| 424 | 3300025941 | Ga0207711_10000004 | Ga0207711_10000004204 | 409 |
| 425 | 3300025941 | Ga0207711_10000107 | Ga0207711_1000010755 | 409 |
| 426 | 3300025941 | Ga0207711_10000371 | Ga0207711_100003718 | 409 |
| 427 | 3300025941 | Ga0207711_10000917 | Ga0207711_100009173 | 409 |
| 428 | 3300025941 | Ga0207711_10002164 | Ga0207711_1000216414 | 409 |
| 429 | 3300025941 | Ga0207711_10013381 | Ga0207711_100133811 | 409 |
| 430 | 3300025942 | Ga0207689_10000584 | Ga0207689_1000058425 | 409 |
| 431 | 3300025945 | Ga0207679_10002925 | Ga0207679_100029256 | 409 |
| 432 | 3300025945 | Ga0207679_10006737 | Ga0207679_100067379 | 409 |
| 433 | 3300025945 | Ga0207679_10036669 | Ga0207679_100366693 | 409 |
| 434 | 3300025945 | Ga0207679_10112082 | Ga0207679_101120821 | 409 |
| 435 | 3300025945 | Ga0207679_10197724 | Ga0207679_101977242 | 409 |
| 436 | 3300025949 | Ga0207667_10016210 | Ga0207667_100162103 | 409 |
| 437 | 3300025949 | Ga0207667_10024479 | Ga0207667_100244793 | 409 |
| 438 | 3300025949 | Ga0207667_10097128 | Ga0207667_100971283 | 409 |
| 439 | 3300025960 | Ga0207651_10000016 | Ga0207651_1000001632 | 409 |
| 440 | 3300025960 | Ga0207651_10000971 | Ga0207651_100009718 | 409 |
| 441 | 3300025960 | Ga0207651_10004999 | Ga0207651_100049997 | 409 |
| 442 | 3300025960 | Ga0207651_10007093 | Ga0207651_100070936 | 409 |
| 443 | 3300025960 | Ga0207651_10033616 | Ga0207651_100336162 | 409 |
| 444 | 3300025961 | Ga0207712_10000004 | Ga0207712_10000004230 | 409 |
| 445 | 3300025961 | Ga0207712_10000311 | Ga0207712_1000031121 | 409 |
| 446 | 3300025972 | Ga0207668_10000009 | Ga0207668_10000009156 | 409 |
| 447 | 3300025972 | Ga0207668_10004966 | Ga0207668_100049667 | 409 |
| 448 | 3300025972 | Ga0207668_10008749 | Ga0207668_100087496 | 409 |
| 449 | 3300025972 | Ga0207668_10019256 | Ga0207668_100192562 | 409 |
| 450 | 3300025981 | Ga0207640_10000371 | Ga0207640_1000037118 | 409 |
| 451 | 3300025981 | Ga0207640_10028204 | Ga0207640_100282042 | 409 |
| 452 | 3300025981 | Ga0207640_10031086 | Ga0207640_100310862 | 409 |
| 453 | 3300025981 | Ga0207640_10080096 | Ga0207640_100800962 | 409 |
| 454 | 3300025986 | Ga0207658_10000010 | Ga0207658_10000010227 | 409 |
| 455 | 3300025986 | Ga0207658_10000287 | Ga0207658_1000028716 | 409 |
| 456 | 3300025986 | Ga0207658_10000512 | Ga0207658_100005125 | 409 |
| 457 | 3300025986 | Ga0207658_10000768 | Ga0207658_1000076821 | 409 |
| 458 | 3300025986 | Ga0207658_10003944 | Ga0207658_1000394410 | 409 |
| 459 | 3300025986 | Ga0207658_10005700 | Ga0207658_100057007 | 409 |
| 460 | 3300025986 | Ga0207658_10017423 | Ga0207658_100174235 | 409 |
| 461 | 3300025986 | Ga0207658_10096851 | Ga0207658_100968512 | 409 |
| 462 | 3300026023 | Ga0207677_10000192 | Ga0207677_1000019232 | 409 |
| 463 | 3300026023 | Ga0207677_10006497 | Ga0207677_100064978 | 409 |
| 464 | 3300026023 | Ga0207677_10049584 | Ga0207677_100495842 | 409 |
| 465 | 3300026035 | Ga0207703_10000479 | Ga0207703_1000047915 | 409 |
| 466 | 3300026035 | Ga0207703_10001633 | Ga0207703_1000163312 | 409 |
| 467 | 3300026035 | Ga0207703_10006096 | Ga0207703_100060967 | 409 |
| 468 | 3300026035 | Ga0207703_10040776 | Ga0207703_100407763 | 409 |
| 469 | 3300026041 | Ga0207639_10006286 | Ga0207639_100062864 | 409 |
| 470 | 3300026041 | Ga0207639_10012894 | Ga0207639_100128944 | 409 |
| 471 | 3300026041 | Ga0207639_10014197 | Ga0207639_100141972 | 409 |
| 472 | 3300026041 | Ga0207639_10054600 | Ga0207639_100546003 | 409 |
| 473 | 3300026041 | Ga0207639_10059217 | Ga0207639_100592172 | 409 |
| 474 | 3300026041 | Ga0207639_10149875 | Ga0207639_101498752 | 409 |
| 475 | 3300026067 | Ga0207678_10011697 | Ga0207678_100116976 | 409 |
| 476 | 3300026067 | Ga0207678_10045368 | Ga0207678_100453682 | 409 |
| 477 | 3300026067 | Ga0207678_10057520 | Ga0207678_100575204 | 409 |
| 478 | 3300026067 | Ga0207678_10072664 | Ga0207678_100726642 | 409 |
| 479 | 3300026067 | Ga0207678_10104865 | Ga0207678_101048652 | 409 |
| 480 | 3300026078 | Ga0207702_10003449 | Ga0207702_100034492 | 409 |
| 481 | 3300026078 | Ga0207702_10009656 | Ga0207702_100096566 | 409 |
| 482 | 3300026078 | Ga0207702_10383624 | Ga0207702_103836241 | 409 |
| 483 | 3300026088 | Ga0207641_10000018 | Ga0207641_10000018150 | 409 |
| 484 | 3300026088 | Ga0207641_10000216 | Ga0207641_1000021636 | 409 |
| 485 | 3300026088 | Ga0207641_10000584 | Ga0207641_1000058440 | 409 |
| 486 | 3300026088 | Ga0207641_10002403 | Ga0207641_1000240316 | 409 |
| 487 | 3300026088 | Ga0207641_10017266 | Ga0207641_100172663 | 409 |
| 488 | 3300026088 | Ga0207641_10024033 | Ga0207641_100240335 | 409 |
| 489 | 3300026088 | Ga0207641_10036223 | Ga0207641_100362232 | 409 |
| 490 | 3300026089 | Ga0207648_10000116 | Ga0207648_1000011644 | 409 |
| 491 | 3300026089 | Ga0207648_10004968 | Ga0207648_100049685 | 409 |
| 492 | 3300026089 | Ga0207648_10005659 | Ga0207648_100056593 | 409 |
| 493 | 3300026095 | Ga0207676_10000021 | Ga0207676_1000002158 | 409 |
| 494 | 3300026095 | Ga0207676_10000027 | Ga0207676_1000002795 | 409 |
| 495 | 3300026095 | Ga0207676_10002208 | Ga0207676_100022088 | 409 |
| 496 | 3300026095 | Ga0207676_10002967 | Ga0207676_1000296710 | 409 |
| 497 | 3300026095 | Ga0207676_10007460 | Ga0207676_100074602 | 409 |
| 498 | 3300026095 | Ga0207676_10016018 | Ga0207676_100160183 | 409 |
| 499 | 3300026116 | Ga0207674_10000065 | Ga0207674_1000006576 | 409 |
| 500 | 3300026116 | Ga0207674_10038465 | Ga0207674_100384654 | 409 |
| 501 | 3300026118 | Ga0207675_100000777 | Ga0207675_10000077720 | 409 |
| 502 | 3300026118 | Ga0207675_100003380 | Ga0207675_10000338011 | 409 |
| 503 | 3300026118 | Ga0207675_100056121 | Ga0207675_1000561214 | 409 |
| 504 | 3300026118 | Ga0207675_100143806 | Ga0207675_1001438062 | 409 |
| 505 | 3300026121 | Ga0207683_10002092 | Ga0207683_100020927 | 409 |
| 506 | 3300026121 | Ga0207683_10030447 | Ga0207683_100304475 | 409 |
| 507 | 3300026142 | Ga0207698_10000116 | Ga0207698_1000011638 | 409 |
| 508 | 3300026142 | Ga0207698_10097892 | Ga0207698_100978923 | 409 |
| 509 | 3300027866 | Ga0209813_10000468 | Ga0209813_100004685 | 409 |
| 510 | 3300028379 | Ga0268266_10000040 | Ga0268266_10000040155 | 409 |
| 511 | 3300028379 | Ga0268266_10017275 | Ga0268266_100172755 | 409 |
| 512 | 3300028379 | Ga0268266_10071681 | Ga0268266_100716814 | 409 |
| 513 | 3300028379 | Ga0268266_10147933 | Ga0268266_101479332 | 409 |
| 514 | 3300028379 | Ga0268266_10260066 | Ga0268266_102600662 | 409 |
| 515 | 3300028380 | Ga0268265_10000013 | Ga0268265_1000001329 | 409 |
| 516 | 3300028380 | Ga0268265_10000042 | Ga0268265_1000004237 | 409 |
| 517 | 3300028380 | Ga0268265_10000294 | Ga0268265_1000029436 | 409 |
| 518 | 3300028380 | Ga0268265_10000324 | Ga0268265_100003246 | 409 |
| 519 | 3300028381 | Ga0268264_10000003 | Ga0268264_10000003244 | 409 |
| 520 | 3300028381 | Ga0268264_10000039 | Ga0268264_10000039140 | 409 |
| 521 | 3300028381 | Ga0268264_10000070 | Ga0268264_10000070167 | 409 |
| 522 | 3300028381 | Ga0268264_10035653 | Ga0268264_100356532 | 409 |
| 523 | 3300031548 | Ga0307408_100187469 | Ga0307408_1001874692 | 409 |
| 524 | 3300031548 | Ga0307408_100218984 | Ga0307408_1002189842 | 409 |
| 525 | 3300031731 | Ga0307405_10077121 | Ga0307405_100771213 | 409 |
| 526 | 3300031731 | Ga0307405_10171692 | Ga0307405_101716922 | 409 |
| 527 | 3300031852 | Ga0307410_10016039 | Ga0307410_100160392 | 409 |
| 528 | 3300031852 | Ga0307410_10027751 | Ga0307410_100277512 | 409 |
| 529 | 3300031901 | Ga0307406_10147757 | Ga0307406_101477572 | 409 |
| 530 | 3300031911 | Ga0307412_10009822 | Ga0307412_100098225 | 409 |
| 531 | 3300031911 | Ga0307412_10022920 | Ga0307412_100229203 | 409 |
| 532 | 3300031995 | Ga0307409_100031642 | Ga0307409_1000316423 | 409 |
| 533 | 3300031995 | Ga0307409_100095582 | Ga0307409_1000955822 | 409 |
| 534 | 3300032002 | Ga0307416_100000451 | Ga0307416_1000004518 | 409 |
| 535 | 3300032004 | Ga0307414_10188259 | Ga0307414_101882591 | 409 |
| 536 | 3300032005 | Ga0307411_10016140 | Ga0307411_100161403 | 409 |
| 537 | 3300035118 | Ga0373954_0038206 | Ga0373954_0038206_434_1720 | 409 |
| 538 | 3300035172 | Ga0373955_0065392 | Ga0373955_0065392_446_1732 | 409 |
| 539 | 3300035692 | Ga0373935_0111026 | Ga0373935_0111026_236_1522 | 409 |
| 540 | 3300035695 | Ga0373927_0062106 | Ga0373927_0062106_378_1664 | 409 |
| 541 | 3300035725 | Ga0373947_0072005 | Ga0373947_0072005_354_1640 | 409 |
| 542 | 3300037068 | Ga0373925_0035087 | Ga0373925_0035087_86_1372 | 409 |
| 543 | 3300037312 | Ga0395899_0000113 | Ga0395899_0000113_5607_6893 | 409 |
| 544 | 3300037312 | Ga0395899_0003756 | Ga0395899_0003756_3803_5089 | 409 |
| 545 | 3300037312 | Ga0395899_0014804 | Ga0395899_0014804_2305_3591 | 409 |
| 546 | 3300037312 | Ga0395899_0099019 | Ga0395899_0099019_400_1686 | 409 |
| 547 | 3300037418 | Ga0395900_0005823 | Ga0395900_0005823_6903_8189 | 409 |
| 548 | 3300037418 | Ga0395900_0009694 | Ga0395900_0009694_6354_7640 | 409 |
| 549 | 3300037418 | Ga0395900_0013203 | Ga0395900_0013203_4796_6082 | 409 |
| 550 | 3300037418 | Ga0395900_0016968 | Ga0395900_0016968_2355_3641 | 409 |
| 551 | 3300037418 | Ga0395900_0017452 | Ga0395900_0017452_5409_6695 | 409 |
| 552 | 3300037418 | Ga0395900_0049587 | Ga0395900_0049587_476_1762 | 409 |
| 553 | 3300037418 | Ga0395900_0084351 | Ga0395900_0084351_1244_2530 | 409 |
| 554 | 3300037418 | Ga0395900_0121935 | Ga0395900_0121935_340_1626 | 409 |
| 555 | 3300037418 | Ga0395900_0163281 | Ga0395900_0163281_352_1638 | 409 |
| 556 | 3300037466 | Ga0395898_0000306 | Ga0395898_0000306_109048_110334 | 409 |
| 557 | 3300037466 | Ga0395898_0001326 | Ga0395898_0001326_5619_6905 | 409 |
| 558 | 3300037466 | Ga0395898_0014197 | Ga0395898_0014197_3326_4612 | 409 |
| 559 | 3300037466 | Ga0395898_0015973 | Ga0395898_0015973_1877_3163 | 409 |
| 560 | 3300037466 | Ga0395898_0017925 | Ga0395898_0017925_2305_3591 | 409 |
| 561 | 3300037466 | Ga0395898_0034479 | Ga0395898_0034479_2689_3975 | 409 |
| 562 | 3300037466 | Ga0395898_0086885 | Ga0395898_0086885_137_1423 | 409 |
| 563 | 3300037471 | Ga0395905_0000005 | Ga0395905_0000005_354009_355295 | 409 |
| 564 | 3300037471 | Ga0395905_0000958 | Ga0395905_0000958_3490_4776 | 409 |
| 565 | 3300037471 | Ga0395905_0001046 | Ga0395905_0001046_23469_24755 | 409 |
| 566 | 3300037471 | Ga0395905_0001585 | Ga0395905_0001585_1394_2680 | 409 |
| 567 | 3300037471 | Ga0395905_0010210 | Ga0395905_0010210_4537_5823 | 409 |
| 568 | 3300037471 | Ga0395905_0010767 | Ga0395905_0010767_4186_5472 | 409 |
| 569 | 3300037471 | Ga0395905_0010864 | Ga0395905_0010864_2335_3621 | 409 |
| 570 | 3300037471 | Ga0395905_0016800 | Ga0395905_0016800_3330_4616 | 409 |
| 571 | 3300037471 | Ga0395905_0017713 | Ga0395905_0017713_49_1335 | 409 |
| 572 | 3300037471 | Ga0395905_0021098 | Ga0395905_0021098_17_1303 | 409 |
| 573 | 3300037471 | Ga0395905_0022485 | Ga0395905_0022485_1088_2413 | 409 |
| 574 | 3300037471 | Ga0395905_0024565 | Ga0395905_0024565_884_2143 | 409 |
| 575 | 3300037471 | Ga0395905_0081103 | Ga0395905_0081103_511_1797 | 409 |
| 576 | 3300037471 | Ga0395905_0095924 | Ga0395905_0095924_785_2071 | 409 |
| 577 | 3300037471 | Ga0395905_0158549 | Ga0395905_0158549_224_1510 | 409 |
| 578 | 3300037471 | Ga0395905_0188144 | Ga0395905_0188144_92_1378 | 409 |
| 579 | 3300037471 | Ga0395905_0233620 | Ga0395905_0233620_203_1519 | 409 |
| 580 | 3300037471 | Ga0395905_0291905 | Ga0395905_0291905_135_1394 | 409 |
| 581 | 3300037853 | Ga0436364_0545952 | Ga0436364_0545952_14672_15952 | 409 |
| 582 | 3300038443 | Ga0395901_0002169 | Ga0395901_0002169_6981_8267 | 409 |
| 583 | 3300038443 | Ga0395901_0007143 | Ga0395901_0007143_3803_5089 | 409 |
| 584 | 3300038443 | Ga0395901_0011649 | Ga0395901_0011649_1209_2495 | 409 |
| 585 | 3300038443 | Ga0395901_0018318 | Ga0395901_0018318_3152_4438 | 409 |
| 586 | 3300038443 | Ga0395901_0033170 | Ga0395901_0033170_3092_4378 | 409 |
| 587 | 3300038443 | Ga0395901_0116375 | Ga0395901_0116375_751_2037 | 409 |
| 588 | 3300038443 | Ga0395901_0142808 | Ga0395901_0142808_223_1509 | 409 |
| 589 | 3300038443 | Ga0395901_0188110 | Ga0395901_0188110_367_1653 | 409 |
| 590 | 3300038443 | Ga0395901_0190683 | Ga0395901_0190683_236_1522 | 409 |
| 591 | 3300038443 | Ga0395901_0388375 | Ga0395901_0388375_76_1362 | 409 |
| 592 | 3300039437 | Ga0436365_0257345 | Ga0436365_0257345_8009_9271 | 409 |
| 593 | 3300039437 | Ga0436365_1536714 | Ga0436365_1536714_17623_18891 | 409 |
| 594 | 3300039437 | Ga0436365_1577285 | Ga0436365_1577285_2522_3802 | 409 |
| 595 | 3300041512 | Ga0451853_1219635 | Ga0451853_1219635_517_1776 | 409 |
| 596 | 3300042005 | Ga0439448_0002715 | Ga0439448_0002715_2787_4046 | 409 |
| 597 | 3300042005 | Ga0439448_0011074 | Ga0439448_0011074_1370_2656 | 409 |
| 598 | 3300042006 | Ga0439432_025571 | Ga0439432_025571_562_1848 | 409 |
| 599 | 3300042007 | Ga0439449_0011365 | Ga0439449_0011365_892_2223 | 409 |
| 600 | 3300042012 | Ga0439455_0001188 | Ga0439455_0001188_331_1590 | 409 |
| 601 | 3300042157 | Ga0439458_0000636 | Ga0439458_0000636_4131_5417 | 409 |
| 602 | 3300042157 | Ga0439458_0003580 | Ga0439458_0003580_156_1415 | 409 |
| 603 | 3300044656 | Ga0466969_0002833 | Ga0466969_0002833_3231_4517 | 409 |
| 604 | 3300044658 | Ga0466972_0002118 | Ga0466972_0002118_2791_4050 | 409 |
| 605 | 3300044658 | Ga0466972_0081581 | Ga0466972_0081581_126_1385 | 409 |
| 606 | 3300044684 | Ga0466966_0047414 | Ga0466966_0047414_551_1837 | 409 |
| 607 | 3300044684 | Ga0466966_0085199 | Ga0466966_0085199_324_1610 | 409 |
| 608 | 3300044694 | Ga0466963_0054244 | Ga0466963_0054244_193_1479 | 409 |
| 609 | 3300044706 | Ga0466964_0020584 | Ga0466964_0020584_243_1514 | 409 |
| 610 | 3300044719 | Ga0466971_0020675 | Ga0466971_0020675_1002_2273 | 409 |
| 611 | 3300044719 | Ga0466971_0024385 | Ga0466971_0024385_1303_2589 | 409 |
| 612 | 3300044719 | Ga0466971_0039941 | Ga0466971_0039941_130_1389 | 409 |
| 613 | 3300044765 | Ga0466970_0002773 | Ga0466970_0002773_6018_7277 | 409 |
| 614 | 3300044765 | Ga0466970_0004904 | Ga0466970_0004904_1121_2407 | 409 |
| 615 | 3300044842 | Ga0466957_0001053 | Ga0466957_0001053_5277_6563 | 409 |
| 616 | 3300044842 | Ga0466957_0068693 | Ga0466957_0068693_213_1484 | 409 |
| 617 | 3300044842 | Ga0466957_0089149 | Ga0466957_0089149_285_1571 | 409 |
| 618 | 3300044901 | Ga0466960_0017036 | Ga0466960_0017036_1523_2809 | 409 |
| 619 | 3300044901 | Ga0466960_0017817 | Ga0466960_0017817_1102_2361 | 409 |
| 620 | 3300045049 | Ga0466959_0022449 | Ga0466959_0022449_1064_2350 | 409 |
| 621 | 3300045049 | Ga0466959_0041638 | Ga0466959_0041638_1570_2829 | 409 |
| 622 | 3300045836 | Ga0466958_0005075 | Ga0466958_0005075_97_1383 | 409 |
| 623 | 3300045836 | Ga0466958_0029566 | Ga0466958_0029566_560_1831 | 409 |
| 624 | 3300045976 | Ga0466967_0145127 | Ga0466967_0145127_668_1939 | 409 |
| 625 | 3300045976 | Ga0466967_0148693 | Ga0466967_0148693_237_1502 | 409 |
| 626 | 3300045976 | Ga0466967_0209156 | Ga0466967_0209156_535_1827 | 409 |
| 627 | 3300046452 | Ga0495617_006653 | Ga0495617_006653_690_1955 | 409 |
| 628 | 3300046453 | Ga0495627_000024 | Ga0495627_000024_75029_76294 | 409 |
| 629 | 3300046512 | Ga0495610_0000053 | Ga0495610_0000053_117721_118986 | 409 |
| 630 | 3300046520 | Ga0495637_0002826 | Ga0495637_0002826_4030_5295 | 409 |
| 631 | 3300046524 | Ga0495648_0009993 | Ga0495648_0009993_1508_2773 | 409 |
| 632 | 3300046524 | Ga0495648_0060033 | Ga0495648_0060033_730_1998 | 409 |
| 633 | 3300046525 | Ga0495663_0011834 | Ga0495663_0011834_683_2017 | 409 |
| 634 | 3300046525 | Ga0495663_0043540 | Ga0495663_0043540_52_1311 | 409 |
| 635 | 3300046530 | Ga0495654_0000620 | Ga0495654_0000620_20512_21771 | 409 |
| 636 | 3300046537 | Ga0495598_0000194 | Ga0495598_0000194_6445_7731 | 409 |
| 637 | 3300046539 | Ga0495621_0002136 | Ga0495621_0002136_995_2281 | 409 |
| 638 | 3300046616 | Ga0495668_0001088 | Ga0495668_0001088_6739_7998 | 409 |
| 639 | 3300046616 | Ga0495668_0023290 | Ga0495668_0023290_1529_2812 | 409 |
| 640 | 3300046616 | Ga0495668_0048007 | Ga0495668_0048007_468_1739 | 409 |
| 641 | 3300046616 | Ga0495668_0093322 | Ga0495668_0093322_253_1512 | 409 |
| 642 | 3300046684 | Ga0495669_0000599 | Ga0495669_0000599_13493_14776 | 409 |
| 643 | 3300046684 | Ga0495669_0001837 | Ga0495669_0001837_6891_8174 | 409 |
| 644 | 3300046684 | Ga0495669_0030328 | Ga0495669_0030328_434_1768 | 409 |
| 645 | 3300046691 | Ga0495670_0038423 | Ga0495670_0038423_335_1621 | 409 |
| 646 | 3300047470 | Ga0495681_0000099 | Ga0495681_0000099_47118_48383 | 409 |
| 647 | 3300047470 | Ga0495681_0001636 | Ga0495681_0001636_15310_16602 | 409 |
| 648 | 3300048088 | Ga0495602_0016614 | Ga0495602_0016614_2518_3804 | 409 |
| 649 | 3300048903 | Ga0496100_0088838 | Ga0496100_0088838_464_1798 | 409 |
| 650 | 3300048904 | Ga0496101_0000533 | Ga0496101_0000533_8832_10118 | 409 |
| 651 | 3300048904 | Ga0496101_0037290 | Ga0496101_0037290_139_1398 | 409 |
| 652 | 3300048905 | Ga0496102_0000010 | Ga0496102_0000010_230729_232003 | 409 |
| 653 | 3300048905 | Ga0496102_0036921 | Ga0496102_0036921_274_1560 | 409 |
| 654 | 3300048905 | Ga0496102_0194181 | Ga0496102_0194181_98_1384 | 409 |
| 655 | 3300048906 | Ga0496103_0000029 | Ga0496103_0000029_119438_120712 | 409 |
| 656 | 3300048906 | Ga0496103_0001191 | Ga0496103_0001191_15584_16843 | 409 |
| 657 | 3300048906 | Ga0496103_0064099 | Ga0496103_0064099_825_2111 | 409 |
| 658 | 3300048907 | Ga0496104_0017717 | Ga0496104_0017717_2823_4109 | 409 |
| 659 | 3300048908 | Ga0496105_0004359 | Ga0496105_0004359_7640_8926 | 409 |
| 660 | 3300048909 | Ga0496106_0007216 | Ga0496106_0007216_76_1362 | 409 |
| 661 | 3300048909 | Ga0496106_0063212 | Ga0496106_0063212_475_1734 | 409 |
| 662 | 3300048910 | Ga0496107_0005864 | Ga0496107_0005864_742_2028 | 409 |
| 663 | 3300048910 | Ga0496107_0079859 | Ga0496107_0079859_326_1612 | 409 |
| 664 | 3300048910 | Ga0496107_0133137 | Ga0496107_0133137_241_1500 | 409 |
| 665 | 3300048911 | Ga0496108_0000482 | Ga0496108_0000482_23853_25118 | 409 |
| 666 | 3300048911 | Ga0496108_0006891 | Ga0496108_0006891_6062_7348 | 409 |
| 667 | 3300048912 | Ga0496109_0002603 | Ga0496109_0002603_7768_9054 | 409 |
| 668 | 3300048912 | Ga0496109_0027863 | Ga0496109_0027863_2612_3946 | 409 |
| 669 | 3300048913 | Ga0496110_0000347 | Ga0496110_0000347_21034_22320 | 409 |
| 670 | 3300048913 | Ga0496110_0006617 | Ga0496110_0006617_6516_7850 | 409 |
| 671 | 3300048913 | Ga0496110_0080420 | Ga0496110_0080420_172_1431 | 409 |
| 672 | 3300048914 | Ga0496111_0010584 | Ga0496111_0010584_3862_5196 | 409 |
| 673 | 3300048915 | Ga0496112_0003652 | Ga0496112_0003652_8455_9789 | 409 |
| 674 | 3300048915 | Ga0496112_0005111 | Ga0496112_0005111_4276_5562 | 409 |
| 675 | 3300048915 | Ga0496112_0008504 | Ga0496112_0008504_6062_7348 | 409 |
| 676 | 3300048916 | Ga0496113_0018020 | Ga0496113_0018020_2252_3538 | 409 |
| 677 | 3300048916 | Ga0496113_0171660 | Ga0496113_0171660_368_1702 | 409 |
| 678 | 3300048919 | Ga0496116_0000942 | Ga0496116_0000942_27032_28306 | 409 |
| 679 | 3300048919 | Ga0496116_0049461 | Ga0496116_0049461_1411_2676 | 409 |
| 680 | 3300048920 | Ga0496117_0000037 | Ga0496117_0000037_231331_232605 | 409 |
| 681 | 3300048920 | Ga0496117_0007661 | Ga0496117_0007661_296_1555 | 409 |
| 682 | 3300048920 | Ga0496117_0062597 | Ga0496117_0062597_652_1911 | 409 |
| 683 | 3300048921 | Ga0496118_0000034 | Ga0496118_0000034_229135_230409 | 409 |
| 684 | 3300048921 | Ga0496118_0000689 | Ga0496118_0000689_22930_24210 | 409 |
| 685 | 3300048921 | Ga0496118_0010460 | Ga0496118_0010460_1767_3026 | 409 |
| 686 | 3300048922 | Ga0496119_0015128 | Ga0496119_0015128_3833_5107 | 409 |
| 687 | 3300048922 | Ga0496119_0016847 | Ga0496119_0016847_3441_4700 | 409 |
| 688 | 3300048923 | Ga0496120_0011194 | Ga0496120_0011194_729_2003 | 409 |
| 689 | 3300048923 | Ga0496120_0018136 | Ga0496120_0018136_1344_2603 | 409 |
| 690 | 3300048924 | Ga0496121_0001024 | Ga0496121_0001024_22748_24013 | 409 |
| 691 | 3300048924 | Ga0496121_0051640 | Ga0496121_0051640_2150_3409 | 409 |
| 692 | 3300048925 | Ga0496122_0001502 | Ga0496122_0001502_27339_28613 | 409 |
| 693 | 3300048926 | Ga0496123_0002683 | Ga0496123_0002683_5067_6341 | 409 |
| 694 | 3300048927 | Ga0496124_0000033 | Ga0496124_0000033_229135_230409 | 409 |
| 695 | 3300048927 | Ga0496124_0097996 | Ga0496124_0097996_259_1524 | 409 |
| 696 | 3300048928 | Ga0496125_0008402 | Ga0496125_0008402_20_1285 | 409 |
| 697 | 3300048928 | Ga0496125_0050350 | Ga0496125_0050350_1452_2687 | 409 |
| 698 | 3300048928 | Ga0496125_0066069 | Ga0496125_0066069_321_1580 | 409 |
| 699 | 3300048928 | Ga0496125_0071020 | Ga0496125_0071020_1075_2361 | 409 |
| 700 | 3300048929 | Ga0496126_0022584 | Ga0496126_0022584_878_2143 | 409 |
| 701 | 3300049513 | Ga0501290_000215 | Ga0501290_000215_3794_5059 | 409 |
| 702 | 3300049515 | Ga0501292_000181 | Ga0501292_000181_7960_9225 | 409 |
| 703 | 3300049580 | Ga0501046_0040917 | Ga0501046_0040917_2386_3657 | 409 |
| 704 | 3300049584 | Ga0501068_0060266 | Ga0501068_0060266_654_1940 | 409 |
| 705 | 3300049665 | Ga0501227_005214 | Ga0501227_005214_875_2140 | 409 |
| 706 | 3300049669 | Ga0501235_002586 | Ga0501235_002586_65_1330 | 409 |
| 707 | 3300049690 | Ga0501261_000172 | Ga0501261_000172_7887_9152 | 409 |
| 708 | 3300049705 | Ga0501225_0002320 | Ga0501225_0002320_2422_3687 | 409 |
| 709 | 3300049708 | Ga0501245_001140 | Ga0501245_001140_771_2036 | 409 |
| 710 | 3300049775 | Ga0501279_000144 | Ga0501279_000144_7966_9231 | 409 |
| 711 | 3300049776 | Ga0501280_000005 | Ga0501280_000005_78203_79468 | 409 |
| 712 | 3300049823 | Ga0501044_0140596 | Ga0501044_0140596_1055_2326 | 409 |
| 713 | 3300050493 | nmdc:mga0k408_39192_c1 | nmdc:mga0k408_39192_c1_1362_2621 | 409 |
| 714 | 3300050494 | nmdc:mga06z11_348_c1 | nmdc:mga06z11_348_c1_14351_15685 | 409 |
| 715 | 3300050495 | nmdc:mga04h51_137_c1 | nmdc:mga04h51_137_c1_18387_19721 | 409 |
| 716 | 3300050496 | nmdc:mga07m45_43381_c1 | nmdc:mga07m45_43381_c1_739_1998 | 409 |
| 717 | 3300050496 | nmdc:mga07m45_64284_c1 | nmdc:mga07m45_64284_c1_16_1350 | 409 |
| 718 | 3300053087 | Ga0500643_000305 | Ga0500643_000305_7909_9168 | 409 |
| 719 | 3300053108 | Ga0500562_010370 | Ga0500562_010370_247_1524 | 409 |
| 720 | 3300053116 | Ga0500592_000757 | Ga0500592_000757_493_1752 | 409 |
| 721 | 3300053116 | Ga0500592_009042 | Ga0500592_009042_113_1384 | 409 |
| 722 | 3300053157 | Ga0500624_000018 | Ga0500624_000018_26775_28040 | 409 |
| 723 | 3300053158 | Ga0500627_0000110 | Ga0500627_0000110_5398_6657 | 409 |
| 724 | 3300061719 | Ga0466962_0004085 | Ga0466962_0004085_3788_5059 | 409 |
| 725 | 3300061719 | Ga0466962_0008275 | Ga0466962_0008275_3410_4696 | 409 |
| 726 | iso_pu_bacteria | 2512564014 | 2512645628 | 409 |
| 727 | iso_pu_bacteria | 2582581305 | 2585261791 | 409 |
| 728 | iso_pu_bacteria | 2808606401 | 2809062590 | 409 |
| 729 | iso_pu_bacteria | 2808606404 | 2809078726 | 409 |
| 730 | iso_pu_bacteria | 2808606405 | 2809082979 | 409 |
| 731 | iso_pu_bacteria | 2880518877 | 2880521604 | 409 |
| 732 | iso_pu_bacteria | 2919709256 | 2919709540 | 409 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c5q-assembly1.cif.gz_A-2 | crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine | 0.9404 | 8 | 401 |
| 2qgh-assembly1.cif.gz_A-2 | crystal structure of diaminopimelate decarboxylase from helicobacter pylori complexed with l-lysine | 0.9401 | 8 | 401 |
| 1twi-assembly1.cif.gz_A | crystal structure of diaminopimelate decarboxylase from m. jannaschii in co-complex with l-lysine | 0.9339 | 8 | 409 |
| 4xg1-assembly2.cif.gz_D | psychromonas ingrahamii diaminopimelate decarboxylase with llp | 0.9305 | 4 | 407 |
| 1tuf-assembly1.cif.gz_A | crystal structure of diaminopimelate decarboxylase from m. jannaschi | 0.9304 | 10 | 409 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4xg1A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9597 | 25 | 268 | 3.20.20.10 |
| 2qghA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9541 | 25 | 268 | 3.20.20.10 |
| 4xg1A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9511 | 25 | 268 | 3.20.20.10 |
| 2qghA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9464 | 25 | 268 | 3.20.20.10 |
| 3vabA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase | 0.9443 | 25 | 268 | 3.20.20.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q6F0H3-F1-model_v4 | deleted | 0.9862 | 2 | 120 |
|
| AF-A0A661KV00-F1-model_v4 | Diaminopimelate decarboxylase | 0.984 | 2 | 133 |
GO:0008836
GO:0009089 |
| AF-A0A7V5KT84-F1-model_v4 | Diaminopimelate decarboxylase | 0.984 | 2 | 146 |
GO:0008836
GO:0009089 |
| AF-A0A529T0Q3-F1-model_v4 | Diaminopimelate decarboxylase | 0.9835 | 2 | 135 |
GO:0006596
GO:0008836 GO:0009089 |
| AF-A0A800IF44-F1-model_v4 | Diaminopimelate decarboxylase | 0.9813 | 2 | 146 |
GO:0006596
GO:0008836 GO:0009089 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar