F478034

General Info

Members Datasets Scaffolds Average Seq Length
732 286 725 423

Family's Representative Sequence

Representative Sequence 3300025920|Ga0207649_10011117|Ga0207649_100111174
Length 366
Sequence MQVKANPNSAVIATLAKSGLGADVVSGGEYRRAIAAGVPSDKIVFSGVGKTEEEMRLALEGGLYQFNLESLSEAEMLSAVASSMGRTAPVGFRVNPDVGAGGHAKITTGAAENKFGIAIGEAIEAYARAAVLPRISVQGVAVHIGSQLTSLDPLKRAFRRVGELIAELRASGHDIAVADLGGGLGVPYDPDQPEEYGEMVRRIAGGWNARLVFEPGRLIVGNAGVLLSRVIRVKPGATDPFVIVDAAMNDLMRPALYDAWHRIEAVRPNSEMRVANVVGPVCETGDTFATARRMDEVAAGDLVVFRTAGAYAAAMSSTYNSRPLTPEVLVDGNKWAVVRPRIDVDRLIAGDRIPEWLSGCAQPSSS

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
4 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
5 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
6 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
7 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
8 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
9 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
16 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
17 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
20 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
21 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
22 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
23 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
29 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
38 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
183 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
207 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
208 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
209 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
229 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
234 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
235 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
236 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
237 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
253 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
254 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
255 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
256 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
257 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
258 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
259 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
260 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
261 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
262 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
263 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
264 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
268 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
269 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
270 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
271 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
272 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
273 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
274 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
282 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
283 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
284 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
285 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0.41
Isolates 0.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.46
Nodule 0
Rhizoplane 4.37
Rhizosphere 88.52
Stem 0
Stem Tuber 0
Unclassified 4.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000417 3300001904 Bacteria 8017
2 JGI24752J21851_1000152 3300001976 Bacteria 9443
3 JGI24740J21852_10001280 3300001979 Bacteria 11421
4 JGI24739J22299_10016092 3300001989 Bacteria 2711
5 JGI24739J22299_10048144 3300001989 Bacteria 1387
6 JGI24737J22298_10000412 3300001990 Bacteria 14628
7 JGI24737J22298_10002124 3300001990 Bacteria 7069
8 JGI24737J22298_10008210 3300001990 Bacteria 3503
9 JGI24743J22301_10004569 3300001991 Bacteria 2265
10 JGI24735J21928_10004880 3300002067 Bacteria 4472
11 JGI24750J21931_1000028 3300002070 Bacteria 19012
12 JGI24745J21846_1002439 3300002073 Bacteria 1901
13 JGI24748J21848_1000068 3300002074 Bacteria 37633
14 JGI24738J21930_10008872 3300002075 Bacteria 2277
15 JGI24749J21850_1000643 3300002076 Bacteria 5059
16 JGI24744J21845_10001494 3300002077 Bacteria 4648
17 JGI24034J26672_10000036 3300002239 Bacteria 84333
18 JGI24742J22300_10001538 3300002244 Bacteria 3657
19 JGI24742J22300_10001672 3300002244 Bacteria 3530
20 JGI24751J29686_10000166 3300002459 Bacteria 30777
21 rootL2_10273144 3300003322 Bacteria 1994
22 Ga0065707_10081811 3300005295 Bacteria 37556
23 Ga0070658_10001920 3300005327 Bacteria 17506
24 Ga0070658_10049607 3300005327 Bacteria 3401
25 Ga0070676_10001259 3300005328 Bacteria 12757
26 Ga0070690_100000070 3300005330 Bacteria 50746
27 Ga0070670_100000027 3300005331 Bacteria 186072
28 Ga0070670_100000158 3300005331 Bacteria 62049
29 Ga0070670_100016397 3300005331 Bacteria 6362
30 Ga0070670_100041256 3300005331 Bacteria 3967
31 Ga0070670_100139564 3300005331 Bacteria 2096
32 Ga0070670_100145041 3300005331 Bacteria 2054
33 Ga0070677_10010739 3300005333 Bacteria 3140
34 Ga0068869_100002182 3300005334 Bacteria 11777
35 Ga0070666_10000009 3300005335 Bacteria 279209
36 Ga0070666_10003672 3300005335 Bacteria 9300
37 Ga0070680_100000478 3300005336 Bacteria 27447
38 Ga0070680_100004284 3300005336 Bacteria 10719
39 Ga0070682_100015303 3300005337 Bacteria 4443
40 Ga0068868_100000133 3300005338 Bacteria 47802
41 Ga0068868_100007367 3300005338 Bacteria 7837
42 Ga0068868_100026019 3300005338 Bacteria 4456
43 Ga0068868_100042668 3300005338 Bacteria 3541
44 Ga0068868_100086537 3300005338 Bacteria 2519
45 Ga0070660_100001618 3300005339 Bacteria 15487
46 Ga0070660_100003409 3300005339 Bacteria 10929
47 Ga0070660_100004813 3300005339 Bacteria 9338
48 Ga0070660_100006259 3300005339 Bacteria 8242
49 Ga0070660_100017116 3300005339 Bacteria 5278
50 Ga0070660_100020104 3300005339 Bacteria 4902
51 Ga0070660_100104386 3300005339 Bacteria 2248
52 Ga0070660_100154855 3300005339 Bacteria 1844
53 Ga0070689_100048572 3300005340 Bacteria 3273
54 Ga0070691_10001250 3300005341 Bacteria 10719
55 Ga0070661_100000901 3300005344 Bacteria 21311
56 Ga0070661_100023361 3300005344 Bacteria 4430
57 Ga0070661_100032967 3300005344 Bacteria 3752
58 Ga0070661_100044549 3300005344 Bacteria 3241
59 Ga0070661_100071468 3300005344 Bacteria 2554
60 Ga0070661_100077031 3300005344 Bacteria 2458
61 Ga0070692_10021631 3300005345 Bacteria 3131
62 Ga0070692_10070221 3300005345 Bacteria 1864
63 Ga0070668_100000001 3300005347 Bacteria 275905
64 Ga0070668_100003509 3300005347 Bacteria 11560
65 Ga0070668_100082654 3300005347 Bacteria 2519
66 Ga0070669_100000031 3300005353 Bacteria 154042
67 Ga0070669_100003809 3300005353 Bacteria 10897
68 Ga0070669_100030659 3300005353 Bacteria 3882
69 Ga0070669_100062266 3300005353 Bacteria 2743
70 Ga0070675_100021804 3300005354 Bacteria 5117
71 Ga0070675_100030286 3300005354 Bacteria 4368
72 Ga0070675_100065049 3300005354 Bacteria 3014
73 Ga0070671_100000046 3300005355 Bacteria 84967
74 Ga0070671_100002287 3300005355 Bacteria 14783
75 Ga0070671_100011836 3300005355 Bacteria 7018
76 Ga0070671_100014974 3300005355 Bacteria 6263
77 Ga0070671_100023741 3300005355 Bacteria 5019
78 Ga0070671_100029474 3300005355 Bacteria 4525
79 Ga0070671_100082996 3300005355 Bacteria 2680
80 Ga0070671_100115675 3300005355 Bacteria 2255
81 Ga0070671_100181432 3300005355 Bacteria 1782
82 Ga0070674_100002123 3300005356 Bacteria 10885
83 Ga0070674_100020365 3300005356 Bacteria 4236
84 Ga0070674_100038868 3300005356 Bacteria 3210
85 Ga0070674_100054852 3300005356 Bacteria 2758
86 Ga0070674_100057819 3300005356 Bacteria 2693
87 Ga0070674_100115765 3300005356 Bacteria 1977
88 Ga0070673_100000015 3300005364 Bacteria 118064
89 Ga0070673_100002926 3300005364 Bacteria 10520
90 Ga0070673_100005220 3300005364 Bacteria 8293
91 Ga0070673_100005676 3300005364 Bacteria 8019
92 Ga0070673_100100128 3300005364 Bacteria 2385
93 Ga0070673_100201983 3300005364 Bacteria 1712
94 Ga0070688_100000713 3300005365 Bacteria 16384
95 Ga0070659_100002194 3300005366 Bacteria 13899
96 Ga0070659_100005293 3300005366 Bacteria 9256
97 Ga0070659_100015886 3300005366 Bacteria 5647
98 Ga0070659_100018908 3300005366 Bacteria 5205
99 Ga0070659_100035929 3300005366 Bacteria 3860
100 Ga0070659_100053770 3300005366 Bacteria 3170
101 Ga0070659_100067212 3300005366 Bacteria 2842
102 Ga0070659_100116272 3300005366 Bacteria 2162
103 Ga0070659_100219444 3300005366 Bacteria 1569
104 Ga0070667_100000006 3300005367 Bacteria 336732
105 Ga0070667_100000066 3300005367 Bacteria 134529
106 Ga0070667_100000315 3300005367 Bacteria 54132
107 Ga0070667_100007331 3300005367 Bacteria 9167
108 Ga0070667_100009392 3300005367 Bacteria 8112
109 Ga0070667_100012209 3300005367 Bacteria 7108
110 Ga0070667_100022714 3300005367 Bacteria 5202
111 Ga0070667_100030332 3300005367 Bacteria 4510
112 Ga0070709_10008560 3300005434 Bacteria 5624
113 Ga0070714_100032532 3300005435 Bacteria 4354
114 Ga0070663_100003972 3300005455 Bacteria 8628
115 Ga0070663_100074196 3300005455 Bacteria 2483
116 Ga0070663_100111228 3300005455 Bacteria 2058
117 Ga0070678_100002434 3300005456 Bacteria 10198
118 Ga0070678_100018974 3300005456 Bacteria 4469
119 Ga0070678_100315640 3300005456 Bacteria 1333
120 Ga0070662_100001002 3300005457 Bacteria 17247
121 Ga0070662_100023564 3300005457 Bacteria 4230
122 Ga0070662_100024630 3300005457 Bacteria 4148
123 Ga0070662_100106008 3300005457 Bacteria 2134
124 Ga0070662_100179824 3300005457 Bacteria 1667
125 Ga0068867_100000030 3300005459 Bacteria 86560
126 Ga0068867_100024131 3300005459 Bacteria 4358
127 Ga0068867_100083228 3300005459 Bacteria 2415
128 Ga0070685_10000481 3300005466 Bacteria 23166
129 Ga0070685_10017076 3300005466 Bacteria 3878
130 Ga0070679_100000007 3300005530 Bacteria 195373
131 Ga0070679_100044549 3300005530 Bacteria 4420
132 Ga0070679_100306264 3300005530 Bacteria 1539
133 Ga0070684_100017184 3300005535 Bacteria 5930
134 Ga0068853_100004012 3300005539 Bacteria 11322
135 Ga0068853_100009896 3300005539 Bacteria 7696
136 Ga0068853_100012193 3300005539 Bacteria 6991
137 Ga0068853_100080908 3300005539 Bacteria 2844
138 Ga0068853_100083372 3300005539 Bacteria 2801
139 Ga0068853_100100721 3300005539 Bacteria 2554
140 Ga0070672_100017516 3300005543 Bacteria 5159
141 Ga0070672_100028466 3300005543 Bacteria 4180
142 Ga0070672_100113682 3300005543 Bacteria 2209
143 Ga0070672_100121919 3300005543 Bacteria 2135
144 Ga0070686_100000018 3300005544 Bacteria 140685
145 Ga0070686_100000681 3300005544 Bacteria 19737
146 Ga0070686_100012646 3300005544 Bacteria 4812
147 Ga0070695_100056822 3300005545 Bacteria 2527
148 Ga0070665_100000071 3300005548 Bacteria 200675
149 Ga0070665_100005588 3300005548 Bacteria 12931
150 Ga0070665_100079937 3300005548 Bacteria 3275
151 Ga0068855_100234622 3300005563 Bacteria 2052
152 Ga0068855_100329587 3300005563 Bacteria 1685
153 Ga0070664_100005421 3300005564 Bacteria 10239
154 Ga0070664_100007258 3300005564 Bacteria 8933
155 Ga0070664_100090621 3300005564 Bacteria 2646
156 Ga0070664_100109315 3300005564 Bacteria 2412
157 Ga0070664_100116139 3300005564 Bacteria 2340
158 Ga0070664_100123103 3300005564 Bacteria 2272
159 Ga0068857_100016701 3300005577 Bacteria 6431
160 Ga0068857_100084384 3300005577 Bacteria 2838
161 Ga0068854_100000027 3300005578 Bacteria 117836
162 Ga0068854_100013594 3300005578 Bacteria 5348
163 Ga0068854_100016376 3300005578 Bacteria 4941
164 Ga0068854_100088394 3300005578 Bacteria 2301
165 Ga0068854_100134107 3300005578 Bacteria 1894
166 Ga0068856_100010592 3300005614 Bacteria 8957
167 Ga0068856_100036485 3300005614 Bacteria 4820
168 Ga0068856_100043523 3300005614 Bacteria 4418
169 Ga0068856_100363661 3300005614 Bacteria 1465
170 Ga0068852_100001514 3300005616 Bacteria 15720
171 Ga0068852_100013796 3300005616 Bacteria 6195
172 Ga0068852_100015664 3300005616 Bacteria 5889
173 Ga0068852_100036973 3300005616 Bacteria 4091
174 Ga0068859_100003342 3300005617 Bacteria 16314
175 Ga0068859_100047289 3300005617 Bacteria 4322
176 Ga0068864_100000123 3300005618 Bacteria 75407
177 Ga0068864_100001531 3300005618 Bacteria 19037
178 Ga0068864_100002776 3300005618 Bacteria 14466
179 Ga0068864_100004621 3300005618 Bacteria 11294
180 Ga0068864_100014051 3300005618 Bacteria 6641
181 Ga0068866_10046228 3300005718 Bacteria 2188
182 Ga0068861_100026337 3300005719 Bacteria 4226
183 Ga0068861_100084513 3300005719 Bacteria 2492
184 Ga0068861_100154369 3300005719 Bacteria 1887
185 Ga0068851_10014286 3300005834 Bacteria 3769
186 Ga0068851_10022710 3300005834 Bacteria 3060
187 Ga0068851_10042555 3300005834 Bacteria 2287
188 Ga0068863_100000025 3300005841 Bacteria 186072
189 Ga0068863_100000323 3300005841 Bacteria 48685
190 Ga0068863_100002570 3300005841 Bacteria 17992
191 Ga0068863_100004728 3300005841 Bacteria 13417
192 Ga0068863_100005243 3300005841 Bacteria 12792
193 Ga0068863_100011938 3300005841 Bacteria 8394
194 Ga0068863_100130679 3300005841 Bacteria 2398
195 Ga0068863_100251287 3300005841 Bacteria 1708
196 Ga0068858_100000417 3300005842 Bacteria 44184
197 Ga0068858_100001016 3300005842 Bacteria 28931
198 Ga0068858_100006240 3300005842 Bacteria 11615
199 Ga0068858_100010757 3300005842 Bacteria 8651
200 Ga0068860_100000013 3300005843 Bacteria 323055
201 Ga0068860_100000022 3300005843 Bacteria 279209
202 Ga0068860_100000074 3300005843 Bacteria 173022
203 Ga0068860_100067885 3300005843 Bacteria 3387
204 Ga0068862_100000027 3300005844 Bacteria 186072
205 Ga0068862_100000043 3300005844 Bacteria 164356
206 Ga0068862_100000286 3300005844 Bacteria 55798
207 Ga0068862_100000602 3300005844 Bacteria 37405
208 Ga0081455_10000088 3300005937 Bacteria 98815
209 Ga0081539_10069984 3300005985 Bacteria 1885
210 Ga0075363_100012593 3300006048 Bacteria 4081
211 Ga0070716_100027757 3300006173 Bacteria 3044
212 Ga0075367_10022015 3300006178 Bacteria 3569
213 Ga0075366_10122866 3300006195 Bacteria 1565
214 Ga0097621_100002082 3300006237 Bacteria 13695
215 Ga0097621_100005795 3300006237 Bacteria 8724
216 Ga0075370_10005135 3300006353 Bacteria 6459
217 Ga0075370_10026940 3300006353 Bacteria 3187
218 Ga0068871_100011965 3300006358 Bacteria 6388
219 Ga0075433_10028588 3300006852 Bacteria 4741
220 Ga0068865_100000021 3300006881 Bacteria 103137
221 Ga0068865_100003551 3300006881 Bacteria 9359
222 Ga0068865_100171321 3300006881 Bacteria 1664
223 Ga0097620_100003342 3300006931 Bacteria 16314
224 Ga0097620_100047287 3300006931 Bacteria 4322
225 Ga0105251_10000159 3300009011 Bacteria 68974
226 Ga0105240_10152372 3300009093 Bacteria 2752
227 Ga0105245_10036369 3300009098 Bacteria 4374
228 Ga0105245_10208235 3300009098 Bacteria 1881
229 Ga0105243_10000748 3300009148 Bacteria 31133
230 Ga0105243_10047987 3300009148 Bacteria 3365
231 Ga0105243_10161834 3300009148 Bacteria 1930
232 Ga0105242_10000198 3300009176 Bacteria 46869
233 Ga0105242_10069894 3300009176 Bacteria 2910
234 Ga0105248_10000026 3300009177 Bacteria 257155
235 Ga0105248_10002719 3300009177 Bacteria 19642
236 Ga0105248_10006916 3300009177 Bacteria 12433
237 Ga0105248_10009017 3300009177 Bacteria 10969
238 Ga0105237_10009984 3300009545 Bacteria 10131
239 Ga0105237_10086169 3300009545 Bacteria 3131
240 Ga0105237_10119826 3300009545 Bacteria 2625
241 Ga0105238_10010294 3300009551 Bacteria 9381
242 Ga0105238_10010489 3300009551 Bacteria 9300
243 Ga0105238_10105740 3300009551 Bacteria 2796
244 Ga0105238_10191348 3300009551 Bacteria 2022
245 Ga0105249_10000014 3300009553 Bacteria 283274
246 Ga0105249_10000110 3300009553 Bacteria 111292
247 Ga0105249_10059125 3300009553 Bacteria 3515
248 Ga0105239_10038535 3300010375 Bacteria 5238
249 Ga0105239_10079131 3300010375 Bacteria 3617
250 Ga0105239_10286199 3300010375 Bacteria 1856
251 Ga0105239_10300798 3300010375 Bacteria 1807
252 Ga0105246_10002051 3300011119 Bacteria 12144
253 Ga0105246_10032319 3300011119 Bacteria 3470
254 Ga0105246_10034124 3300011119 Bacteria 3387
255 Ga0157373_10003459 3300013100 Bacteria 11943
256 Ga0157373_10048292 3300013100 Bacteria 3035
257 Ga0157370_10122339 3300013104 Bacteria 2430
258 Ga0157369_10001381 3300013105 Bacteria 29880
259 Ga0157369_10079349 3300013105 Bacteria 3516
260 Ga0157369_10286337 3300013105 Bacteria 1716
261 Ga0157374_10003145 3300013296 Bacteria 13874
262 Ga0157374_10166323 3300013296 Bacteria 2149
263 Ga0157378_10010279 3300013297 Bacteria 8172
264 Ga0157378_10068955 3300013297 Bacteria 3172
265 Ga0157378_10078659 3300013297 Bacteria 2976
266 Ga0163162_10027428 3300013306 Bacteria 5632
267 Ga0163162_10066546 3300013306 Bacteria 3652
268 Ga0163162_10188618 3300013306 Bacteria 2189
269 Ga0157372_10009365 3300013307 Bacteria 10424
270 Ga0157372_10112965 3300013307 Bacteria 3113
271 Ga0157372_10194774 3300013307 Bacteria 2348
272 Ga0157375_10002408 3300013308 Bacteria 16200
273 Ga0157375_10007486 3300013308 Bacteria 9551
274 Ga0157375_10021115 3300013308 Bacteria 5964
275 Ga0157375_10056614 3300013308 Bacteria 3872
276 Ga0157375_10088260 3300013308 Bacteria 3155
277 Ga0163163_10029103 3300014325 Bacteria 5311
278 Ga0157380_10000040 3300014326 Bacteria 76401
279 Ga0157380_10000315 3300014326 Bacteria 29340
280 Ga0157380_10000371 3300014326 Bacteria 27122
281 Ga0157380_10243993 3300014326 Bacteria 1621
282 Ga0157379_10006996 3300014968 Bacteria 9752
283 Ga0157376_10000140 3300014969 Bacteria 49314
284 Ga0163161_10000186 3300017792 Bacteria 57200
285 Ga0206356_10876973 3300020070 Bacteria 1661
286 Ga0206354_10216959 3300020081 Bacteria 3759
287 Ga0206353_11106818 3300020082 Bacteria 6459
288 Ga0213873_10000010 3300021358 Bacteria 223024
289 Ga0213876_10000027 3300021384 Bacteria 223024
290 Ga0213876_10003843 3300021384 Bacteria 8512
291 Ga0213875_10000166 3300021388 Bacteria 68786
292 Ga0209147_100298 3300025229 Bacteria 40972
293 Ga0207656_10008550 3300025321 Bacteria 3773
294 Ga0207713_1000491 3300025735 Bacteria 40778
295 Ga0207682_10008709 3300025893 Bacteria 4013
296 Ga0207710_10011345 3300025900 Bacteria 3751
297 Ga0207688_10048536 3300025901 Bacteria 2372
298 Ga0207680_10000007 3300025903 Bacteria 623574
299 Ga0207680_10000821 3300025903 Bacteria 14643
300 Ga0207680_10010099 3300025903 Bacteria 4712
301 Ga0207680_10010579 3300025903 Bacteria 4620
302 Ga0207647_10000627 3300025904 Bacteria 27507
303 Ga0207647_10000748 3300025904 Bacteria 25450
304 Ga0207647_10016672 3300025904 Bacteria 5008
305 Ga0207647_10021518 3300025904 Bacteria 4304
306 Ga0207647_10052537 3300025904 Bacteria 2515
307 Ga0207647_10052658 3300025904 Bacteria 2511
308 Ga0207699_10012553 3300025906 Bacteria 4311
309 Ga0207645_10000523 3300025907 Bacteria 31917
310 Ga0207705_10000025 3300025909 Bacteria 259826
311 Ga0207705_10002730 3300025909 Bacteria 13529
312 Ga0207705_10015976 3300025909 Bacteria 5389
313 Ga0207705_10059980 3300025909 Bacteria 2747
314 Ga0207654_10008184 3300025911 Bacteria 5274
315 Ga0207695_10008658 3300025913 Bacteria 12698
316 Ga0207695_10009684 3300025913 Bacteria 11865
317 Ga0207671_10000350 3300025914 Bacteria 66648
318 Ga0207671_10034430 3300025914 Bacteria 3762
319 Ga0207660_10000536 3300025917 Bacteria 25438
320 Ga0207660_10019298 3300025917 Bacteria 4555
321 Ga0207657_10000594 3300025919 Bacteria 38336
322 Ga0207657_10002675 3300025919 Bacteria 19218
323 Ga0207657_10011581 3300025919 Bacteria 8749
324 Ga0207657_10015100 3300025919 Bacteria 7501
325 Ga0207657_10019526 3300025919 Bacteria 6433
326 Ga0207657_10029764 3300025919 Bacteria 4965
327 Ga0207657_10066617 3300025919 Bacteria 3065
328 Ga0207657_10092883 3300025919 Bacteria 2514
329 Ga0207657_10248180 3300025919 Bacteria 1420
330 Ga0207649_10000074 3300025920 Bacteria 85018
331 Ga0207649_10011117 3300025920 Bacteria 4955
332 Ga0207649_10014515 3300025920 Bacteria 4412
333 Ga0207652_10000001 3300025921 Bacteria 1006643
334 Ga0207652_10000002 3300025921 Bacteria 878035
335 Ga0207652_10014994 3300025921 Bacteria 6287
336 Ga0207652_10095568 3300025921 Bacteria 2618
337 Ga0207681_10000014 3300025923 Bacteria 353422
338 Ga0207681_10000199 3300025923 Bacteria 47783
339 Ga0207681_10015882 3300025923 Bacteria 4700
340 Ga0207681_10018745 3300025923 Bacteria 4364
341 Ga0207681_10049089 3300025923 Bacteria 2851
342 Ga0207694_10004154 3300025924 Bacteria 11366
343 Ga0207694_10095572 3300025924 Bacteria 2349
344 Ga0207650_10000015 3300025925 Bacteria 369173
345 Ga0207650_10000056 3300025925 Bacteria 157972
346 Ga0207650_10005758 3300025925 Bacteria 8453
347 Ga0207650_10061101 3300025925 Bacteria 2812
348 Ga0207650_10069682 3300025925 Bacteria 2642
349 Ga0207650_10151324 3300025925 Bacteria 1831
350 Ga0207659_10012135 3300025926 Bacteria 5466
351 Ga0207659_10019289 3300025926 Bacteria 4485
352 Ga0207659_10088946 3300025926 Bacteria 2302
353 Ga0207687_10029300 3300025927 Bacteria 3702
354 Ga0207664_10039239 3300025929 Bacteria 3676
355 Ga0207644_10000117 3300025931 Bacteria 58917
356 Ga0207644_10000230 3300025931 Bacteria 38307
357 Ga0207644_10000729 3300025931 Bacteria 20845
358 Ga0207644_10001257 3300025931 Bacteria 16312
359 Ga0207644_10004051 3300025931 Bacteria 9507
360 Ga0207644_10009847 3300025931 Bacteria 6287
361 Ga0207690_10002458 3300025932 Bacteria 11196
362 Ga0207690_10017303 3300025932 Bacteria 4399
363 Ga0207690_10084202 3300025932 Bacteria 2228
364 Ga0207690_10103523 3300025932 Bacteria 2037
365 Ga0207690_10164652 3300025932 Bacteria 1656
366 Ga0207706_10003608 3300025933 Bacteria 14780
367 Ga0207706_10011126 3300025933 Bacteria 8200
368 Ga0207706_10034739 3300025933 Bacteria 4486
369 Ga0207706_10035507 3300025933 Bacteria 4431
370 Ga0207706_10036096 3300025933 Bacteria 4392
371 Ga0207706_10099552 3300025933 Bacteria 2558
372 Ga0207706_10117315 3300025933 Bacteria 2341
373 Ga0207706_10132974 3300025933 Bacteria 2188
374 Ga0207706_10146953 3300025933 Bacteria 2074
375 Ga0207706_10181922 3300025933 Bacteria 1846
376 Ga0207706_10214565 3300025933 Bacteria 1686
377 Ga0207686_10000215 3300025934 Bacteria 44113
378 Ga0207709_10000118 3300025935 Bacteria 122125
379 Ga0207670_10004991 3300025936 Bacteria 7227
380 Ga0207669_10025186 3300025937 Bacteria 3211
381 Ga0207669_10041952 3300025937 Bacteria 2667
382 Ga0207669_10046380 3300025937 Bacteria 2568
383 Ga0207669_10067751 3300025937 Bacteria 2226
384 Ga0207669_10162469 3300025937 Bacteria 1579
385 Ga0207704_10000027 3300025938 Bacteria 122372
386 Ga0207665_10022883 3300025939 Bacteria 4114
387 Ga0207691_10006731 3300025940 Bacteria 11083
388 Ga0207691_10010314 3300025940 Bacteria 8962
389 Ga0207691_10015809 3300025940 Bacteria 7171
390 Ga0207691_10032188 3300025940 Bacteria 4890
391 Ga0207691_10047567 3300025940 Bacteria 3936
392 Ga0207691_10152067 3300025940 Bacteria 2034
393 Ga0207711_10000004 3300025941 Bacteria 870636
394 Ga0207711_10000107 3300025941 Bacteria 87146
395 Ga0207711_10000371 3300025941 Bacteria 47663
396 Ga0207711_10000917 3300025941 Bacteria 28411
397 Ga0207711_10002164 3300025941 Bacteria 17672
398 Ga0207711_10013381 3300025941 Bacteria 6816
399 Ga0207689_10000584 3300025942 Bacteria 34795
400 Ga0207661_10047249 3300025944 Bacteria 3416
401 Ga0207679_10002925 3300025945 Bacteria 10572
402 Ga0207679_10004931 3300025945 Bacteria 8325
403 Ga0207679_10006737 3300025945 Bacteria 7278
404 Ga0207679_10036669 3300025945 Bacteria 3479
405 Ga0207679_10112082 3300025945 Bacteria 2155
406 Ga0207679_10197724 3300025945 Bacteria 1677
407 Ga0207667_10003112 3300025949 Bacteria 20535
408 Ga0207667_10016210 3300025949 Bacteria 8422
409 Ga0207667_10024479 3300025949 Bacteria 6629
410 Ga0207667_10097128 3300025949 Bacteria 3041
411 Ga0207651_10000016 3300025960 Bacteria 122094
412 Ga0207651_10000971 3300025960 Bacteria 12648
413 Ga0207651_10004999 3300025960 Bacteria 6761
414 Ga0207651_10007093 3300025960 Bacteria 5947
415 Ga0207651_10033616 3300025960 Bacteria 3310
416 Ga0207712_10000004 3300025961 Bacteria 614655
417 Ga0207712_10000195 3300025961 Bacteria 62560
418 Ga0207712_10000311 3300025961 Bacteria 44496
419 Ga0207668_10000009 3300025972 Bacteria 188071
420 Ga0207668_10004966 3300025972 Bacteria 7827
421 Ga0207668_10008749 3300025972 Bacteria 6050
422 Ga0207668_10019256 3300025972 Bacteria 4311
423 Ga0207640_10000371 3300025981 Bacteria 29012
424 Ga0207640_10007770 3300025981 Bacteria 5922
425 Ga0207640_10028204 3300025981 Bacteria 3430
426 Ga0207640_10031086 3300025981 Bacteria 3295
427 Ga0207640_10080096 3300025981 Bacteria 2228
428 Ga0207658_10000010 3300025986 Bacteria 240224
429 Ga0207658_10000287 3300025986 Bacteria 52758
430 Ga0207658_10000512 3300025986 Bacteria 35351
431 Ga0207658_10000768 3300025986 Bacteria 27428
432 Ga0207658_10003944 3300025986 Bacteria 10423
433 Ga0207658_10005700 3300025986 Bacteria 8516
434 Ga0207658_10017423 3300025986 Bacteria 4948
435 Ga0207658_10096851 3300025986 Bacteria 2302
436 Ga0207677_10000192 3300026023 Bacteria 49458
437 Ga0207677_10006497 3300026023 Bacteria 6423
438 Ga0207677_10049584 3300026023 Bacteria 2834
439 Ga0207677_10088774 3300026023 Bacteria 2242
440 Ga0207703_10000479 3300026035 Bacteria 41910
441 Ga0207703_10001633 3300026035 Bacteria 20216
442 Ga0207703_10006096 3300026035 Bacteria 9644
443 Ga0207703_10040776 3300026035 Bacteria 3717
444 Ga0207639_10003366 3300026041 Bacteria 10754
445 Ga0207639_10006286 3300026041 Bacteria 8066
446 Ga0207639_10012894 3300026041 Bacteria 5831
447 Ga0207639_10014197 3300026041 Bacteria 5593
448 Ga0207639_10054600 3300026041 Bacteria 3054
449 Ga0207639_10059217 3300026041 Bacteria 2950
450 Ga0207639_10149875 3300026041 Bacteria 1952
451 Ga0207678_10011697 3300026067 Bacteria 7702
452 Ga0207678_10024747 3300026067 Bacteria 5242
453 Ga0207678_10045368 3300026067 Bacteria 3801
454 Ga0207678_10057520 3300026067 Bacteria 3346
455 Ga0207678_10072664 3300026067 Bacteria 2947
456 Ga0207678_10104865 3300026067 Bacteria 2412
457 Ga0207702_10003449 3300026078 Bacteria 14437
458 Ga0207702_10005176 3300026078 Bacteria 11472
459 Ga0207702_10009656 3300026078 Bacteria 8102
460 Ga0207702_10383624 3300026078 Bacteria 1352
461 Ga0207641_10000018 3300026088 Bacteria 298209
462 Ga0207641_10000216 3300026088 Bacteria 74765
463 Ga0207641_10000584 3300026088 Bacteria 40125
464 Ga0207641_10002403 3300026088 Bacteria 17295
465 Ga0207641_10017266 3300026088 Bacteria 5907
466 Ga0207641_10021386 3300026088 Bacteria 5316
467 Ga0207641_10024033 3300026088 Bacteria 5021
468 Ga0207641_10036223 3300026088 Bacteria 4118
469 Ga0207641_10112391 3300026088 Bacteria 2417
470 Ga0207648_10000116 3300026089 Bacteria 77755
471 Ga0207648_10004968 3300026089 Bacteria 13529
472 Ga0207648_10005659 3300026089 Bacteria 12549
473 Ga0207676_10000021 3300026095 Bacteria 296572
474 Ga0207676_10000027 3300026095 Bacteria 245868
475 Ga0207676_10002208 3300026095 Bacteria 14055
476 Ga0207676_10002967 3300026095 Bacteria 12106
477 Ga0207676_10007460 3300026095 Bacteria 7760
478 Ga0207676_10016018 3300026095 Bacteria 5424
479 Ga0207674_10000065 3300026116 Bacteria 109485
480 Ga0207674_10003373 3300026116 Bacteria 19614
481 Ga0207674_10024950 3300026116 Bacteria 6381
482 Ga0207674_10038465 3300026116 Bacteria 4963
483 Ga0207675_100000777 3300026118 Bacteria 31865
484 Ga0207675_100003380 3300026118 Bacteria 15596
485 Ga0207675_100056121 3300026118 Bacteria 3674
486 Ga0207675_100143806 3300026118 Bacteria 2267
487 Ga0207683_10002092 3300026121 Bacteria 17578
488 Ga0207683_10030447 3300026121 Bacteria 4677
489 Ga0207698_10000116 3300026142 Bacteria 49993
490 Ga0207698_10001553 3300026142 Bacteria 13380
491 Ga0207698_10097892 3300026142 Bacteria 2422
492 Ga0209813_10000468 3300027866 Bacteria 9700
493 Ga0268266_10000040 3300028379 Bacteria 323843
494 Ga0268266_10017275 3300028379 Bacteria 6159
495 Ga0268266_10071681 3300028379 Bacteria 3003
496 Ga0268266_10147933 3300028379 Bacteria 2114
497 Ga0268266_10260066 3300028379 Bacteria 1608
498 Ga0268265_10000013 3300028380 Bacteria 341536
499 Ga0268265_10000042 3300028380 Bacteria 186086
500 Ga0268265_10000294 3300028380 Bacteria 56208
501 Ga0268265_10000324 3300028380 Bacteria 52110
502 Ga0268264_10000003 3300028381 Bacteria 1141976
503 Ga0268264_10000039 3300028381 Bacteria 376641
504 Ga0268264_10000070 3300028381 Bacteria 268524
505 Ga0268264_10003561 3300028381 Bacteria 13410
506 Ga0268264_10035653 3300028381 Bacteria 4095
507 Ga0307408_100187469 3300031548 Bacteria 1664
508 Ga0307408_100218984 3300031548 Bacteria 1552
509 Ga0307405_10077121 3300031731 Bacteria 2164
510 Ga0307405_10171692 3300031731 Bacteria 1547
511 Ga0307410_10016039 3300031852 Bacteria 4456
512 Ga0307410_10027751 3300031852 Bacteria 3580
513 Ga0307406_10147757 3300031901 Bacteria 1673
514 Ga0307412_10009822 3300031911 Bacteria 5496
515 Ga0307412_10022920 3300031911 Bacteria 3834
516 Ga0307409_100031642 3300031995 Bacteria 3822
517 Ga0307409_100095582 3300031995 Bacteria 2449
518 Ga0307416_100000451 3300032002 Bacteria 21079
519 Ga0307414_10188259 3300032004 Bacteria 1667
520 Ga0307411_10016140 3300032005 Bacteria 4222
521 Ga0373954_0038206 3300035118 Bacteria 2232
522 Ga0373955_0065392 3300035172 Bacteria 2019
523 Ga0373935_0111026 3300035692 Bacteria 1820
524 Ga0373927_0062106 3300035695 Bacteria 2416
525 Ga0373947_0072005 3300035725 Bacteria 2121
526 Ga0373925_0035087 3300037068 Bacteria 3699
527 Ga0395899_0000113 3300037312 Bacteria 136163
528 Ga0395899_0003756 3300037312 Bacteria 11991
529 Ga0395899_0011074 3300037312 Bacteria 6907
530 Ga0395899_0014804 3300037312 Bacteria 5953
531 Ga0395899_0099019 3300037312 Bacteria 2106
532 Ga0395899_0198413 3300037312 Bacteria 1401
533 Ga0395900_0005823 3300037418 Bacteria 12875
534 Ga0395900_0009694 3300037418 Bacteria 9868
535 Ga0395900_0013203 3300037418 Bacteria 8444
536 Ga0395900_0016968 3300037418 Bacteria 7431
537 Ga0395900_0017452 3300037418 Bacteria 7327
538 Ga0395900_0049587 3300037418 Bacteria 4325
539 Ga0395900_0084351 3300037418 Bacteria 3264
540 Ga0395900_0121935 3300037418 Bacteria 2674
541 Ga0395900_0156331 3300037418 Bacteria 2329
542 Ga0395900_0163281 3300037418 Bacteria 2271
543 Ga0395900_0433894 3300037418 Bacteria 1272
544 Ga0395898_0000306 3300037466 Bacteria 115940
545 Ga0395898_0001326 3300037466 Bacteria 35892
546 Ga0395898_0005605 3300037466 Bacteria 13532
547 Ga0395898_0014197 3300037466 Bacteria 8191
548 Ga0395898_0015973 3300037466 Bacteria 7691
549 Ga0395898_0017925 3300037466 Bacteria 7224
550 Ga0395898_0034479 3300037466 Bacteria 5044
551 Ga0395898_0086885 3300037466 Bacteria 3013
552 Ga0395905_0000005 3300037471 Bacteria 557808
553 Ga0395905_0000958 3300037471 Bacteria 37063
554 Ga0395905_0001046 3300037471 Bacteria 35041
555 Ga0395905_0001585 3300037471 Bacteria 27082
556 Ga0395905_0010210 3300037471 Bacteria 9150
557 Ga0395905_0010767 3300037471 Bacteria 8864
558 Ga0395905_0010864 3300037471 Bacteria 8818
559 Ga0395905_0016800 3300037471 Bacteria 6952
560 Ga0395905_0017713 3300037471 Bacteria 6763
561 Ga0395905_0021098 3300037471 Bacteria 6169
562 Ga0395905_0022485 3300037471 Bacteria 5963
563 Ga0395905_0024565 3300037471 Bacteria 5687
564 Ga0395905_0081103 3300037471 Bacteria 3040
565 Ga0395905_0095924 3300037471 Bacteria 2784
566 Ga0395905_0158549 3300037471 Bacteria 2128
567 Ga0395905_0188144 3300037471 Bacteria 1937
568 Ga0395905_0233620 3300037471 Bacteria 1719
569 Ga0395905_0291905 3300037471 Bacteria 1517
570 Ga0436364_0545952 3300037853 Bacteria 79385
571 Ga0395901_0002169 3300038443 Bacteria 20042
572 Ga0395901_0007143 3300038443 Bacteria 11272
573 Ga0395901_0011649 3300038443 Bacteria 8906
574 Ga0395901_0018318 3300038443 Bacteria 7149
575 Ga0395901_0033170 3300038443 Bacteria 5328
576 Ga0395901_0116375 3300038443 Bacteria 2808
577 Ga0395901_0142808 3300038443 Bacteria 2516
578 Ga0395901_0188110 3300038443 Bacteria 2165
579 Ga0395901_0190683 3300038443 Bacteria 2150
580 Ga0395901_0388375 3300038443 Bacteria 1435
581 Ga0436365_0234449 3300039437 Bacteria 99419
582 Ga0436365_0257345 3300039437 Bacteria 14502
583 Ga0436365_1536714 3300039437 Bacteria 19921
584 Ga0436365_1577285 3300039437 Bacteria 4503
585 Ga0436362_0553655 3300039453 Bacteria 122937
586 Ga0451853_1219635 3300041512 Bacteria 1969
587 Ga0439448_0002715 3300042005 Bacteria 4840
588 Ga0439448_0011074 3300042005 Bacteria 2683
589 Ga0439432_025571 3300042006 Bacteria 1936
590 Ga0439449_0011365 3300042007 Bacteria 3350
591 Ga0439455_0001188 3300042012 Bacteria 4232
592 Ga0439458_0000636 3300042157 Bacteria 9077
593 Ga0439458_0003580 3300042157 Bacteria 3623
594 Ga0466969_0002833 3300044656 Bacteria 9276
595 Ga0466972_0002118 3300044658 Bacteria 9742
596 Ga0466972_0081581 3300044658 Bacteria 1540
597 Ga0466966_0047414 3300044684 Bacteria 2740
598 Ga0466966_0085199 3300044684 Bacteria 1964
599 Ga0466963_0054244 3300044694 Bacteria 2663
600 Ga0466964_0020584 3300044706 Bacteria 2542
601 Ga0466971_0020675 3300044719 Bacteria 2926
602 Ga0466971_0024385 3300044719 Bacteria 2699
603 Ga0466971_0039941 3300044719 Bacteria 2107
604 Ga0466970_0002773 3300044765 Bacteria 8455
605 Ga0466970_0004904 3300044765 Bacteria 6606
606 Ga0466957_0001053 3300044842 Bacteria 14217
607 Ga0466957_0068693 3300044842 Bacteria 2188
608 Ga0466957_0089149 3300044842 Bacteria 1931
609 Ga0466960_0017036 3300044901 Bacteria 3162
610 Ga0466960_0017817 3300044901 Bacteria 3104
611 Ga0466959_0022449 3300045049 Bacteria 4666
612 Ga0466959_0041638 3300045049 Bacteria 3390
613 Ga0466959_0046724 3300045049 Bacteria 3185
614 Ga0466958_0005075 3300045836 Bacteria 7035
615 Ga0466958_0029566 3300045836 Bacteria 3251
616 Ga0466967_0145127 3300045976 Bacteria 2213
617 Ga0466967_0148693 3300045976 Bacteria 2187
618 Ga0466967_0209156 3300045976 Bacteria 1850
619 Ga0466967_0350196 3300045976 Bacteria 1429
620 Ga0495617_006653 3300046452 Bacteria 4040
621 Ga0495627_000024 3300046453 Bacteria 250480
622 Ga0495610_0000053 3300046512 Bacteria 142545
623 Ga0495637_0002826 3300046520 Bacteria 9411
624 Ga0495648_0009993 3300046524 Bacteria 7279
625 Ga0495648_0060033 3300046524 Bacteria 2265
626 Ga0495663_0011834 3300046525 Bacteria 2431
627 Ga0495663_0043540 3300046525 Bacteria 1371
628 Ga0495654_0000620 3300046530 Bacteria 28271
629 Ga0495598_0000194 3300046537 Bacteria 10705
630 Ga0495621_0002136 3300046539 Bacteria 5246
631 Ga0495668_0001088 3300046616 Bacteria 28328
632 Ga0495668_0023290 3300046616 Bacteria 3534
633 Ga0495668_0048007 3300046616 Bacteria 2369
634 Ga0495668_0093322 3300046616 Bacteria 1648
635 Ga0495669_0000599 3300046684 Bacteria 15785
636 Ga0495669_0001837 3300046684 Bacteria 8692
637 Ga0495669_0030328 3300046684 Bacteria 2374
638 Ga0495670_0038423 3300046691 Bacteria 2386
639 Ga0495683_0070833 3300047323 Bacteria 1712
640 Ga0495681_0000099 3300047470 Bacteria 75808
641 Ga0495681_0001636 3300047470 Bacteria 16634
642 Ga0495686_0119377 3300047472 Bacteria 1573
643 Ga0495602_0016614 3300048088 Bacteria 7398
644 Ga0496100_0088838 3300048903 Bacteria 2104
645 Ga0496101_0000533 3300048904 Bacteria 23349
646 Ga0496101_0037290 3300048904 Bacteria 3448
647 Ga0496102_0000010 3300048905 Bacteria 324617
648 Ga0496102_0036921 3300048905 Bacteria 4405
649 Ga0496102_0194181 3300048905 Bacteria 1913
650 Ga0496103_0000029 3300048906 Bacteria 213326
651 Ga0496103_0001191 3300048906 Bacteria 17849
652 Ga0496103_0064099 3300048906 Bacteria 2290
653 Ga0496104_0017717 3300048907 Bacteria 6492
654 Ga0496105_0004359 3300048908 Bacteria 10652
655 Ga0496106_0007216 3300048909 Bacteria 8210
656 Ga0496106_0063212 3300048909 Bacteria 2813
657 Ga0496107_0005864 3300048910 Bacteria 8410
658 Ga0496107_0079859 3300048910 Bacteria 2385
659 Ga0496107_0133137 3300048910 Bacteria 1836
660 Ga0496108_0000482 3300048911 Bacteria 31959
661 Ga0496108_0004124 3300048911 Bacteria 11674
662 Ga0496108_0006891 3300048911 Bacteria 9196
663 Ga0496108_0224247 3300048911 Bacteria 1633
664 Ga0496109_0002603 3300048912 Bacteria 15119
665 Ga0496109_0027863 3300048912 Bacteria 5049
666 Ga0496110_0000347 3300048913 Bacteria 30884
667 Ga0496110_0006617 3300048913 Bacteria 9207
668 Ga0496110_0080420 3300048913 Bacteria 2904
669 Ga0496111_0010584 3300048914 Bacteria 6197
670 Ga0496112_0003652 3300048915 Bacteria 12820
671 Ga0496112_0005111 3300048915 Bacteria 11272
672 Ga0496112_0006181 3300048915 Bacteria 10476
673 Ga0496112_0008504 3300048915 Bacteria 9196
674 Ga0496113_0018020 3300048916 Bacteria 4912
675 Ga0496113_0171660 3300048916 Bacteria 1717
676 Ga0496116_0000942 3300048919 Bacteria 35835
677 Ga0496116_0049461 3300048919 Bacteria 2812
678 Ga0496117_0000037 3300048920 Bacteria 324960
679 Ga0496117_0007661 3300048920 Bacteria 10460
680 Ga0496117_0062597 3300048920 Bacteria 2549
681 Ga0496118_0000034 3300048921 Bacteria 322764
682 Ga0496118_0000689 3300048921 Bacteria 54897
683 Ga0496118_0010460 3300048921 Bacteria 9187
684 Ga0496119_0015128 3300048922 Bacteria 5972
685 Ga0496119_0016847 3300048922 Bacteria 5531
686 Ga0496120_0011194 3300048923 Bacteria 6191
687 Ga0496120_0018136 3300048923 Bacteria 4544
688 Ga0496121_0001024 3300048924 Bacteria 49819
689 Ga0496121_0051640 3300048924 Bacteria 3461
690 Ga0496122_0001502 3300048925 Bacteria 37251
691 Ga0496123_0002683 3300048926 Bacteria 21419
692 Ga0496124_0000033 3300048927 Bacteria 330586
693 Ga0496124_0097996 3300048927 Bacteria 2379
694 Ga0496125_0008402 3300048928 Bacteria 10816
695 Ga0496125_0050350 3300048928 Bacteria 3450
696 Ga0496125_0066069 3300048928 Bacteria 2861
697 Ga0496125_0071020 3300048928 Bacteria 2722
698 Ga0496126_0022584 3300048929 Bacteria 6117
699 Ga0501290_000215 3300049513 Bacteria 9570
700 Ga0501292_000181 3300049515 Bacteria 10084
701 Ga0501046_0040917 3300049580 Bacteria 3701
702 Ga0501068_0060266 3300049584 Bacteria 2304
703 Ga0501227_005214 3300049665 Bacteria 2786
704 Ga0501235_002586 3300049669 Bacteria 3892
705 Ga0501261_000172 3300049690 Bacteria 9210
706 Ga0501225_0002320 3300049705 Bacteria 5876
707 Ga0501234_008130 3300049707 Bacteria 1640
708 Ga0501245_001140 3300049708 Bacteria 3426
709 Ga0501279_000144 3300049775 Bacteria 10040
710 Ga0501280_000005 3300049776 Bacteria 85174
711 Ga0501044_0140596 3300049823 Bacteria 2403
712 nmdc:mga0k408_39192_c1 3300050493 Bacteria 2721
713 nmdc:mga06z11_348_c1 3300050494 Bacteria 17434
714 nmdc:mga04h51_137_c1 3300050495 Bacteria 21470
715 nmdc:mga07m45_43381_c1 3300050496 Bacteria 2521
716 nmdc:mga07m45_64284_c1 3300050496 Bacteria 2082
717 nmdc:mga0a205_802_c1 3300050515 Bacteria 25500
718 Ga0500643_000305 3300053087 Bacteria 40867
719 Ga0500562_010370 3300053108 Bacteria 2362
720 Ga0500592_000757 3300053116 Bacteria 5295
721 Ga0500592_009042 3300053116 Bacteria 1582
722 Ga0500624_000018 3300053157 Bacteria 131677
723 Ga0500627_0000110 3300053158 Bacteria 26911
724 Ga0466962_0004085 3300061719 Bacteria 6991
725 Ga0466962_0008275 3300061719 Bacteria 4983

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025920 Ga0207649_10011117 Ga0207649_100111174 357
2 3300045976 Ga0466967_0350196 Ga0466967_0350196_13_1122 360
3 3300047323 Ga0495683_0070833 Ga0495683_0070833_480_1598 362
4 3300003322 rootL2_10273144 rootL2_102731443 363
5 3300021358 Ga0213873_10000010 Ga0213873_10000010122 381
6 3300021384 Ga0213876_10000027 Ga0213876_10000027122 381
7 3300039437 Ga0436365_0234449 Ga0436365_0234449_90300_91559 381
8 3300039453 Ga0436362_0553655 Ga0436362_0553655_60478_61737 381
9 3300025933 Ga0207706_10146953 Ga0207706_101469533 383
10 3300037418 Ga0395900_0433894 Ga0395900_0433894_82_1260 383
11 3300045049 Ga0466959_0046724 Ga0466959_0046724_46_1224 383
12 3300049707 Ga0501234_008130 Ga0501234_008130_235_1467 391
13 3300025919 Ga0207657_10066617 Ga0207657_100666173 393
14 3300005338 Ga0068868_100086537 Ga0068868_1000865372 398
15 3300005344 Ga0070661_100077031 Ga0070661_1000770312 398
16 3300005577 Ga0068857_100084384 Ga0068857_1000843842 398
17 3300006852 Ga0075433_10028588 Ga0075433_100285883 398
18 3300026023 Ga0207677_10088774 Ga0207677_100887742 398
19 3300026088 Ga0207641_10112391 Ga0207641_101123912 398
20 3300026116 Ga0207674_10024950 Ga0207674_100249504 398
21 3300050515 nmdc:mga0a205_802_c1 nmdc:mga0a205_802_c1_7615_8901 398
22 3300047472 Ga0495686_0119377 Ga0495686_0119377_144_1433 399
23 3300011119 Ga0105246_10034124 Ga0105246_100341242 400
24 3300005347 Ga0070668_100082654 Ga0070668_1000826542 401
25 3300005366 Ga0070659_100002194 Ga0070659_10000219412 401
26 3300005457 Ga0070662_100001002 Ga0070662_10000100216 401
27 3300005543 Ga0070672_100028466 Ga0070672_1000284663 401
28 3300005563 Ga0068855_100329587 Ga0068855_1003295871 401
29 3300005843 Ga0068860_100067885 Ga0068860_1000678852 401
30 3300009093 Ga0105240_10152372 Ga0105240_101523722 401
31 3300010375 Ga0105239_10079131 Ga0105239_100791313 401
32 3300013308 Ga0157375_10056614 Ga0157375_100566143 401
33 3300025904 Ga0207647_10000627 Ga0207647_100006273 401
34 3300025933 Ga0207706_10011126 Ga0207706_100111267 401
35 3300025961 Ga0207712_10000195 Ga0207712_1000019542 401
36 3300028381 Ga0268264_10003561 Ga0268264_100035619 401
37 3300005366 Ga0070659_100035929 Ga0070659_1000359292 402
38 3300005344 Ga0070661_100023361 Ga0070661_1000233613 403
39 3300005543 Ga0070672_100113682 Ga0070672_1001136822 403
40 3300005545 Ga0070695_100056822 Ga0070695_1000568222 403
41 3300009148 Ga0105243_10161834 Ga0105243_101618342 403
42 3300025893 Ga0207682_10008709 Ga0207682_100087092 403
43 3300025920 Ga0207649_10014515 Ga0207649_100145153 403
44 3300025925 Ga0207650_10151324 Ga0207650_101513242 403
45 3300025933 Ga0207706_10034739 Ga0207706_100347392 403
46 3300025940 Ga0207691_10047567 Ga0207691_100475672 403
47 3300025945 Ga0207679_10004931 Ga0207679_100049316 403
48 3300002067 JGI24735J21928_10004880 JGI24735J21928_100048803 404
49 3300005331 Ga0070670_100016397 Ga0070670_1000163972 404
50 3300005336 Ga0070680_100004284 Ga0070680_1000042844 404
51 3300005337 Ga0070682_100015303 Ga0070682_1000153033 404
52 3300005339 Ga0070660_100006259 Ga0070660_1000062596 404
53 3300005341 Ga0070691_10001250 Ga0070691_100012505 404
54 3300005344 Ga0070661_100044549 Ga0070661_1000445491 404
55 3300005355 Ga0070671_100002287 Ga0070671_1000022877 404
56 3300005356 Ga0070674_100038868 Ga0070674_1000388682 404
57 3300005364 Ga0070673_100201983 Ga0070673_1002019832 404
58 3300005366 Ga0070659_100005293 Ga0070659_1000052931 404
59 3300005457 Ga0070662_100023564 Ga0070662_1000235644 404
60 3300005535 Ga0070684_100017184 Ga0070684_1000171843 404
61 3300005539 Ga0068853_100004012 Ga0068853_1000040125 404
62 3300005564 Ga0070664_100007258 Ga0070664_1000072589 404
63 3300005578 Ga0068854_100013594 Ga0068854_1000135943 404
64 3300005614 Ga0068856_100010592 Ga0068856_1000105923 404
65 3300005616 Ga0068852_100036973 Ga0068852_1000369732 404
66 3300005618 Ga0068864_100001531 Ga0068864_10000153110 404
67 3300005834 Ga0068851_10022710 Ga0068851_100227103 404
68 3300009177 Ga0105248_10002719 Ga0105248_1000271911 404
69 3300009545 Ga0105237_10009984 Ga0105237_100099844 404
70 3300009551 Ga0105238_10010294 Ga0105238_100102949 404
71 3300013307 Ga0157372_10009365 Ga0157372_100093659 404
72 3300025904 Ga0207647_10016672 Ga0207647_100166723 404
73 3300025909 Ga0207705_10002730 Ga0207705_100027308 404
74 3300025913 Ga0207695_10008658 Ga0207695_100086587 404
75 3300025914 Ga0207671_10034430 Ga0207671_100344303 404
76 3300025917 Ga0207660_10019298 Ga0207660_100192983 404
77 3300025919 Ga0207657_10000594 Ga0207657_100005949 404
78 3300025921 Ga0207652_10095568 Ga0207652_100955682 404
79 3300025931 Ga0207644_10001257 Ga0207644_1000125715 404
80 3300025932 Ga0207690_10002458 Ga0207690_100024584 404
81 3300025933 Ga0207706_10035507 Ga0207706_100355072 404
82 3300025937 Ga0207669_10067751 Ga0207669_100677512 404
83 3300025944 Ga0207661_10047249 Ga0207661_100472491 404
84 3300025949 Ga0207667_10003112 Ga0207667_100031127 404
85 3300025981 Ga0207640_10007770 Ga0207640_100077705 404
86 3300026041 Ga0207639_10003366 Ga0207639_100033664 404
87 3300026067 Ga0207678_10024747 Ga0207678_100247473 404
88 3300026078 Ga0207702_10005176 Ga0207702_100051769 404
89 3300026088 Ga0207641_10021386 Ga0207641_100213867 404
90 3300026116 Ga0207674_10003373 Ga0207674_1000337315 404
91 3300026142 Ga0207698_10001553 Ga0207698_100015531 404
92 3300037312 Ga0395899_0011074 Ga0395899_0011074_3007_4293 404
93 3300037312 Ga0395899_0198413 Ga0395899_0198413_124_1365 404
94 3300037466 Ga0395898_0005605 Ga0395898_0005605_5400_6686 404
95 3300048911 Ga0496108_0004124 Ga0496108_0004124_6655_7941 404
96 3300048915 Ga0496112_0006181 Ga0496112_0006181_5435_6721 404
97 3300005356 Ga0070674_100115765 Ga0070674_1001157651 405
98 3300005539 Ga0068853_100083372 Ga0068853_1000833723 405
99 3300013307 Ga0157372_10194774 Ga0157372_101947742 405
100 3300014326 Ga0157380_10243993 Ga0157380_102439932 405
101 3300020081 Ga0206354_10216959 Ga0206354_102169593 405
102 3300020082 Ga0206353_11106818 Ga0206353_111068182 405
103 3300025937 Ga0207669_10041952 Ga0207669_100419522 405
104 3300025940 Ga0207691_10032188 Ga0207691_100321884 405
105 3300037418 Ga0395900_0156331 Ga0395900_0156331_771_2045 405
106 3300048911 Ga0496108_0224247 Ga0496108_0224247_282_1550 408
107 3300001904 JGI24736J21556_1000417 JGI24736J21556_10004174 409
108 3300001976 JGI24752J21851_1000152 JGI24752J21851_10001527 409
109 3300001979 JGI24740J21852_10001280 JGI24740J21852_100012803 409
110 3300001989 JGI24739J22299_10016092 JGI24739J22299_100160922 409
111 3300001989 JGI24739J22299_10048144 JGI24739J22299_100481441 409
112 3300001990 JGI24737J22298_10000412 JGI24737J22298_100004127 409
113 3300001990 JGI24737J22298_10002124 JGI24737J22298_100021242 409
114 3300001990 JGI24737J22298_10008210 JGI24737J22298_100082102 409
115 3300001991 JGI24743J22301_10004569 JGI24743J22301_100045692 409
116 3300002070 JGI24750J21931_1000028 JGI24750J21931_100002814 409
117 3300002073 JGI24745J21846_1002439 JGI24745J21846_10024392 409
118 3300002074 JGI24748J21848_1000068 JGI24748J21848_100006812 409
119 3300002075 JGI24738J21930_10008872 JGI24738J21930_100088722 409
120 3300002076 JGI24749J21850_1000643 JGI24749J21850_10006436 409
121 3300002077 JGI24744J21845_10001494 JGI24744J21845_100014943 409
122 3300002239 JGI24034J26672_10000036 JGI24034J26672_1000003611 409
123 3300002244 JGI24742J22300_10001538 JGI24742J22300_100015384 409
124 3300002244 JGI24742J22300_10001672 JGI24742J22300_100016724 409
125 3300002459 JGI24751J29686_10000166 JGI24751J29686_100001664 409
126 3300005295 Ga0065707_10081811 Ga0065707_1008181120 409
127 3300005327 Ga0070658_10001920 Ga0070658_1000192010 409
128 3300005327 Ga0070658_10049607 Ga0070658_100496074 409
129 3300005328 Ga0070676_10001259 Ga0070676_100012599 409
130 3300005330 Ga0070690_100000070 Ga0070690_10000007018 409
131 3300005331 Ga0070670_100000027 Ga0070670_10000002739 409
132 3300005331 Ga0070670_100000158 Ga0070670_10000015850 409
133 3300005331 Ga0070670_100041256 Ga0070670_1000412564 409
134 3300005331 Ga0070670_100139564 Ga0070670_1001395642 409
135 3300005331 Ga0070670_100145041 Ga0070670_1001450412 409
136 3300005333 Ga0070677_10010739 Ga0070677_100107393 409
137 3300005334 Ga0068869_100002182 Ga0068869_1000021822 409
138 3300005335 Ga0070666_10000009 Ga0070666_1000000936 409
139 3300005335 Ga0070666_10003672 Ga0070666_100036726 409
140 3300005336 Ga0070680_100000478 Ga0070680_1000004785 409
141 3300005338 Ga0068868_100000133 Ga0068868_10000013315 409
142 3300005338 Ga0068868_100007367 Ga0068868_1000073673 409
143 3300005338 Ga0068868_100026019 Ga0068868_1000260192 409
144 3300005338 Ga0068868_100042668 Ga0068868_1000426681 409
145 3300005339 Ga0070660_100001618 Ga0070660_10000161812 409
146 3300005339 Ga0070660_100003409 Ga0070660_1000034094 409
147 3300005339 Ga0070660_100004813 Ga0070660_1000048133 409
148 3300005339 Ga0070660_100017116 Ga0070660_1000171162 409
149 3300005339 Ga0070660_100020104 Ga0070660_1000201045 409
150 3300005339 Ga0070660_100104386 Ga0070660_1001043862 409
151 3300005339 Ga0070660_100154855 Ga0070660_1001548552 409
152 3300005340 Ga0070689_100048572 Ga0070689_1000485722 409
153 3300005344 Ga0070661_100000901 Ga0070661_1000009016 409
154 3300005344 Ga0070661_100032967 Ga0070661_1000329672 409
155 3300005344 Ga0070661_100071468 Ga0070661_1000714683 409
156 3300005345 Ga0070692_10021631 Ga0070692_100216312 409
157 3300005345 Ga0070692_10070221 Ga0070692_100702211 409
158 3300005347 Ga0070668_100000001 Ga0070668_1000000013 409
159 3300005347 Ga0070668_100003509 Ga0070668_1000035096 409
160 3300005353 Ga0070669_100000031 Ga0070669_100000031126 409
161 3300005353 Ga0070669_100003809 Ga0070669_1000038095 409
162 3300005353 Ga0070669_100030659 Ga0070669_1000306593 409
163 3300005353 Ga0070669_100062266 Ga0070669_1000622663 409
164 3300005354 Ga0070675_100021804 Ga0070675_1000218046 409
165 3300005354 Ga0070675_100030286 Ga0070675_1000302862 409
166 3300005354 Ga0070675_100065049 Ga0070675_1000650492 409
167 3300005355 Ga0070671_100000046 Ga0070671_10000004619 409
168 3300005355 Ga0070671_100011836 Ga0070671_1000118365 409
169 3300005355 Ga0070671_100014974 Ga0070671_1000149742 409
170 3300005355 Ga0070671_100023741 Ga0070671_1000237413 409
171 3300005355 Ga0070671_100029474 Ga0070671_1000294743 409
172 3300005355 Ga0070671_100082996 Ga0070671_1000829962 409
173 3300005355 Ga0070671_100115675 Ga0070671_1001156752 409
174 3300005355 Ga0070671_100181432 Ga0070671_1001814322 409
175 3300005356 Ga0070674_100002123 Ga0070674_1000021236 409
176 3300005356 Ga0070674_100020365 Ga0070674_1000203652 409
177 3300005356 Ga0070674_100054852 Ga0070674_1000548523 409
178 3300005356 Ga0070674_100057819 Ga0070674_1000578192 409
179 3300005364 Ga0070673_100000015 Ga0070673_10000001528 409
180 3300005364 Ga0070673_100002926 Ga0070673_1000029269 409
181 3300005364 Ga0070673_100005220 Ga0070673_1000052206 409
182 3300005364 Ga0070673_100005676 Ga0070673_1000056762 409
183 3300005364 Ga0070673_100100128 Ga0070673_1001001282 409
184 3300005365 Ga0070688_100000713 Ga0070688_1000007135 409
185 3300005366 Ga0070659_100015886 Ga0070659_1000158862 409
186 3300005366 Ga0070659_100018908 Ga0070659_1000189083 409
187 3300005366 Ga0070659_100053770 Ga0070659_1000537703 409
188 3300005366 Ga0070659_100067212 Ga0070659_1000672122 409
189 3300005366 Ga0070659_100116272 Ga0070659_1001162722 409
190 3300005366 Ga0070659_100219444 Ga0070659_1002194442 409
191 3300005367 Ga0070667_100000006 Ga0070667_100000006230 409
192 3300005367 Ga0070667_100000066 Ga0070667_10000006621 409
193 3300005367 Ga0070667_100000315 Ga0070667_10000031526 409
194 3300005367 Ga0070667_100007331 Ga0070667_1000073315 409
195 3300005367 Ga0070667_100009392 Ga0070667_1000093923 409
196 3300005367 Ga0070667_100012209 Ga0070667_1000122092 409
197 3300005367 Ga0070667_100022714 Ga0070667_1000227146 409
198 3300005367 Ga0070667_100030332 Ga0070667_1000303322 409
199 3300005434 Ga0070709_10008560 Ga0070709_100085602 409
200 3300005435 Ga0070714_100032532 Ga0070714_1000325325 409
201 3300005455 Ga0070663_100003972 Ga0070663_1000039727 409
202 3300005455 Ga0070663_100074196 Ga0070663_1000741962 409
203 3300005455 Ga0070663_100111228 Ga0070663_1001112282 409
204 3300005456 Ga0070678_100002434 Ga0070678_1000024346 409
205 3300005456 Ga0070678_100018974 Ga0070678_1000189742 409
206 3300005456 Ga0070678_100315640 Ga0070678_1003156401 409
207 3300005457 Ga0070662_100024630 Ga0070662_1000246303 409
208 3300005457 Ga0070662_100106008 Ga0070662_1001060082 409
209 3300005457 Ga0070662_100179824 Ga0070662_1001798242 409
210 3300005459 Ga0068867_100000030 Ga0068867_10000003054 409
211 3300005459 Ga0068867_100024131 Ga0068867_1000241314 409
212 3300005459 Ga0068867_100083228 Ga0068867_1000832282 409
213 3300005466 Ga0070685_10000481 Ga0070685_1000048112 409
214 3300005466 Ga0070685_10017076 Ga0070685_100170763 409
215 3300005530 Ga0070679_100000007 Ga0070679_100000007131 409
216 3300005530 Ga0070679_100044549 Ga0070679_1000445492 409
217 3300005530 Ga0070679_100306264 Ga0070679_1003062641 409
218 3300005539 Ga0068853_100009896 Ga0068853_1000098966 409
219 3300005539 Ga0068853_100012193 Ga0068853_1000121931 409
220 3300005539 Ga0068853_100080908 Ga0068853_1000809082 409
221 3300005539 Ga0068853_100100721 Ga0068853_1001007212 409
222 3300005543 Ga0070672_100017516 Ga0070672_1000175165 409
223 3300005543 Ga0070672_100121919 Ga0070672_1001219192 409
224 3300005544 Ga0070686_100000018 Ga0070686_10000001811 409
225 3300005544 Ga0070686_100000681 Ga0070686_10000068112 409
226 3300005544 Ga0070686_100012646 Ga0070686_1000126462 409
227 3300005548 Ga0070665_100000071 Ga0070665_100000071154 409
228 3300005548 Ga0070665_100005588 Ga0070665_10000558811 409
229 3300005548 Ga0070665_100079937 Ga0070665_1000799372 409
230 3300005563 Ga0068855_100234622 Ga0068855_1002346221 409
231 3300005564 Ga0070664_100005421 Ga0070664_1000054216 409
232 3300005564 Ga0070664_100090621 Ga0070664_1000906212 409
233 3300005564 Ga0070664_100109315 Ga0070664_1001093152 409
234 3300005564 Ga0070664_100116139 Ga0070664_1001161392 409
235 3300005564 Ga0070664_100123103 Ga0070664_1001231033 409
236 3300005577 Ga0068857_100016701 Ga0068857_1000167014 409
237 3300005578 Ga0068854_100000027 Ga0068854_10000002749 409
238 3300005578 Ga0068854_100016376 Ga0068854_1000163764 409
239 3300005578 Ga0068854_100088394 Ga0068854_1000883942 409
240 3300005578 Ga0068854_100134107 Ga0068854_1001341072 409
241 3300005614 Ga0068856_100036485 Ga0068856_1000364853 409
242 3300005614 Ga0068856_100043523 Ga0068856_1000435233 409
243 3300005614 Ga0068856_100363661 Ga0068856_1003636611 409
244 3300005616 Ga0068852_100001514 Ga0068852_10000151411 409
245 3300005616 Ga0068852_100013796 Ga0068852_1000137963 409
246 3300005616 Ga0068852_100015664 Ga0068852_1000156646 409
247 3300005617 Ga0068859_100003342 Ga0068859_10000334212 409
248 3300005617 Ga0068859_100047289 Ga0068859_1000472892 409
249 3300005618 Ga0068864_100000123 Ga0068864_10000012350 409
250 3300005618 Ga0068864_100002776 Ga0068864_1000027763 409
251 3300005618 Ga0068864_100004621 Ga0068864_1000046217 409
252 3300005618 Ga0068864_100014051 Ga0068864_1000140513 409
253 3300005718 Ga0068866_10046228 Ga0068866_100462282 409
254 3300005719 Ga0068861_100026337 Ga0068861_1000263373 409
255 3300005719 Ga0068861_100084513 Ga0068861_1000845132 409
256 3300005719 Ga0068861_100154369 Ga0068861_1001543691 409
257 3300005834 Ga0068851_10014286 Ga0068851_100142864 409
258 3300005834 Ga0068851_10042555 Ga0068851_100425552 409
259 3300005841 Ga0068863_100000025 Ga0068863_100000025173 409
260 3300005841 Ga0068863_100000323 Ga0068863_10000032332 409
261 3300005841 Ga0068863_100002570 Ga0068863_1000025706 409
262 3300005841 Ga0068863_100004728 Ga0068863_1000047283 409
263 3300005841 Ga0068863_100005243 Ga0068863_1000052434 409
264 3300005841 Ga0068863_100011938 Ga0068863_1000119382 409
265 3300005841 Ga0068863_100130679 Ga0068863_1001306792 409
266 3300005841 Ga0068863_100251287 Ga0068863_1002512872 409
267 3300005842 Ga0068858_100000417 Ga0068858_10000041712 409
268 3300005842 Ga0068858_100001016 Ga0068858_1000010168 409
269 3300005842 Ga0068858_100006240 Ga0068858_1000062403 409
270 3300005842 Ga0068858_100010757 Ga0068858_1000107572 409
271 3300005843 Ga0068860_100000013 Ga0068860_100000013140 409
272 3300005843 Ga0068860_100000022 Ga0068860_10000002237 409
273 3300005843 Ga0068860_100000074 Ga0068860_10000007471 409
274 3300005844 Ga0068862_100000027 Ga0068862_10000002740 409
275 3300005844 Ga0068862_100000043 Ga0068862_100000043142 409
276 3300005844 Ga0068862_100000286 Ga0068862_10000028615 409
277 3300005844 Ga0068862_100000602 Ga0068862_1000006027 409
278 3300005937 Ga0081455_10000088 Ga0081455_1000008844 409
279 3300005985 Ga0081539_10069984 Ga0081539_100699842 409
280 3300006048 Ga0075363_100012593 Ga0075363_1000125934 409
281 3300006173 Ga0070716_100027757 Ga0070716_1000277572 409
282 3300006178 Ga0075367_10022015 Ga0075367_100220153 409
283 3300006195 Ga0075366_10122866 Ga0075366_101228662 409
284 3300006237 Ga0097621_100002082 Ga0097621_1000020828 409
285 3300006237 Ga0097621_100005795 Ga0097621_1000057957 409
286 3300006353 Ga0075370_10005135 Ga0075370_100051355 409
287 3300006353 Ga0075370_10026940 Ga0075370_100269403 409
288 3300006358 Ga0068871_100011965 Ga0068871_1000119653 409
289 3300006881 Ga0068865_100000021 Ga0068865_10000002128 409
290 3300006881 Ga0068865_100003551 Ga0068865_1000035519 409
291 3300006881 Ga0068865_100171321 Ga0068865_1001713212 409
292 3300006931 Ga0097620_100003342 Ga0097620_10000334212 409
293 3300006931 Ga0097620_100047287 Ga0097620_1000472872 409
294 3300009011 Ga0105251_10000159 Ga0105251_1000015940 409
295 3300009098 Ga0105245_10036369 Ga0105245_100363694 409
296 3300009098 Ga0105245_10208235 Ga0105245_102082352 409
297 3300009148 Ga0105243_10000748 Ga0105243_1000074810 409
298 3300009148 Ga0105243_10047987 Ga0105243_100479871 409
299 3300009176 Ga0105242_10000198 Ga0105242_1000019819 409
300 3300009176 Ga0105242_10069894 Ga0105242_100698942 409
301 3300009177 Ga0105248_10000026 Ga0105248_10000026189 409
302 3300009177 Ga0105248_10006916 Ga0105248_100069167 409
303 3300009177 Ga0105248_10009017 Ga0105248_100090176 409
304 3300009545 Ga0105237_10086169 Ga0105237_100861693 409
305 3300009545 Ga0105237_10119826 Ga0105237_101198263 409
306 3300009551 Ga0105238_10010489 Ga0105238_100104892 409
307 3300009551 Ga0105238_10105740 Ga0105238_101057403 409
308 3300009551 Ga0105238_10191348 Ga0105238_101913482 409
309 3300009553 Ga0105249_10000014 Ga0105249_1000001437 409
310 3300009553 Ga0105249_10000110 Ga0105249_1000011053 409
311 3300009553 Ga0105249_10059125 Ga0105249_100591252 409
312 3300010375 Ga0105239_10038535 Ga0105239_100385356 409
313 3300010375 Ga0105239_10286199 Ga0105239_102861993 409
314 3300010375 Ga0105239_10300798 Ga0105239_103007982 409
315 3300011119 Ga0105246_10002051 Ga0105246_100020514 409
316 3300011119 Ga0105246_10032319 Ga0105246_100323193 409
317 3300013100 Ga0157373_10003459 Ga0157373_100034592 409
318 3300013100 Ga0157373_10048292 Ga0157373_100482922 409
319 3300013104 Ga0157370_10122339 Ga0157370_101223393 409
320 3300013105 Ga0157369_10001381 Ga0157369_100013812 409
321 3300013105 Ga0157369_10079349 Ga0157369_100793492 409
322 3300013105 Ga0157369_10286337 Ga0157369_102863372 409
323 3300013296 Ga0157374_10003145 Ga0157374_100031456 409
324 3300013296 Ga0157374_10166323 Ga0157374_101663232 409
325 3300013297 Ga0157378_10010279 Ga0157378_100102792 409
326 3300013297 Ga0157378_10068955 Ga0157378_100689553 409
327 3300013297 Ga0157378_10078659 Ga0157378_100786591 409
328 3300013306 Ga0163162_10027428 Ga0163162_100274287 409
329 3300013306 Ga0163162_10066546 Ga0163162_100665464 409
330 3300013306 Ga0163162_10188618 Ga0163162_101886182 409
331 3300013307 Ga0157372_10112965 Ga0157372_101129651 409
332 3300013308 Ga0157375_10002408 Ga0157375_1000240810 409
333 3300013308 Ga0157375_10007486 Ga0157375_100074863 409
334 3300013308 Ga0157375_10021115 Ga0157375_100211156 409
335 3300013308 Ga0157375_10088260 Ga0157375_100882602 409
336 3300014325 Ga0163163_10029103 Ga0163163_100291035 409
337 3300014326 Ga0157380_10000040 Ga0157380_1000004029 409
338 3300014326 Ga0157380_10000315 Ga0157380_1000031516 409
339 3300014326 Ga0157380_10000371 Ga0157380_1000037111 409
340 3300014968 Ga0157379_10006996 Ga0157379_100069965 409
341 3300014969 Ga0157376_10000140 Ga0157376_1000014014 409
342 3300017792 Ga0163161_10000186 Ga0163161_1000018611 409
343 3300020070 Ga0206356_10876973 Ga0206356_108769732 409
344 3300021384 Ga0213876_10003843 Ga0213876_100038437 409
345 3300021388 Ga0213875_10000166 Ga0213875_1000016616 409
346 3300025229 Ga0209147_100298 Ga0209147_10029813 409
347 3300025321 Ga0207656_10008550 Ga0207656_100085502 409
348 3300025735 Ga0207713_1000491 Ga0207713_100049119 409
349 3300025900 Ga0207710_10011345 Ga0207710_100113452 409
350 3300025901 Ga0207688_10048536 Ga0207688_100485362 409
351 3300025903 Ga0207680_10000007 Ga0207680_10000007242 409
352 3300025903 Ga0207680_10000821 Ga0207680_100008217 409
353 3300025903 Ga0207680_10010099 Ga0207680_100100995 409
354 3300025903 Ga0207680_10010579 Ga0207680_100105794 409
355 3300025904 Ga0207647_10000748 Ga0207647_1000074815 409
356 3300025904 Ga0207647_10021518 Ga0207647_100215184 409
357 3300025904 Ga0207647_10052537 Ga0207647_100525372 409
358 3300025904 Ga0207647_10052658 Ga0207647_100526581 409
359 3300025906 Ga0207699_10012553 Ga0207699_100125533 409
360 3300025907 Ga0207645_10000523 Ga0207645_1000052310 409
361 3300025909 Ga0207705_10000025 Ga0207705_1000002524 409
362 3300025909 Ga0207705_10015976 Ga0207705_100159766 409
363 3300025909 Ga0207705_10059980 Ga0207705_100599801 409
364 3300025911 Ga0207654_10008184 Ga0207654_100081846 409
365 3300025913 Ga0207695_10009684 Ga0207695_1000968411 409
366 3300025914 Ga0207671_10000350 Ga0207671_100003503 409
367 3300025917 Ga0207660_10000536 Ga0207660_1000053623 409
368 3300025919 Ga0207657_10002675 Ga0207657_100026758 409
369 3300025919 Ga0207657_10011581 Ga0207657_100115813 409
370 3300025919 Ga0207657_10015100 Ga0207657_100151008 409
371 3300025919 Ga0207657_10019526 Ga0207657_100195263 409
372 3300025919 Ga0207657_10029764 Ga0207657_100297643 409
373 3300025919 Ga0207657_10092883 Ga0207657_100928832 409
374 3300025919 Ga0207657_10248180 Ga0207657_102481802 409
375 3300025920 Ga0207649_10000074 Ga0207649_1000007445 409
376 3300025921 Ga0207652_10000001 Ga0207652_10000001717 409
377 3300025921 Ga0207652_10000002 Ga0207652_1000000210 409
378 3300025921 Ga0207652_10014994 Ga0207652_100149945 409
379 3300025923 Ga0207681_10000014 Ga0207681_10000014331 409
380 3300025923 Ga0207681_10000199 Ga0207681_1000019936 409
381 3300025923 Ga0207681_10015882 Ga0207681_100158824 409
382 3300025923 Ga0207681_10018745 Ga0207681_100187453 409
383 3300025923 Ga0207681_10049089 Ga0207681_100490893 409
384 3300025924 Ga0207694_10004154 Ga0207694_100041543 409
385 3300025924 Ga0207694_10095572 Ga0207694_100955722 409
386 3300025925 Ga0207650_10000015 Ga0207650_10000015344 409
387 3300025925 Ga0207650_10000056 Ga0207650_100000567 409
388 3300025925 Ga0207650_10005758 Ga0207650_100057587 409
389 3300025925 Ga0207650_10061101 Ga0207650_100611012 409
390 3300025925 Ga0207650_10069682 Ga0207650_100696822 409
391 3300025926 Ga0207659_10012135 Ga0207659_100121355 409
392 3300025926 Ga0207659_10019289 Ga0207659_100192892 409
393 3300025926 Ga0207659_10088946 Ga0207659_100889462 409
394 3300025927 Ga0207687_10029300 Ga0207687_100293005 409
395 3300025929 Ga0207664_10039239 Ga0207664_100392392 409
396 3300025931 Ga0207644_10000117 Ga0207644_1000011710 409
397 3300025931 Ga0207644_10000230 Ga0207644_100002309 409
398 3300025931 Ga0207644_10000729 Ga0207644_1000072911 409
399 3300025931 Ga0207644_10004051 Ga0207644_100040517 409
400 3300025931 Ga0207644_10009847 Ga0207644_100098472 409
401 3300025932 Ga0207690_10017303 Ga0207690_100173033 409
402 3300025932 Ga0207690_10084202 Ga0207690_100842022 409
403 3300025932 Ga0207690_10103523 Ga0207690_101035232 409
404 3300025932 Ga0207690_10164652 Ga0207690_101646522 409
405 3300025933 Ga0207706_10003608 Ga0207706_100036087 409
406 3300025933 Ga0207706_10036096 Ga0207706_100360963 409
407 3300025933 Ga0207706_10099552 Ga0207706_100995522 409
408 3300025933 Ga0207706_10117315 Ga0207706_101173152 409
409 3300025933 Ga0207706_10132974 Ga0207706_101329742 409
410 3300025933 Ga0207706_10181922 Ga0207706_101819222 409
411 3300025933 Ga0207706_10214565 Ga0207706_102145652 409
412 3300025934 Ga0207686_10000215 Ga0207686_1000021527 409
413 3300025935 Ga0207709_10000118 Ga0207709_1000011832 409
414 3300025936 Ga0207670_10004991 Ga0207670_100049913 409
415 3300025937 Ga0207669_10025186 Ga0207669_100251862 409
416 3300025937 Ga0207669_10046380 Ga0207669_100463802 409
417 3300025937 Ga0207669_10162469 Ga0207669_101624692 409
418 3300025938 Ga0207704_10000027 Ga0207704_1000002732 409
419 3300025939 Ga0207665_10022883 Ga0207665_100228834 409
420 3300025940 Ga0207691_10006731 Ga0207691_100067315 409
421 3300025940 Ga0207691_10010314 Ga0207691_100103148 409
422 3300025940 Ga0207691_10015809 Ga0207691_100158094 409
423 3300025940 Ga0207691_10152067 Ga0207691_101520672 409
424 3300025941 Ga0207711_10000004 Ga0207711_10000004204 409
425 3300025941 Ga0207711_10000107 Ga0207711_1000010755 409
426 3300025941 Ga0207711_10000371 Ga0207711_100003718 409
427 3300025941 Ga0207711_10000917 Ga0207711_100009173 409
428 3300025941 Ga0207711_10002164 Ga0207711_1000216414 409
429 3300025941 Ga0207711_10013381 Ga0207711_100133811 409
430 3300025942 Ga0207689_10000584 Ga0207689_1000058425 409
431 3300025945 Ga0207679_10002925 Ga0207679_100029256 409
432 3300025945 Ga0207679_10006737 Ga0207679_100067379 409
433 3300025945 Ga0207679_10036669 Ga0207679_100366693 409
434 3300025945 Ga0207679_10112082 Ga0207679_101120821 409
435 3300025945 Ga0207679_10197724 Ga0207679_101977242 409
436 3300025949 Ga0207667_10016210 Ga0207667_100162103 409
437 3300025949 Ga0207667_10024479 Ga0207667_100244793 409
438 3300025949 Ga0207667_10097128 Ga0207667_100971283 409
439 3300025960 Ga0207651_10000016 Ga0207651_1000001632 409
440 3300025960 Ga0207651_10000971 Ga0207651_100009718 409
441 3300025960 Ga0207651_10004999 Ga0207651_100049997 409
442 3300025960 Ga0207651_10007093 Ga0207651_100070936 409
443 3300025960 Ga0207651_10033616 Ga0207651_100336162 409
444 3300025961 Ga0207712_10000004 Ga0207712_10000004230 409
445 3300025961 Ga0207712_10000311 Ga0207712_1000031121 409
446 3300025972 Ga0207668_10000009 Ga0207668_10000009156 409
447 3300025972 Ga0207668_10004966 Ga0207668_100049667 409
448 3300025972 Ga0207668_10008749 Ga0207668_100087496 409
449 3300025972 Ga0207668_10019256 Ga0207668_100192562 409
450 3300025981 Ga0207640_10000371 Ga0207640_1000037118 409
451 3300025981 Ga0207640_10028204 Ga0207640_100282042 409
452 3300025981 Ga0207640_10031086 Ga0207640_100310862 409
453 3300025981 Ga0207640_10080096 Ga0207640_100800962 409
454 3300025986 Ga0207658_10000010 Ga0207658_10000010227 409
455 3300025986 Ga0207658_10000287 Ga0207658_1000028716 409
456 3300025986 Ga0207658_10000512 Ga0207658_100005125 409
457 3300025986 Ga0207658_10000768 Ga0207658_1000076821 409
458 3300025986 Ga0207658_10003944 Ga0207658_1000394410 409
459 3300025986 Ga0207658_10005700 Ga0207658_100057007 409
460 3300025986 Ga0207658_10017423 Ga0207658_100174235 409
461 3300025986 Ga0207658_10096851 Ga0207658_100968512 409
462 3300026023 Ga0207677_10000192 Ga0207677_1000019232 409
463 3300026023 Ga0207677_10006497 Ga0207677_100064978 409
464 3300026023 Ga0207677_10049584 Ga0207677_100495842 409
465 3300026035 Ga0207703_10000479 Ga0207703_1000047915 409
466 3300026035 Ga0207703_10001633 Ga0207703_1000163312 409
467 3300026035 Ga0207703_10006096 Ga0207703_100060967 409
468 3300026035 Ga0207703_10040776 Ga0207703_100407763 409
469 3300026041 Ga0207639_10006286 Ga0207639_100062864 409
470 3300026041 Ga0207639_10012894 Ga0207639_100128944 409
471 3300026041 Ga0207639_10014197 Ga0207639_100141972 409
472 3300026041 Ga0207639_10054600 Ga0207639_100546003 409
473 3300026041 Ga0207639_10059217 Ga0207639_100592172 409
474 3300026041 Ga0207639_10149875 Ga0207639_101498752 409
475 3300026067 Ga0207678_10011697 Ga0207678_100116976 409
476 3300026067 Ga0207678_10045368 Ga0207678_100453682 409
477 3300026067 Ga0207678_10057520 Ga0207678_100575204 409
478 3300026067 Ga0207678_10072664 Ga0207678_100726642 409
479 3300026067 Ga0207678_10104865 Ga0207678_101048652 409
480 3300026078 Ga0207702_10003449 Ga0207702_100034492 409
481 3300026078 Ga0207702_10009656 Ga0207702_100096566 409
482 3300026078 Ga0207702_10383624 Ga0207702_103836241 409
483 3300026088 Ga0207641_10000018 Ga0207641_10000018150 409
484 3300026088 Ga0207641_10000216 Ga0207641_1000021636 409
485 3300026088 Ga0207641_10000584 Ga0207641_1000058440 409
486 3300026088 Ga0207641_10002403 Ga0207641_1000240316 409
487 3300026088 Ga0207641_10017266 Ga0207641_100172663 409
488 3300026088 Ga0207641_10024033 Ga0207641_100240335 409
489 3300026088 Ga0207641_10036223 Ga0207641_100362232 409
490 3300026089 Ga0207648_10000116 Ga0207648_1000011644 409
491 3300026089 Ga0207648_10004968 Ga0207648_100049685 409
492 3300026089 Ga0207648_10005659 Ga0207648_100056593 409
493 3300026095 Ga0207676_10000021 Ga0207676_1000002158 409
494 3300026095 Ga0207676_10000027 Ga0207676_1000002795 409
495 3300026095 Ga0207676_10002208 Ga0207676_100022088 409
496 3300026095 Ga0207676_10002967 Ga0207676_1000296710 409
497 3300026095 Ga0207676_10007460 Ga0207676_100074602 409
498 3300026095 Ga0207676_10016018 Ga0207676_100160183 409
499 3300026116 Ga0207674_10000065 Ga0207674_1000006576 409
500 3300026116 Ga0207674_10038465 Ga0207674_100384654 409
501 3300026118 Ga0207675_100000777 Ga0207675_10000077720 409
502 3300026118 Ga0207675_100003380 Ga0207675_10000338011 409
503 3300026118 Ga0207675_100056121 Ga0207675_1000561214 409
504 3300026118 Ga0207675_100143806 Ga0207675_1001438062 409
505 3300026121 Ga0207683_10002092 Ga0207683_100020927 409
506 3300026121 Ga0207683_10030447 Ga0207683_100304475 409
507 3300026142 Ga0207698_10000116 Ga0207698_1000011638 409
508 3300026142 Ga0207698_10097892 Ga0207698_100978923 409
509 3300027866 Ga0209813_10000468 Ga0209813_100004685 409
510 3300028379 Ga0268266_10000040 Ga0268266_10000040155 409
511 3300028379 Ga0268266_10017275 Ga0268266_100172755 409
512 3300028379 Ga0268266_10071681 Ga0268266_100716814 409
513 3300028379 Ga0268266_10147933 Ga0268266_101479332 409
514 3300028379 Ga0268266_10260066 Ga0268266_102600662 409
515 3300028380 Ga0268265_10000013 Ga0268265_1000001329 409
516 3300028380 Ga0268265_10000042 Ga0268265_1000004237 409
517 3300028380 Ga0268265_10000294 Ga0268265_1000029436 409
518 3300028380 Ga0268265_10000324 Ga0268265_100003246 409
519 3300028381 Ga0268264_10000003 Ga0268264_10000003244 409
520 3300028381 Ga0268264_10000039 Ga0268264_10000039140 409
521 3300028381 Ga0268264_10000070 Ga0268264_10000070167 409
522 3300028381 Ga0268264_10035653 Ga0268264_100356532 409
523 3300031548 Ga0307408_100187469 Ga0307408_1001874692 409
524 3300031548 Ga0307408_100218984 Ga0307408_1002189842 409
525 3300031731 Ga0307405_10077121 Ga0307405_100771213 409
526 3300031731 Ga0307405_10171692 Ga0307405_101716922 409
527 3300031852 Ga0307410_10016039 Ga0307410_100160392 409
528 3300031852 Ga0307410_10027751 Ga0307410_100277512 409
529 3300031901 Ga0307406_10147757 Ga0307406_101477572 409
530 3300031911 Ga0307412_10009822 Ga0307412_100098225 409
531 3300031911 Ga0307412_10022920 Ga0307412_100229203 409
532 3300031995 Ga0307409_100031642 Ga0307409_1000316423 409
533 3300031995 Ga0307409_100095582 Ga0307409_1000955822 409
534 3300032002 Ga0307416_100000451 Ga0307416_1000004518 409
535 3300032004 Ga0307414_10188259 Ga0307414_101882591 409
536 3300032005 Ga0307411_10016140 Ga0307411_100161403 409
537 3300035118 Ga0373954_0038206 Ga0373954_0038206_434_1720 409
538 3300035172 Ga0373955_0065392 Ga0373955_0065392_446_1732 409
539 3300035692 Ga0373935_0111026 Ga0373935_0111026_236_1522 409
540 3300035695 Ga0373927_0062106 Ga0373927_0062106_378_1664 409
541 3300035725 Ga0373947_0072005 Ga0373947_0072005_354_1640 409
542 3300037068 Ga0373925_0035087 Ga0373925_0035087_86_1372 409
543 3300037312 Ga0395899_0000113 Ga0395899_0000113_5607_6893 409
544 3300037312 Ga0395899_0003756 Ga0395899_0003756_3803_5089 409
545 3300037312 Ga0395899_0014804 Ga0395899_0014804_2305_3591 409
546 3300037312 Ga0395899_0099019 Ga0395899_0099019_400_1686 409
547 3300037418 Ga0395900_0005823 Ga0395900_0005823_6903_8189 409
548 3300037418 Ga0395900_0009694 Ga0395900_0009694_6354_7640 409
549 3300037418 Ga0395900_0013203 Ga0395900_0013203_4796_6082 409
550 3300037418 Ga0395900_0016968 Ga0395900_0016968_2355_3641 409
551 3300037418 Ga0395900_0017452 Ga0395900_0017452_5409_6695 409
552 3300037418 Ga0395900_0049587 Ga0395900_0049587_476_1762 409
553 3300037418 Ga0395900_0084351 Ga0395900_0084351_1244_2530 409
554 3300037418 Ga0395900_0121935 Ga0395900_0121935_340_1626 409
555 3300037418 Ga0395900_0163281 Ga0395900_0163281_352_1638 409
556 3300037466 Ga0395898_0000306 Ga0395898_0000306_109048_110334 409
557 3300037466 Ga0395898_0001326 Ga0395898_0001326_5619_6905 409
558 3300037466 Ga0395898_0014197 Ga0395898_0014197_3326_4612 409
559 3300037466 Ga0395898_0015973 Ga0395898_0015973_1877_3163 409
560 3300037466 Ga0395898_0017925 Ga0395898_0017925_2305_3591 409
561 3300037466 Ga0395898_0034479 Ga0395898_0034479_2689_3975 409
562 3300037466 Ga0395898_0086885 Ga0395898_0086885_137_1423 409
563 3300037471 Ga0395905_0000005 Ga0395905_0000005_354009_355295 409
564 3300037471 Ga0395905_0000958 Ga0395905_0000958_3490_4776 409
565 3300037471 Ga0395905_0001046 Ga0395905_0001046_23469_24755 409
566 3300037471 Ga0395905_0001585 Ga0395905_0001585_1394_2680 409
567 3300037471 Ga0395905_0010210 Ga0395905_0010210_4537_5823 409
568 3300037471 Ga0395905_0010767 Ga0395905_0010767_4186_5472 409
569 3300037471 Ga0395905_0010864 Ga0395905_0010864_2335_3621 409
570 3300037471 Ga0395905_0016800 Ga0395905_0016800_3330_4616 409
571 3300037471 Ga0395905_0017713 Ga0395905_0017713_49_1335 409
572 3300037471 Ga0395905_0021098 Ga0395905_0021098_17_1303 409
573 3300037471 Ga0395905_0022485 Ga0395905_0022485_1088_2413 409
574 3300037471 Ga0395905_0024565 Ga0395905_0024565_884_2143 409
575 3300037471 Ga0395905_0081103 Ga0395905_0081103_511_1797 409
576 3300037471 Ga0395905_0095924 Ga0395905_0095924_785_2071 409
577 3300037471 Ga0395905_0158549 Ga0395905_0158549_224_1510 409
578 3300037471 Ga0395905_0188144 Ga0395905_0188144_92_1378 409
579 3300037471 Ga0395905_0233620 Ga0395905_0233620_203_1519 409
580 3300037471 Ga0395905_0291905 Ga0395905_0291905_135_1394 409
581 3300037853 Ga0436364_0545952 Ga0436364_0545952_14672_15952 409
582 3300038443 Ga0395901_0002169 Ga0395901_0002169_6981_8267 409
583 3300038443 Ga0395901_0007143 Ga0395901_0007143_3803_5089 409
584 3300038443 Ga0395901_0011649 Ga0395901_0011649_1209_2495 409
585 3300038443 Ga0395901_0018318 Ga0395901_0018318_3152_4438 409
586 3300038443 Ga0395901_0033170 Ga0395901_0033170_3092_4378 409
587 3300038443 Ga0395901_0116375 Ga0395901_0116375_751_2037 409
588 3300038443 Ga0395901_0142808 Ga0395901_0142808_223_1509 409
589 3300038443 Ga0395901_0188110 Ga0395901_0188110_367_1653 409
590 3300038443 Ga0395901_0190683 Ga0395901_0190683_236_1522 409
591 3300038443 Ga0395901_0388375 Ga0395901_0388375_76_1362 409
592 3300039437 Ga0436365_0257345 Ga0436365_0257345_8009_9271 409
593 3300039437 Ga0436365_1536714 Ga0436365_1536714_17623_18891 409
594 3300039437 Ga0436365_1577285 Ga0436365_1577285_2522_3802 409
595 3300041512 Ga0451853_1219635 Ga0451853_1219635_517_1776 409
596 3300042005 Ga0439448_0002715 Ga0439448_0002715_2787_4046 409
597 3300042005 Ga0439448_0011074 Ga0439448_0011074_1370_2656 409
598 3300042006 Ga0439432_025571 Ga0439432_025571_562_1848 409
599 3300042007 Ga0439449_0011365 Ga0439449_0011365_892_2223 409
600 3300042012 Ga0439455_0001188 Ga0439455_0001188_331_1590 409
601 3300042157 Ga0439458_0000636 Ga0439458_0000636_4131_5417 409
602 3300042157 Ga0439458_0003580 Ga0439458_0003580_156_1415 409
603 3300044656 Ga0466969_0002833 Ga0466969_0002833_3231_4517 409
604 3300044658 Ga0466972_0002118 Ga0466972_0002118_2791_4050 409
605 3300044658 Ga0466972_0081581 Ga0466972_0081581_126_1385 409
606 3300044684 Ga0466966_0047414 Ga0466966_0047414_551_1837 409
607 3300044684 Ga0466966_0085199 Ga0466966_0085199_324_1610 409
608 3300044694 Ga0466963_0054244 Ga0466963_0054244_193_1479 409
609 3300044706 Ga0466964_0020584 Ga0466964_0020584_243_1514 409
610 3300044719 Ga0466971_0020675 Ga0466971_0020675_1002_2273 409
611 3300044719 Ga0466971_0024385 Ga0466971_0024385_1303_2589 409
612 3300044719 Ga0466971_0039941 Ga0466971_0039941_130_1389 409
613 3300044765 Ga0466970_0002773 Ga0466970_0002773_6018_7277 409
614 3300044765 Ga0466970_0004904 Ga0466970_0004904_1121_2407 409
615 3300044842 Ga0466957_0001053 Ga0466957_0001053_5277_6563 409
616 3300044842 Ga0466957_0068693 Ga0466957_0068693_213_1484 409
617 3300044842 Ga0466957_0089149 Ga0466957_0089149_285_1571 409
618 3300044901 Ga0466960_0017036 Ga0466960_0017036_1523_2809 409
619 3300044901 Ga0466960_0017817 Ga0466960_0017817_1102_2361 409
620 3300045049 Ga0466959_0022449 Ga0466959_0022449_1064_2350 409
621 3300045049 Ga0466959_0041638 Ga0466959_0041638_1570_2829 409
622 3300045836 Ga0466958_0005075 Ga0466958_0005075_97_1383 409
623 3300045836 Ga0466958_0029566 Ga0466958_0029566_560_1831 409
624 3300045976 Ga0466967_0145127 Ga0466967_0145127_668_1939 409
625 3300045976 Ga0466967_0148693 Ga0466967_0148693_237_1502 409
626 3300045976 Ga0466967_0209156 Ga0466967_0209156_535_1827 409
627 3300046452 Ga0495617_006653 Ga0495617_006653_690_1955 409
628 3300046453 Ga0495627_000024 Ga0495627_000024_75029_76294 409
629 3300046512 Ga0495610_0000053 Ga0495610_0000053_117721_118986 409
630 3300046520 Ga0495637_0002826 Ga0495637_0002826_4030_5295 409
631 3300046524 Ga0495648_0009993 Ga0495648_0009993_1508_2773 409
632 3300046524 Ga0495648_0060033 Ga0495648_0060033_730_1998 409
633 3300046525 Ga0495663_0011834 Ga0495663_0011834_683_2017 409
634 3300046525 Ga0495663_0043540 Ga0495663_0043540_52_1311 409
635 3300046530 Ga0495654_0000620 Ga0495654_0000620_20512_21771 409
636 3300046537 Ga0495598_0000194 Ga0495598_0000194_6445_7731 409
637 3300046539 Ga0495621_0002136 Ga0495621_0002136_995_2281 409
638 3300046616 Ga0495668_0001088 Ga0495668_0001088_6739_7998 409
639 3300046616 Ga0495668_0023290 Ga0495668_0023290_1529_2812 409
640 3300046616 Ga0495668_0048007 Ga0495668_0048007_468_1739 409
641 3300046616 Ga0495668_0093322 Ga0495668_0093322_253_1512 409
642 3300046684 Ga0495669_0000599 Ga0495669_0000599_13493_14776 409
643 3300046684 Ga0495669_0001837 Ga0495669_0001837_6891_8174 409
644 3300046684 Ga0495669_0030328 Ga0495669_0030328_434_1768 409
645 3300046691 Ga0495670_0038423 Ga0495670_0038423_335_1621 409
646 3300047470 Ga0495681_0000099 Ga0495681_0000099_47118_48383 409
647 3300047470 Ga0495681_0001636 Ga0495681_0001636_15310_16602 409
648 3300048088 Ga0495602_0016614 Ga0495602_0016614_2518_3804 409
649 3300048903 Ga0496100_0088838 Ga0496100_0088838_464_1798 409
650 3300048904 Ga0496101_0000533 Ga0496101_0000533_8832_10118 409
651 3300048904 Ga0496101_0037290 Ga0496101_0037290_139_1398 409
652 3300048905 Ga0496102_0000010 Ga0496102_0000010_230729_232003 409
653 3300048905 Ga0496102_0036921 Ga0496102_0036921_274_1560 409
654 3300048905 Ga0496102_0194181 Ga0496102_0194181_98_1384 409
655 3300048906 Ga0496103_0000029 Ga0496103_0000029_119438_120712 409
656 3300048906 Ga0496103_0001191 Ga0496103_0001191_15584_16843 409
657 3300048906 Ga0496103_0064099 Ga0496103_0064099_825_2111 409
658 3300048907 Ga0496104_0017717 Ga0496104_0017717_2823_4109 409
659 3300048908 Ga0496105_0004359 Ga0496105_0004359_7640_8926 409
660 3300048909 Ga0496106_0007216 Ga0496106_0007216_76_1362 409
661 3300048909 Ga0496106_0063212 Ga0496106_0063212_475_1734 409
662 3300048910 Ga0496107_0005864 Ga0496107_0005864_742_2028 409
663 3300048910 Ga0496107_0079859 Ga0496107_0079859_326_1612 409
664 3300048910 Ga0496107_0133137 Ga0496107_0133137_241_1500 409
665 3300048911 Ga0496108_0000482 Ga0496108_0000482_23853_25118 409
666 3300048911 Ga0496108_0006891 Ga0496108_0006891_6062_7348 409
667 3300048912 Ga0496109_0002603 Ga0496109_0002603_7768_9054 409
668 3300048912 Ga0496109_0027863 Ga0496109_0027863_2612_3946 409
669 3300048913 Ga0496110_0000347 Ga0496110_0000347_21034_22320 409
670 3300048913 Ga0496110_0006617 Ga0496110_0006617_6516_7850 409
671 3300048913 Ga0496110_0080420 Ga0496110_0080420_172_1431 409
672 3300048914 Ga0496111_0010584 Ga0496111_0010584_3862_5196 409
673 3300048915 Ga0496112_0003652 Ga0496112_0003652_8455_9789 409
674 3300048915 Ga0496112_0005111 Ga0496112_0005111_4276_5562 409
675 3300048915 Ga0496112_0008504 Ga0496112_0008504_6062_7348 409
676 3300048916 Ga0496113_0018020 Ga0496113_0018020_2252_3538 409
677 3300048916 Ga0496113_0171660 Ga0496113_0171660_368_1702 409
678 3300048919 Ga0496116_0000942 Ga0496116_0000942_27032_28306 409
679 3300048919 Ga0496116_0049461 Ga0496116_0049461_1411_2676 409
680 3300048920 Ga0496117_0000037 Ga0496117_0000037_231331_232605 409
681 3300048920 Ga0496117_0007661 Ga0496117_0007661_296_1555 409
682 3300048920 Ga0496117_0062597 Ga0496117_0062597_652_1911 409
683 3300048921 Ga0496118_0000034 Ga0496118_0000034_229135_230409 409
684 3300048921 Ga0496118_0000689 Ga0496118_0000689_22930_24210 409
685 3300048921 Ga0496118_0010460 Ga0496118_0010460_1767_3026 409
686 3300048922 Ga0496119_0015128 Ga0496119_0015128_3833_5107 409
687 3300048922 Ga0496119_0016847 Ga0496119_0016847_3441_4700 409
688 3300048923 Ga0496120_0011194 Ga0496120_0011194_729_2003 409
689 3300048923 Ga0496120_0018136 Ga0496120_0018136_1344_2603 409
690 3300048924 Ga0496121_0001024 Ga0496121_0001024_22748_24013 409
691 3300048924 Ga0496121_0051640 Ga0496121_0051640_2150_3409 409
692 3300048925 Ga0496122_0001502 Ga0496122_0001502_27339_28613 409
693 3300048926 Ga0496123_0002683 Ga0496123_0002683_5067_6341 409
694 3300048927 Ga0496124_0000033 Ga0496124_0000033_229135_230409 409
695 3300048927 Ga0496124_0097996 Ga0496124_0097996_259_1524 409
696 3300048928 Ga0496125_0008402 Ga0496125_0008402_20_1285 409
697 3300048928 Ga0496125_0050350 Ga0496125_0050350_1452_2687 409
698 3300048928 Ga0496125_0066069 Ga0496125_0066069_321_1580 409
699 3300048928 Ga0496125_0071020 Ga0496125_0071020_1075_2361 409
700 3300048929 Ga0496126_0022584 Ga0496126_0022584_878_2143 409
701 3300049513 Ga0501290_000215 Ga0501290_000215_3794_5059 409
702 3300049515 Ga0501292_000181 Ga0501292_000181_7960_9225 409
703 3300049580 Ga0501046_0040917 Ga0501046_0040917_2386_3657 409
704 3300049584 Ga0501068_0060266 Ga0501068_0060266_654_1940 409
705 3300049665 Ga0501227_005214 Ga0501227_005214_875_2140 409
706 3300049669 Ga0501235_002586 Ga0501235_002586_65_1330 409
707 3300049690 Ga0501261_000172 Ga0501261_000172_7887_9152 409
708 3300049705 Ga0501225_0002320 Ga0501225_0002320_2422_3687 409
709 3300049708 Ga0501245_001140 Ga0501245_001140_771_2036 409
710 3300049775 Ga0501279_000144 Ga0501279_000144_7966_9231 409
711 3300049776 Ga0501280_000005 Ga0501280_000005_78203_79468 409
712 3300049823 Ga0501044_0140596 Ga0501044_0140596_1055_2326 409
713 3300050493 nmdc:mga0k408_39192_c1 nmdc:mga0k408_39192_c1_1362_2621 409
714 3300050494 nmdc:mga06z11_348_c1 nmdc:mga06z11_348_c1_14351_15685 409
715 3300050495 nmdc:mga04h51_137_c1 nmdc:mga04h51_137_c1_18387_19721 409
716 3300050496 nmdc:mga07m45_43381_c1 nmdc:mga07m45_43381_c1_739_1998 409
717 3300050496 nmdc:mga07m45_64284_c1 nmdc:mga07m45_64284_c1_16_1350 409
718 3300053087 Ga0500643_000305 Ga0500643_000305_7909_9168 409
719 3300053108 Ga0500562_010370 Ga0500562_010370_247_1524 409
720 3300053116 Ga0500592_000757 Ga0500592_000757_493_1752 409
721 3300053116 Ga0500592_009042 Ga0500592_009042_113_1384 409
722 3300053157 Ga0500624_000018 Ga0500624_000018_26775_28040 409
723 3300053158 Ga0500627_0000110 Ga0500627_0000110_5398_6657 409
724 3300061719 Ga0466962_0004085 Ga0466962_0004085_3788_5059 409
725 3300061719 Ga0466962_0008275 Ga0466962_0008275_3410_4696 409
726 iso_pu_bacteria 2512564014 2512645628 409
727 iso_pu_bacteria 2582581305 2585261791 409
728 iso_pu_bacteria 2808606401 2809062590 409
729 iso_pu_bacteria 2808606404 2809078726 409
730 iso_pu_bacteria 2808606405 2809082979 409
731 iso_pu_bacteria 2880518877 2880521604 409
732 iso_pu_bacteria 2919709256 2919709540 409

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02784

Orn_Arg_deC_N

Pyridoxal-dependent decarboxylase, pyridoxal binding domain

1

221

0.95

PF00278

Orn_DAP_Arg_deC

Pyridoxal-dependent decarboxylase, C-terminal sheet domain

24

309

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c5q-assembly1.cif.gz_A-2 crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine 0.9404 8 401
2qgh-assembly1.cif.gz_A-2 crystal structure of diaminopimelate decarboxylase from helicobacter pylori complexed with l-lysine 0.9401 8 401
1twi-assembly1.cif.gz_A crystal structure of diaminopimelate decarboxylase from m. jannaschii in co-complex with l-lysine 0.9339 8 409
4xg1-assembly2.cif.gz_D psychromonas ingrahamii diaminopimelate decarboxylase with llp 0.9305 4 407
1tuf-assembly1.cif.gz_A crystal structure of diaminopimelate decarboxylase from m. jannaschi 0.9304 10 409
ID Description Score Start End Superfamily
4xg1A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9597 25 268 3.20.20.10
2qghA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9541 25 268 3.20.20.10
4xg1A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9511 25 268 3.20.20.10
2qghA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9464 25 268 3.20.20.10
3vabA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9443 25 268 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A4Q6F0H3-F1-model_v4 deleted 0.9862 2 120
AF-A0A661KV00-F1-model_v4 Diaminopimelate decarboxylase 0.984 2 133 GO:0008836
GO:0009089
AF-A0A7V5KT84-F1-model_v4 Diaminopimelate decarboxylase 0.984 2 146 GO:0008836
GO:0009089
AF-A0A529T0Q3-F1-model_v4 Diaminopimelate decarboxylase 0.9835 2 135 GO:0006596
GO:0008836
GO:0009089
AF-A0A800IF44-F1-model_v4 Diaminopimelate decarboxylase 0.9813 2 146 GO:0006596
GO:0008836
GO:0009089

Feature Viewer

pLDDT pTM Quality
88.05 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map