F478052
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 732 | 451 | 556 | 373 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0075330|Ga0496115_0075330_878_2185 |
| Length | 414 |
| Sequence | LRVNRNVDGHGAVDNHRNVYDDRDLDVFHFLLTRLTGDGDSMRRKIIIAAVSFVIIAGGVGAFASMRATVAEHDVPIYLTGVGTVIAYNTVVVHSQIQGQLVSINFTEGQAVHTGDLLAQIDPRPYQAQVEQLTANRDRDQAQLTNAIANLNRYTPLEQKGYATPQLLQTQQAQVSQLQNAIKSDQALIDAANVQLSYTRLTSPIDGIAGIRQLDIGNIIHPTDANGLVVVTQIHPISLIFTLPETELPQIQQQQEKTKAPLTVIAYSQDNKIELDQGVLGLVNNEILQTTGSIQLKANSPNKTNRLWPGELVNARLLVDTRHNGLTVPAGAVQQGPNGAYSYVIKPDSSVEVRPVKVAQTSEGQSLIDSGLQANEQVVVDGQYKLKPGAQVAVLHGKAAQEAAAQSAEQAPIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 4 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 5 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 6 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 7 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 8 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 9 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 10 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 11 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 12 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 13 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 14 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 15 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 16 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 17 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 18 | 2791355199 | |||
| 19 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 20 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 21 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 22 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 23 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 24 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 25 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 26 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 27 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 28 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 29 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 30 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 31 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 32 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 33 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 34 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 35 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 36 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 37 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 38 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 39 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 40 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 41 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 42 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 43 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 44 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 45 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 46 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 47 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 48 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 49 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 50 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 51 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 52 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 53 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 54 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 55 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 56 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 57 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 58 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 59 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 60 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 61 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 62 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 63 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 64 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 65 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 66 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 67 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 68 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 69 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 70 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 71 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 72 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 73 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 74 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 75 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 76 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 77 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 78 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 79 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 80 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 81 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 82 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 83 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 84 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 85 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 86 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 87 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 88 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 89 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 90 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 91 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 92 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 93 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 94 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 95 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 96 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 97 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 98 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 99 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 100 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 101 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 102 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 103 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 104 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 105 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 106 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 107 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 108 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 109 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 110 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 111 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 112 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 113 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 114 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 115 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 116 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 117 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 118 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 119 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 120 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 121 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 122 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 123 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 124 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 125 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 126 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 127 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 128 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 129 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 130 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 131 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 132 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 133 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 134 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 135 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 136 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 137 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 138 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 139 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 140 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 141 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 142 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 143 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 144 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 146 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 147 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 148 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 149 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 150 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 151 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 152 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 153 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 154 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 155 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 156 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 157 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 158 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 159 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 160 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 161 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 163 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 164 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 167 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 168 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 169 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 170 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 171 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 172 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 173 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 174 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 175 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 176 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 177 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 178 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 179 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 180 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 181 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 182 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 183 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 184 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 185 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 186 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 187 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 188 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 189 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 190 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 191 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 192 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 193 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 194 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 195 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 196 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 197 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 198 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 200 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 210 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 211 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 212 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 219 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 220 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 221 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 222 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 223 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 224 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 225 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 226 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 227 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 228 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 229 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 268 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 272 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 274 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 275 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 276 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 277 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 278 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 279 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 280 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 281 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 282 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 283 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 284 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 285 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 286 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 287 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 288 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 289 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 290 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 291 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 292 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 293 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 353 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 354 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 355 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 356 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 357 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 360 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 361 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 362 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 363 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 364 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 365 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 366 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 367 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 368 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 369 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 370 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 371 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 373 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 374 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 376 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 377 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 378 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 379 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 391 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 394 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 395 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 396 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 397 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 398 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 399 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 400 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 401 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 402 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 403 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 404 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 405 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 406 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 407 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 408 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 409 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 410 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 411 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 412 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 413 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 414 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 415 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 416 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 417 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 418 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 419 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 420 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 421 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 422 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 423 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 424 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 425 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 426 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 427 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 428 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 429 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 430 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 431 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 432 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 433 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 434 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 435 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 436 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 437 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 438 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 439 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 440 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 441 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 442 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 443 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 444 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 445 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 446 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 447 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 448 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 449 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 450 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 451 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 75.92 |
| Metatranscriptomes | 0.14 |
| Isolates | 23.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.89 |
| Nodule | 18.72 |
| Rhizoplane | 3.69 |
| Rhizosphere | 53.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1001604 | 3300000532 | Bacteria | 1846 |
| 2 | JGI25153J46596_10000288 | 3300003215 | Bacteria | 38391 |
| 3 | JGI25153J46596_10000483 | 3300003215 | Bacteria | 25554 |
| 4 | JGI25153J46596_10000912 | 3300003215 | Bacteria | 17961 |
| 5 | JGI25153J46596_10001506 | 3300003215 | Bacteria | 13886 |
| 6 | JGI25153J46596_10001586 | 3300003215 | Bacteria | 13473 |
| 7 | JGI25153J46596_10001963 | 3300003215 | Bacteria | 12198 |
| 8 | JGI25160J50197_1000413 | 3300003354 | Bacteria | 27195 |
| 9 | JGI25160J50197_1001806 | 3300003354 | Bacteria | 10328 |
| 10 | JGI25404J52841_10000205 | 3300003659 | Bacteria | 7120 |
| 11 | JGI25404J52841_10010408 | 3300003659 | Bacteria | 2000 |
| 12 | JGI25404J52841_10013508 | 3300003659 | Bacteria | 1771 |
| 13 | Ga0055539_1005156 | 3300003752 | Bacteria | 1707 |
| 14 | Ga0055531_10012320 | 3300003794 | Bacteria | 4035 |
| 15 | Ga0065165_1000342 | 3300005262 | Bacteria | 76302 |
| 16 | Ga0065165_1006645 | 3300005262 | Bacteria | 5975 |
| 17 | Ga0065704_10140706 | 3300005289 | Bacteria | 1521 |
| 18 | Ga0065715_10001703 | 3300005293 | Bacteria | 5952 |
| 19 | Ga0065707_10016994 | 3300005295 | Bacteria | 1797 |
| 20 | Ga0070658_10018856 | 3300005327 | Bacteria | 5527 |
| 21 | Ga0068869_100003558 | 3300005334 | Bacteria | 9557 |
| 22 | Ga0068869_100042182 | 3300005334 | Bacteria | 3270 |
| 23 | Ga0070682_100031621 | 3300005337 | Bacteria | 3202 |
| 24 | Ga0070682_100110139 | 3300005337 | Bacteria | 1834 |
| 25 | Ga0068868_100089122 | 3300005338 | Bacteria | 2483 |
| 26 | Ga0070689_100070251 | 3300005340 | Bacteria | 2733 |
| 27 | Ga0070691_10018531 | 3300005341 | Bacteria | 3210 |
| 28 | Ga0070668_100020486 | 3300005347 | Bacteria | 4991 |
| 29 | Ga0070668_100023188 | 3300005347 | Bacteria | 4693 |
| 30 | Ga0070668_100053069 | 3300005347 | Bacteria | 3126 |
| 31 | Ga0070668_100112145 | 3300005347 | Bacteria | 2171 |
| 32 | Ga0070669_100001434 | 3300005353 | Bacteria | 17247 |
| 33 | Ga0070675_100307231 | 3300005354 | Bacteria | 1398 |
| 34 | Ga0070671_100057356 | 3300005355 | Bacteria | 3240 |
| 35 | Ga0070674_100141676 | 3300005356 | Bacteria | 1805 |
| 36 | Ga0070673_100373731 | 3300005364 | Bacteria | 1269 |
| 37 | Ga0070659_100156725 | 3300005366 | Bacteria | 1860 |
| 38 | Ga0070667_100009511 | 3300005367 | Bacteria | 8060 |
| 39 | Ga0070667_100351286 | 3300005367 | Bacteria | 1335 |
| 40 | Ga0070709_10033314 | 3300005434 | Bacteria | 3114 |
| 41 | Ga0070714_100033979 | 3300005435 | Bacteria | 4269 |
| 42 | Ga0070714_100092937 | 3300005435 | Bacteria | 2645 |
| 43 | Ga0070713_100150664 | 3300005436 | Bacteria | 2069 |
| 44 | Ga0070713_100175591 | 3300005436 | Bacteria | 1922 |
| 45 | Ga0070710_10002899 | 3300005437 | Bacteria | 8165 |
| 46 | Ga0070710_10055637 | 3300005437 | Bacteria | 2236 |
| 47 | Ga0070710_10096668 | 3300005437 | Bacteria | 1751 |
| 48 | Ga0070711_100008672 | 3300005439 | Bacteria | 6239 |
| 49 | Ga0070711_100038316 | 3300005439 | Bacteria | 3223 |
| 50 | Ga0070711_100043821 | 3300005439 | Bacteria | 3033 |
| 51 | Ga0070711_100074234 | 3300005439 | Bacteria | 2405 |
| 52 | Ga0070711_100096189 | 3300005439 | Bacteria | 2145 |
| 53 | Ga0070711_100288852 | 3300005439 | Bacteria | 1300 |
| 54 | Ga0070700_100047395 | 3300005441 | Bacteria | 2659 |
| 55 | Ga0070694_100012064 | 3300005444 | Bacteria | 5366 |
| 56 | Ga0070663_100003069 | 3300005455 | Bacteria | 9550 |
| 57 | Ga0070663_100006379 | 3300005455 | Bacteria | 7088 |
| 58 | Ga0070663_100025905 | 3300005455 | Bacteria | 3964 |
| 59 | Ga0070663_100144252 | 3300005455 | Bacteria | 1820 |
| 60 | Ga0070678_100080606 | 3300005456 | Bacteria | 2465 |
| 61 | Ga0070678_100207550 | 3300005456 | Bacteria | 1621 |
| 62 | Ga0070662_100029456 | 3300005457 | Bacteria | 3831 |
| 63 | Ga0068867_100125340 | 3300005459 | Bacteria | 1990 |
| 64 | Ga0070706_100093913 | 3300005467 | Bacteria | 2783 |
| 65 | Ga0070698_100000373 | 3300005471 | Bacteria | 46692 |
| 66 | Ga0070698_100094727 | 3300005471 | Bacteria | 2964 |
| 67 | Ga0070699_100011652 | 3300005518 | Bacteria | 7589 |
| 68 | Ga0070699_100018770 | 3300005518 | Bacteria | 5940 |
| 69 | Ga0070699_100182703 | 3300005518 | Bacteria | 1861 |
| 70 | Ga0070699_100389103 | 3300005518 | Bacteria | 1260 |
| 71 | Ga0070697_100013409 | 3300005536 | Bacteria | 6429 |
| 72 | Ga0070697_100069049 | 3300005536 | Bacteria | 2894 |
| 73 | Ga0070697_100154624 | 3300005536 | Bacteria | 1935 |
| 74 | Ga0070697_100345431 | 3300005536 | Bacteria | 1285 |
| 75 | Ga0068853_100215198 | 3300005539 | Bacteria | 1753 |
| 76 | Ga0068853_100223636 | 3300005539 | Bacteria | 1720 |
| 77 | Ga0070696_100025911 | 3300005546 | Bacteria | 3988 |
| 78 | Ga0070665_100002914 | 3300005548 | Bacteria | 18491 |
| 79 | Ga0070665_100006487 | 3300005548 | Bacteria | 11901 |
| 80 | Ga0070665_100024100 | 3300005548 | Bacteria | 6128 |
| 81 | Ga0070665_100179991 | 3300005548 | Bacteria | 2115 |
| 82 | Ga0070665_100182195 | 3300005548 | Bacteria | 2101 |
| 83 | Ga0070704_100020603 | 3300005549 | Bacteria | 4256 |
| 84 | Ga0068855_100070455 | 3300005563 | Bacteria | 4067 |
| 85 | Ga0068856_100018995 | 3300005614 | Bacteria | 6669 |
| 86 | Ga0068852_100130956 | 3300005616 | Bacteria | 2310 |
| 87 | Ga0068864_100091296 | 3300005618 | Bacteria | 2686 |
| 88 | Ga0068864_100190673 | 3300005618 | Bacteria | 1879 |
| 89 | Ga0068861_100002985 | 3300005719 | Bacteria | 11163 |
| 90 | Ga0068863_100178915 | 3300005841 | Bacteria | 2036 |
| 91 | Ga0068860_100029070 | 3300005843 | Bacteria | 5317 |
| 92 | Ga0068862_100029695 | 3300005844 | Bacteria | 4607 |
| 93 | Ga0068862_100149351 | 3300005844 | Bacteria | 2079 |
| 94 | Ga0068862_100188168 | 3300005844 | Bacteria | 1856 |
| 95 | Ga0081455_10000165 | 3300005937 | Bacteria | 81987 |
| 96 | Ga0081455_10000715 | 3300005937 | Bacteria | 43119 |
| 97 | Ga0081455_10010592 | 3300005937 | Bacteria | 9331 |
| 98 | Ga0081455_10043485 | 3300005937 | Bacteria | 3928 |
| 99 | Ga0081455_10074473 | 3300005937 | Bacteria | 2804 |
| 100 | Ga0081540_1000002 | 3300005983 | Bacteria | 251149 |
| 101 | Ga0081540_1000021 | 3300005983 | Bacteria | 161624 |
| 102 | Ga0081540_1000787 | 3300005983 | Bacteria | 29106 |
| 103 | Ga0081540_1001470 | 3300005983 | Bacteria | 20340 |
| 104 | Ga0081540_1002212 | 3300005983 | Bacteria | 16044 |
| 105 | Ga0081540_1002285 | 3300005983 | Bacteria | 15735 |
| 106 | Ga0081540_1002452 | 3300005983 | Bacteria | 15103 |
| 107 | Ga0081540_1003224 | 3300005983 | Bacteria | 13002 |
| 108 | Ga0081540_1003472 | 3300005983 | Bacteria | 12439 |
| 109 | Ga0081540_1006015 | 3300005983 | Bacteria | 8929 |
| 110 | Ga0081540_1011193 | 3300005983 | Bacteria | 6017 |
| 111 | Ga0081540_1016727 | 3300005983 | Bacteria | 4573 |
| 112 | Ga0081540_1025480 | 3300005983 | Bacteria | 3401 |
| 113 | Ga0081540_1044147 | 3300005983 | Bacteria | 2278 |
| 114 | Ga0081540_1067943 | 3300005983 | Bacteria | 1662 |
| 115 | Ga0070717_10001164 | 3300006028 | Bacteria | 17767 |
| 116 | Ga0070717_10024876 | 3300006028 | Bacteria | 4757 |
| 117 | Ga0070717_10165456 | 3300006028 | Bacteria | 1921 |
| 118 | Ga0070717_10198724 | 3300006028 | Bacteria | 1755 |
| 119 | Ga0075365_10002250 | 3300006038 | Bacteria | 9352 |
| 120 | Ga0075365_10005374 | 3300006038 | Bacteria | 6901 |
| 121 | Ga0075365_10038349 | 3300006038 | Bacteria | 3114 |
| 122 | Ga0075365_10122771 | 3300006038 | Bacteria | 1793 |
| 123 | Ga0075365_10137808 | 3300006038 | Bacteria | 1692 |
| 124 | Ga0075363_100005934 | 3300006048 | Bacteria | 5505 |
| 125 | Ga0075363_100123712 | 3300006048 | Bacteria | 1446 |
| 126 | Ga0075364_10045672 | 3300006051 | Bacteria | 2851 |
| 127 | Ga0075364_10067396 | 3300006051 | Bacteria | 2352 |
| 128 | Ga0070715_10035799 | 3300006163 | Bacteria | 2044 |
| 129 | Ga0070716_100059836 | 3300006173 | Bacteria | 2197 |
| 130 | Ga0070716_100126585 | 3300006173 | Bacteria | 1608 |
| 131 | Ga0070712_100009376 | 3300006175 | Bacteria | 6166 |
| 132 | Ga0070712_100010060 | 3300006175 | Bacteria | 5961 |
| 133 | Ga0070712_100020675 | 3300006175 | Bacteria | 4310 |
| 134 | Ga0070712_100048398 | 3300006175 | Bacteria | 2947 |
| 135 | Ga0070712_100056649 | 3300006175 | Bacteria | 2750 |
| 136 | Ga0075362_10001097 | 3300006177 | Bacteria | 8406 |
| 137 | Ga0075362_10087247 | 3300006177 | Bacteria | 1445 |
| 138 | Ga0075367_10001540 | 3300006178 | Bacteria | 9968 |
| 139 | Ga0075367_10001959 | 3300006178 | Bacteria | 9156 |
| 140 | Ga0075369_10000106 | 3300006186 | Bacteria | 22440 |
| 141 | Ga0075369_10040648 | 3300006186 | Bacteria | 1988 |
| 142 | Ga0075366_10004804 | 3300006195 | Bacteria | 7288 |
| 143 | Ga0075366_10109445 | 3300006195 | Bacteria | 1661 |
| 144 | Ga0075370_10003315 | 3300006353 | Bacteria | 7647 |
| 145 | Ga0075370_10007764 | 3300006353 | Bacteria | 5480 |
| 146 | Ga0075370_10024530 | 3300006353 | Bacteria | 3332 |
| 147 | Ga0075370_10026246 | 3300006353 | Bacteria | 3226 |
| 148 | Ga0075370_10045416 | 3300006353 | Bacteria | 2485 |
| 149 | Ga0075428_100001568 | 3300006844 | Bacteria | 24492 |
| 150 | Ga0075428_100064438 | 3300006844 | Bacteria | 4013 |
| 151 | Ga0075428_100064532 | 3300006844 | Bacteria | 4010 |
| 152 | Ga0075428_100072013 | 3300006844 | Bacteria | 3777 |
| 153 | Ga0075430_100009419 | 3300006846 | Bacteria | 8253 |
| 154 | Ga0075430_100011000 | 3300006846 | Bacteria | 7666 |
| 155 | Ga0075430_100014903 | 3300006846 | Bacteria | 6621 |
| 156 | Ga0075430_100040472 | 3300006846 | Bacteria | 3945 |
| 157 | Ga0075431_100000110 | 3300006847 | Bacteria | 52121 |
| 158 | Ga0075431_100064670 | 3300006847 | Bacteria | 3777 |
| 159 | Ga0075431_100085094 | 3300006847 | Bacteria | 3264 |
| 160 | Ga0075431_100145708 | 3300006847 | Bacteria | 2440 |
| 161 | Ga0075433_10001538 | 3300006852 | Bacteria | 17045 |
| 162 | Ga0075434_100002679 | 3300006871 | Bacteria | 15731 |
| 163 | Ga0075434_100013294 | 3300006871 | Bacteria | 7828 |
| 164 | Ga0075434_100290929 | 3300006871 | Bacteria | 1654 |
| 165 | Ga0075429_100010965 | 3300006880 | Bacteria | 7842 |
| 166 | Ga0075429_100046476 | 3300006880 | Bacteria | 3777 |
| 167 | Ga0075436_100000863 | 3300006914 | Bacteria | 20151 |
| 168 | Ga0075436_100249452 | 3300006914 | Bacteria | 1264 |
| 169 | Ga0075435_100103087 | 3300007076 | Bacteria | 2366 |
| 170 | Ga0075435_100208044 | 3300007076 | Bacteria | 1659 |
| 171 | Ga0099794_10000628 | 3300007265 | Bacteria | 11768 |
| 172 | Ga0099794_10010403 | 3300007265 | Bacteria | 3949 |
| 173 | Ga0099794_10016490 | 3300007265 | Bacteria | 3276 |
| 174 | Ga0111539_10000570 | 3300009094 | Bacteria | 47255 |
| 175 | Ga0111539_10073473 | 3300009094 | Bacteria | 4032 |
| 176 | Ga0111539_10143480 | 3300009094 | Bacteria | 2795 |
| 177 | Ga0111539_10278953 | 3300009094 | Bacteria | 1945 |
| 178 | Ga0111539_10300573 | 3300009094 | Bacteria | 1868 |
| 179 | Ga0105245_10130209 | 3300009098 | Bacteria | 2359 |
| 180 | Ga0105247_10019784 | 3300009101 | Bacteria | 4043 |
| 181 | Ga0105247_10047000 | 3300009101 | Bacteria | 2650 |
| 182 | Ga0105247_10222243 | 3300009101 | Bacteria | 1279 |
| 183 | Ga0114129_10000766 | 3300009147 | Bacteria | 41029 |
| 184 | Ga0114129_10045330 | 3300009147 | Bacteria | 6182 |
| 185 | Ga0114129_10167269 | 3300009147 | Bacteria | 3000 |
| 186 | Ga0114129_10200337 | 3300009147 | Bacteria | 2705 |
| 187 | Ga0114129_10257021 | 3300009147 | Bacteria | 2343 |
| 188 | Ga0105243_10007473 | 3300009148 | Bacteria | 8398 |
| 189 | Ga0105243_10018111 | 3300009148 | Bacteria | 5330 |
| 190 | Ga0105241_10034717 | 3300009174 | Bacteria | 3791 |
| 191 | Ga0105241_10064231 | 3300009174 | Bacteria | 2833 |
| 192 | Ga0105242_10266828 | 3300009176 | Bacteria | 1549 |
| 193 | Ga0105248_10311580 | 3300009177 | Bacteria | 1773 |
| 194 | Ga0105248_10425602 | 3300009177 | Bacteria | 1495 |
| 195 | Ga0105237_10248843 | 3300009545 | Bacteria | 1779 |
| 196 | Ga0105238_10076600 | 3300009551 | Bacteria | 3336 |
| 197 | Ga0105249_10021556 | 3300009553 | Bacteria | 5769 |
| 198 | Ga0105249_10457758 | 3300009553 | Bacteria | 1315 |
| 199 | Ga0099796_10005417 | 3300010159 | Bacteria | 3185 |
| 200 | Ga0099796_10019757 | 3300010159 | Bacteria | 2048 |
| 201 | Ga0099796_10032891 | 3300010159 | Bacteria | 1703 |
| 202 | Ga0105239_10023240 | 3300010375 | Bacteria | 6830 |
| 203 | Ga0105239_10060470 | 3300010375 | Bacteria | 4158 |
| 204 | Ga0105246_10128980 | 3300011119 | Bacteria | 1886 |
| 205 | Ga0105246_10213564 | 3300011119 | Bacteria | 1507 |
| 206 | Ga0157374_10124771 | 3300013296 | Bacteria | 2488 |
| 207 | Ga0157374_10251751 | 3300013296 | Bacteria | 1738 |
| 208 | Ga0157378_10146495 | 3300013297 | Bacteria | 2197 |
| 209 | Ga0163162_10031551 | 3300013306 | Bacteria | 5256 |
| 210 | Ga0163162_10151128 | 3300013306 | Bacteria | 2440 |
| 211 | Ga0163162_10171322 | 3300013306 | Bacteria | 2295 |
| 212 | Ga0163162_10352472 | 3300013306 | Bacteria | 1604 |
| 213 | Ga0157375_10356457 | 3300013308 | Bacteria | 1629 |
| 214 | Ga0157375_10377689 | 3300013308 | Bacteria | 1584 |
| 215 | Ga0163163_10015404 | 3300014325 | Bacteria | 7069 |
| 216 | Ga0157376_10135314 | 3300014969 | Bacteria | 2204 |
| 217 | Ga0163161_10046964 | 3300017792 | Bacteria | 3117 |
| 218 | Ga0163161_10052806 | 3300017792 | Bacteria | 2946 |
| 219 | Ga0213876_10035942 | 3300021384 | Bacteria | 2613 |
| 220 | Ga0213871_10005103 | 3300021441 | Bacteria | 2683 |
| 221 | Ga0209563_101772 | 3300025230 | Bacteria | 5425 |
| 222 | Ga0209677_101975 | 3300025253 | Bacteria | 8152 |
| 223 | Ga0209677_102808 | 3300025253 | Bacteria | 6165 |
| 224 | Ga0209148_1012845 | 3300025254 | Bacteria | 1520 |
| 225 | Ga0209233_1002127 | 3300025261 | Bacteria | 7466 |
| 226 | Ga0209233_1004746 | 3300025261 | Bacteria | 4586 |
| 227 | Ga0209455_1012420 | 3300025272 | Bacteria | 2040 |
| 228 | Ga0209564_1003588 | 3300025295 | Bacteria | 10355 |
| 229 | Ga0209564_1007333 | 3300025295 | Bacteria | 5719 |
| 230 | Ga0209758_1000024 | 3300025297 | Bacteria | 591966 |
| 231 | Ga0209758_1000139 | 3300025297 | Bacteria | 175148 |
| 232 | Ga0209758_1000209 | 3300025297 | Bacteria | 128038 |
| 233 | Ga0209758_1003797 | 3300025297 | Bacteria | 13306 |
| 234 | Ga0209758_1006334 | 3300025297 | Bacteria | 8576 |
| 235 | Ga0209758_1007918 | 3300025297 | Bacteria | 7053 |
| 236 | Ga0209758_1008134 | 3300025297 | Bacteria | 6894 |
| 237 | Ga0209758_1029049 | 3300025297 | Bacteria | 2323 |
| 238 | Ga0209256_1006206 | 3300025299 | Bacteria | 6443 |
| 239 | Ga0209256_1021882 | 3300025299 | Bacteria | 1950 |
| 240 | Ga0207426_1000237 | 3300025302 | Bacteria | 124707 |
| 241 | Ga0207426_1002648 | 3300025302 | Bacteria | 11036 |
| 242 | Ga0209257_1000416 | 3300025304 | Bacteria | 82474 |
| 243 | Ga0207692_10003561 | 3300025898 | Bacteria | 6093 |
| 244 | Ga0207692_10020640 | 3300025898 | Bacteria | 3001 |
| 245 | Ga0207692_10078585 | 3300025898 | Bacteria | 1758 |
| 246 | Ga0207647_10057719 | 3300025904 | Bacteria | 2379 |
| 247 | Ga0207699_10004084 | 3300025906 | Bacteria | 6984 |
| 248 | Ga0207699_10006269 | 3300025906 | Bacteria | 5746 |
| 249 | Ga0207699_10007551 | 3300025906 | Bacteria | 5321 |
| 250 | Ga0207699_10057284 | 3300025906 | Bacteria | 2326 |
| 251 | Ga0207645_10151084 | 3300025907 | Bacteria | 1516 |
| 252 | Ga0207643_10073125 | 3300025908 | Bacteria | 1976 |
| 253 | Ga0207705_10029754 | 3300025909 | Bacteria | 3893 |
| 254 | Ga0207684_10105805 | 3300025910 | Bacteria | 2407 |
| 255 | Ga0207684_10182359 | 3300025910 | Bacteria | 1810 |
| 256 | Ga0207693_10003198 | 3300025915 | Bacteria | 14054 |
| 257 | Ga0207693_10004819 | 3300025915 | Bacteria | 11344 |
| 258 | Ga0207693_10016822 | 3300025915 | Bacteria | 5837 |
| 259 | Ga0207693_10021983 | 3300025915 | Bacteria | 5071 |
| 260 | Ga0207693_10030609 | 3300025915 | Bacteria | 4252 |
| 261 | Ga0207693_10121953 | 3300025915 | Bacteria | 2047 |
| 262 | Ga0207663_10007150 | 3300025916 | Bacteria | 5769 |
| 263 | Ga0207663_10011977 | 3300025916 | Bacteria | 4674 |
| 264 | Ga0207663_10023870 | 3300025916 | Bacteria | 3517 |
| 265 | Ga0207663_10026736 | 3300025916 | Bacteria | 3353 |
| 266 | Ga0207663_10039546 | 3300025916 | Bacteria | 2858 |
| 267 | Ga0207657_10210886 | 3300025919 | Bacteria | 1559 |
| 268 | Ga0207646_10225703 | 3300025922 | Bacteria | 1692 |
| 269 | Ga0207687_10003095 | 3300025927 | Bacteria | 11284 |
| 270 | Ga0207700_10043818 | 3300025928 | Bacteria | 3290 |
| 271 | Ga0207700_10065195 | 3300025928 | Bacteria | 2778 |
| 272 | Ga0207700_10098429 | 3300025928 | Bacteria | 2327 |
| 273 | Ga0207664_10007583 | 3300025929 | Bacteria | 7526 |
| 274 | Ga0207664_10019667 | 3300025929 | Bacteria | 4996 |
| 275 | Ga0207644_10145448 | 3300025931 | Bacteria | 1830 |
| 276 | Ga0207706_10001722 | 3300025933 | Bacteria | 21565 |
| 277 | Ga0207709_10090925 | 3300025935 | Bacteria | 1995 |
| 278 | Ga0207709_10095924 | 3300025935 | Bacteria | 1950 |
| 279 | Ga0207709_10102744 | 3300025935 | Bacteria | 1893 |
| 280 | Ga0207670_10105169 | 3300025936 | Bacteria | 2023 |
| 281 | Ga0207665_10000779 | 3300025939 | Bacteria | 21462 |
| 282 | Ga0207665_10007372 | 3300025939 | Bacteria | 7270 |
| 283 | Ga0207665_10018743 | 3300025939 | Bacteria | 4548 |
| 284 | Ga0207665_10089786 | 3300025939 | Bacteria | 2129 |
| 285 | Ga0207691_10241364 | 3300025940 | Bacteria | 1562 |
| 286 | Ga0207711_10029434 | 3300025941 | Bacteria | 4632 |
| 287 | Ga0207689_10009304 | 3300025942 | Bacteria | 8495 |
| 288 | Ga0207679_10220388 | 3300025945 | Bacteria | 1596 |
| 289 | Ga0207667_10284840 | 3300025949 | Bacteria | 1688 |
| 290 | Ga0207712_10015694 | 3300025961 | Bacteria | 4891 |
| 291 | Ga0207712_10017511 | 3300025961 | Bacteria | 4654 |
| 292 | Ga0207668_10001369 | 3300025972 | Bacteria | 14371 |
| 293 | Ga0207668_10014288 | 3300025972 | Bacteria | 4913 |
| 294 | Ga0207668_10017270 | 3300025972 | Bacteria | 4516 |
| 295 | Ga0207668_10038101 | 3300025972 | Bacteria | 3223 |
| 296 | Ga0207668_10051323 | 3300025972 | Bacteria | 2848 |
| 297 | Ga0207639_10140765 | 3300026041 | Bacteria | 2009 |
| 298 | Ga0207678_10002397 | 3300026067 | Bacteria | 17029 |
| 299 | Ga0207678_10003316 | 3300026067 | Bacteria | 14518 |
| 300 | Ga0207678_10014230 | 3300026067 | Bacteria | 6994 |
| 301 | Ga0207678_10147298 | 3300026067 | Bacteria | 2009 |
| 302 | Ga0207708_10061683 | 3300026075 | Bacteria | 2863 |
| 303 | Ga0207641_10051008 | 3300026088 | Bacteria | 3503 |
| 304 | Ga0207676_10079181 | 3300026095 | Bacteria | 2664 |
| 305 | Ga0207674_10068585 | 3300026116 | Bacteria | 3569 |
| 306 | Ga0207675_100010951 | 3300026118 | Bacteria | 8495 |
| 307 | Ga0207675_100094094 | 3300026118 | Bacteria | 2819 |
| 308 | Ga0207683_10211671 | 3300026121 | Bacteria | 1765 |
| 309 | Ga0209179_1000450 | 3300027512 | Bacteria | 4162 |
| 310 | Ga0209588_1000521 | 3300027671 | Bacteria | 9849 |
| 311 | Ga0207428_10002129 | 3300027907 | Bacteria | 19919 |
| 312 | Ga0207428_10007040 | 3300027907 | Bacteria | 10295 |
| 313 | Ga0207428_10011549 | 3300027907 | Bacteria | 7799 |
| 314 | Ga0268266_10001022 | 3300028379 | Bacteria | 35236 |
| 315 | Ga0268266_10005075 | 3300028379 | Bacteria | 12419 |
| 316 | Ga0268266_10050761 | 3300028379 | Bacteria | 3558 |
| 317 | Ga0268265_10012713 | 3300028380 | Bacteria | 5712 |
| 318 | Ga0268265_10016290 | 3300028380 | Bacteria | 5102 |
| 319 | Ga0268264_10011779 | 3300028381 | Bacteria | 7211 |
| 320 | Ga0268264_10156706 | 3300028381 | Bacteria | 2047 |
| 321 | Ga0265334_10011662 | 3300028573 | Bacteria | 3696 |
| 322 | Ga0265760_10022120 | 3300031090 | Bacteria | 1841 |
| 323 | Ga0307509_10152254 | 3300031507 | Bacteria | 2226 |
| 324 | Ga0307509_10174701 | 3300031507 | Bacteria | 2022 |
| 325 | Ga0307409_100033655 | 3300031995 | Bacteria | 3732 |
| 326 | Ga0307409_100041610 | 3300031995 | Bacteria | 3433 |
| 327 | Ga0307411_10027550 | 3300032005 | Bacteria | 3440 |
| 328 | Ga0307411_10092584 | 3300032005 | Bacteria | 2114 |
| 329 | Ga0307415_100062558 | 3300032126 | Bacteria | 2582 |
| 330 | Ga0307510_10014098 | 3300033180 | Bacteria | 9465 |
| 331 | Ga0307510_10061641 | 3300033180 | Bacteria | 3842 |
| 332 | Ga0373934_0015153 | 3300035086 | Bacteria | 2922 |
| 333 | Ga0373954_0001354 | 3300035118 | Bacteria | 9877 |
| 334 | Ga0373956_0006917 | 3300035119 | Bacteria | 4556 |
| 335 | Ga0373943_0046526 | 3300035170 | Bacteria | 2118 |
| 336 | Ga0373955_0001045 | 3300035172 | Bacteria | 11768 |
| 337 | Ga0373924_0003482 | 3300035410 | Bacteria | 5420 |
| 338 | Ga0373927_0017396 | 3300035695 | Bacteria | 4731 |
| 339 | Ga0373927_0059883 | 3300035695 | Bacteria | 2463 |
| 340 | Ga0373933_0001089 | 3300035724 | Bacteria | 16221 |
| 341 | Ga0373947_0041692 | 3300035725 | Bacteria | 2738 |
| 342 | Ga0373937_0006280 | 3300036401 | Bacteria | 10247 |
| 343 | Ga0373925_0097765 | 3300037068 | Bacteria | 2252 |
| 344 | Ga0373925_0189165 | 3300037068 | Bacteria | 1633 |
| 345 | Ga0436365_0999537 | 3300039437 | Bacteria | 4812 |
| 346 | Ga0436360_0435591 | 3300039438 | Bacteria | 2276 |
| 347 | Ga0436361_0426039 | 3300039447 | Bacteria | 2325 |
| 348 | Ga0436361_0714685 | 3300039447 | Bacteria | 6869 |
| 349 | Ga0436361_0961182 | 3300039447 | Bacteria | 2513 |
| 350 | Ga0466959_0083273 | 3300045049 | Bacteria | 2304 |
| 351 | Ga0495592_0008630 | 3300046454 | Bacteria | 7648 |
| 352 | Ga0495603_0021639 | 3300046455 | Bacteria | 3895 |
| 353 | Ga0495590_0050120 | 3300046457 | Bacteria | 1457 |
| 354 | Ga0495629_0008997 | 3300046459 | Bacteria | 7328 |
| 355 | Ga0495629_0058992 | 3300046459 | Bacteria | 2683 |
| 356 | Ga0495638_0002575 | 3300046460 | Bacteria | 14674 |
| 357 | Ga0495638_0010632 | 3300046460 | Bacteria | 6374 |
| 358 | Ga0495651_0033585 | 3300046462 | Bacteria | 4001 |
| 359 | Ga0495653_0013015 | 3300046463 | Bacteria | 6786 |
| 360 | Ga0495653_0077153 | 3300046463 | Unclassified | 2475 |
| 361 | Ga0495605_0023824 | 3300046474 | Bacteria | 3213 |
| 362 | Ga0495639_0103180 | 3300046475 | Bacteria | 1348 |
| 363 | Ga0495662_0008323 | 3300046476 | Bacteria | 5100 |
| 364 | Ga0495664_0011428 | 3300046477 | Bacteria | 5006 |
| 365 | Ga0495584_0018523 | 3300046491 | Bacteria | 3539 |
| 366 | Ga0495585_0021409 | 3300046492 | Bacteria | 3712 |
| 367 | Ga0495606_0011605 | 3300046507 | Bacteria | 7163 |
| 368 | Ga0495608_0002629 | 3300046511 | Bacteria | 12898 |
| 369 | Ga0495628_0057941 | 3300046516 | Bacteria | 3047 |
| 370 | Ga0495630_0057520 | 3300046517 | Bacteria | 2914 |
| 371 | Ga0495631_0050058 | 3300046518 | Bacteria | 1828 |
| 372 | Ga0495632_0042259 | 3300046519 | Bacteria | 2285 |
| 373 | Ga0495637_0046525 | 3300046520 | Bacteria | 1835 |
| 374 | Ga0495637_0077350 | 3300046520 | Bacteria | 1332 |
| 375 | Ga0495643_0026380 | 3300046522 | Bacteria | 3279 |
| 376 | Ga0495648_0002795 | 3300046524 | Bacteria | 15731 |
| 377 | Ga0495648_0008057 | 3300046524 | Bacteria | 8336 |
| 378 | Ga0495648_0009873 | 3300046524 | Bacteria | 7335 |
| 379 | Ga0495640_0015625 | 3300046533 | Bacteria | 5705 |
| 380 | Ga0495587_0036423 | 3300046536 | Bacteria | 2959 |
| 381 | Ga0495609_0066868 | 3300046538 | Bacteria | 1583 |
| 382 | Ga0495621_0003718 | 3300046539 | Bacteria | 4225 |
| 383 | Ga0495645_0002685 | 3300046543 | Bacteria | 12074 |
| 384 | Ga0495622_0038526 | 3300046557 | Bacteria | 2226 |
| 385 | Ga0495667_0013388 | 3300046559 | Bacteria | 5552 |
| 386 | Ga0495656_0047775 | 3300046615 | Bacteria | 1816 |
| 387 | Ga0495668_0034892 | 3300046616 | Bacteria | 2820 |
| 388 | Ga0495634_0010658 | 3300046642 | Bacteria | 6729 |
| 389 | Ga0495634_0020002 | 3300046642 | Bacteria | 4750 |
| 390 | Ga0495634_0181157 | 3300046642 | Bacteria | 1319 |
| 391 | Ga0495611_0006627 | 3300046648 | Bacteria | 4932 |
| 392 | Ga0495625_0074786 | 3300046660 | Bacteria | 2372 |
| 393 | Ga0495625_0110434 | 3300046660 | Bacteria | 1880 |
| 394 | Ga0495625_0145442 | 3300046660 | Bacteria | 1596 |
| 395 | Ga0495635_0002628 | 3300046663 | Bacteria | 12288 |
| 396 | Ga0495635_0108406 | 3300046663 | Bacteria | 1897 |
| 397 | Ga0495659_0037244 | 3300046664 | Bacteria | 1722 |
| 398 | Ga0495659_0041900 | 3300046664 | Bacteria | 1637 |
| 399 | Ga0495588_0010521 | 3300046674 | Bacteria | 4304 |
| 400 | Ga0495657_0038615 | 3300046675 | Bacteria | 3284 |
| 401 | Ga0495599_0001303 | 3300046678 | Bacteria | 14181 |
| 402 | Ga0495646_0015281 | 3300046680 | Bacteria | 4874 |
| 403 | Ga0495669_0004419 | 3300046684 | Bacteria | 5807 |
| 404 | Ga0495669_0103791 | 3300046684 | Bacteria | 1322 |
| 405 | Ga0495624_0062665 | 3300046690 | Bacteria | 2326 |
| 406 | Ga0495670_0141359 | 3300046691 | Bacteria | 1259 |
| 407 | Ga0495671_0130530 | 3300046692 | Bacteria | 1225 |
| 408 | Ga0495649_0093385 | 3300046694 | Bacteria | 1602 |
| 409 | Ga0495600_0004004 | 3300046809 | Bacteria | 8757 |
| 410 | Ga0495604_0029571 | 3300047317 | Bacteria | 4358 |
| 411 | Ga0495604_0053329 | 3300047317 | Bacteria | 3126 |
| 412 | Ga0495674_0120296 | 3300047319 | Bacteria | 2219 |
| 413 | Ga0495672_0065522 | 3300047320 | Bacteria | 2076 |
| 414 | Ga0495676_0106458 | 3300047321 | Bacteria | 2066 |
| 415 | Ga0495680_0002436 | 3300047322 | Bacteria | 19039 |
| 416 | Ga0495683_0063856 | 3300047323 | Bacteria | 1819 |
| 417 | Ga0495675_0055280 | 3300047444 | Bacteria | 2517 |
| 418 | Ga0495673_0025002 | 3300047469 | Bacteria | 2874 |
| 419 | Ga0495673_0099165 | 3300047469 | Bacteria | 1180 |
| 420 | Ga0495684_0003077 | 3300047471 | Bacteria | 13110 |
| 421 | Ga0495684_0003990 | 3300047471 | Bacteria | 11511 |
| 422 | Ga0495686_0053148 | 3300047472 | Bacteria | 2539 |
| 423 | Ga0495686_0077384 | 3300047472 | Bacteria | 2037 |
| 424 | Ga0495686_0090192 | 3300047472 | Bacteria | 1862 |
| 425 | Ga0495686_0120278 | 3300047472 | Bacteria | 1566 |
| 426 | Ga0495593_0002110 | 3300047673 | Bacteria | 11877 |
| 427 | Ga0495602_0099140 | 3300048088 | Bacteria | 2396 |
| 428 | Ga0496101_0013290 | 3300048904 | Bacteria | 5514 |
| 429 | Ga0496101_0016299 | 3300048904 | Bacteria | 5016 |
| 430 | Ga0496102_0098305 | 3300048905 | Bacteria | 2716 |
| 431 | Ga0496104_0059661 | 3300048907 | Bacteria | 3612 |
| 432 | Ga0496104_0066176 | 3300048907 | Bacteria | 3431 |
| 433 | Ga0496105_0006689 | 3300048908 | Bacteria | 8873 |
| 434 | Ga0496105_0011260 | 3300048908 | Bacteria | 7060 |
| 435 | Ga0496106_0030102 | 3300048909 | Bacteria | 4047 |
| 436 | Ga0496106_0135656 | 3300048909 | Bacteria | 1933 |
| 437 | Ga0496107_0111704 | 3300048910 | Bacteria | 2009 |
| 438 | Ga0496108_0240300 | 3300048911 | Bacteria | 1575 |
| 439 | Ga0496109_0124509 | 3300048912 | Bacteria | 2403 |
| 440 | Ga0496110_0016254 | 3300048913 | Bacteria | 6210 |
| 441 | Ga0496110_0183101 | 3300048913 | Bacteria | 1902 |
| 442 | Ga0496110_0282219 | 3300048913 | Bacteria | 1512 |
| 443 | Ga0496111_0031450 | 3300048914 | Bacteria | 3781 |
| 444 | Ga0496112_0097976 | 3300048915 | Bacteria | 2902 |
| 445 | Ga0496112_0168225 | 3300048915 | Bacteria | 2158 |
| 446 | Ga0496112_0182165 | 3300048915 | Bacteria | 2064 |
| 447 | Ga0496112_0219713 | 3300048915 | Bacteria | 1856 |
| 448 | Ga0496113_0085819 | 3300048916 | Bacteria | 2418 |
| 449 | Ga0496114_0027824 | 3300048917 | Bacteria | 4634 |
| 450 | Ga0496114_0107054 | 3300048917 | Bacteria | 2393 |
| 451 | Ga0496114_0143490 | 3300048917 | Bacteria | 2069 |
| 452 | Ga0496115_0035644 | 3300048918 | Bacteria | 3937 |
| 453 | Ga0496115_0075330 | 3300048918 | Bacteria | 2741 |
| 454 | Ga0496115_0179133 | 3300048918 | Bacteria | 1752 |
| 455 | Ga0496117_0055679 | 3300048920 | Bacteria | 2761 |
| 456 | Ga0496118_0015721 | 3300048921 | Bacteria | 6987 |
| 457 | Ga0496119_0090890 | 3300048922 | Bacteria | 1735 |
| 458 | Ga0496121_0000178 | 3300048924 | Bacteria | 141429 |
| 459 | Ga0496121_0000868 | 3300048924 | Bacteria | 54616 |
| 460 | Ga0496121_0001346 | 3300048924 | Bacteria | 41986 |
| 461 | Ga0496121_0007484 | 3300048924 | Bacteria | 13190 |
| 462 | Ga0496121_0036811 | 3300048924 | Bacteria | 4355 |
| 463 | Ga0496121_0077900 | 3300048924 | Bacteria | 2638 |
| 464 | Ga0496121_0103860 | 3300048924 | Bacteria | 2185 |
| 465 | Ga0496121_0104292 | 3300048924 | Bacteria | 2179 |
| 466 | Ga0496121_0104972 | 3300048924 | Bacteria | 2169 |
| 467 | Ga0496122_0043294 | 3300048925 | Bacteria | 3529 |
| 468 | Ga0496126_0002980 | 3300048929 | Bacteria | 21982 |
| 469 | Ga0496126_0013853 | 3300048929 | Bacteria | 8180 |
| 470 | Ga0496126_0017979 | 3300048929 | Bacteria | 7028 |
| 471 | Ga0496126_0040784 | 3300048929 | Bacteria | 4302 |
| 472 | Ga0496126_0045621 | 3300048929 | Bacteria | 4026 |
| 473 | Ga0496126_0087272 | 3300048929 | Bacteria | 2749 |
| 474 | Ga0496126_0106425 | 3300048929 | Bacteria | 2448 |
| 475 | Ga0495682_0016089 | 3300049460 | Bacteria | 2829 |
| 476 | nmdc:mga03683_32382_c1 | 3300050489 | Bacteria | 2103 |
| 477 | nmdc:mga03683_672_c1 | 3300050489 | Bacteria | 7052 |
| 478 | nmdc:mga03683_90323_c1 | 3300050489 | Bacteria | 1334 |
| 479 | nmdc:mga03n38_2843_c1 | 3300050490 | Bacteria | 5449 |
| 480 | nmdc:mga03n38_3844_c1 | 3300050490 | Bacteria | 4884 |
| 481 | nmdc:mga00v17_27330_c1 | 3300050491 | Bacteria | 3330 |
| 482 | nmdc:mga00v17_38782_c1 | 3300050491 | Bacteria | 2850 |
| 483 | nmdc:mga00v17_86617_c1 | 3300050491 | Bacteria | 1963 |
| 484 | nmdc:mga0yw44_104964_c1 | 3300050492 | Bacteria | 1804 |
| 485 | nmdc:mga0yw44_125676_c1 | 3300050492 | Bacteria | 1656 |
| 486 | nmdc:mga0yw44_405_c1 | 3300050492 | Bacteria | 15044 |
| 487 | nmdc:mga0k408_1338_c1 | 3300050493 | Bacteria | 2214 |
| 488 | nmdc:mga06z11_2034_c1 | 3300050494 | Bacteria | 7665 |
| 489 | nmdc:mga06z11_38_c1 | 3300050494 | Bacteria | 54827 |
| 490 | nmdc:mga06z11_5543_c1 | 3300050494 | Bacteria | 5074 |
| 491 | nmdc:mga07m45_106_c1 | 3300050496 | Bacteria | 28440 |
| 492 | nmdc:mga07m45_10894_c1 | 3300050496 | Bacteria | 4761 |
| 493 | nmdc:mga07m45_38426_c1 | 3300050496 | Bacteria | 2671 |
| 494 | nmdc:mga07m45_40886_c1 | 3300050496 | Bacteria | 2595 |
| 495 | nmdc:mga07m45_8693_c1 | 3300050496 | Bacteria | 5231 |
| 496 | nmdc:mga05p37_12561_c1 | 3300050507 | Bacteria | 10112 |
| 497 | nmdc:mga05p37_160_c1 | 3300050507 | Bacteria | 64997 |
| 498 | nmdc:mga09592_15829_c1 | 3300050508 | Bacteria | 6163 |
| 499 | nmdc:mga09592_2214_c1 | 3300050508 | Bacteria | 15651 |
| 500 | nmdc:mga0qj67_1410_c1 | 3300050509 | Bacteria | 16811 |
| 501 | nmdc:mga0qj67_15607_c1 | 3300050509 | Bacteria | 5751 |
| 502 | nmdc:mga0qj67_2560_c1 | 3300050509 | Bacteria | 12991 |
| 503 | nmdc:mga0qj67_7961_c1 | 3300050509 | Bacteria | 7834 |
| 504 | nmdc:mga06r32_237637_c1 | 3300050510 | Bacteria | 1810 |
| 505 | nmdc:mga06r32_27771_c1 | 3300050510 | Bacteria | 5291 |
| 506 | nmdc:mga06r32_289_c1 | 3300050510 | Bacteria | 41773 |
| 507 | nmdc:mga06r32_9691_c1 | 3300050510 | Bacteria | 8703 |
| 508 | nmdc:mga08y16_16366_c1 | 3300050511 | Bacteria | 7797 |
| 509 | nmdc:mga08y16_326_c1 | 3300050511 | Bacteria | 43249 |
| 510 | nmdc:mga08y16_45923_c1 | 3300050511 | Bacteria | 4575 |
| 511 | nmdc:mga0n895_10230_c1 | 3300050512 | Bacteria | 8264 |
| 512 | nmdc:mga0n895_107985_c1 | 3300050512 | Bacteria | 2797 |
| 513 | nmdc:mga0n895_11454_c1 | 3300050512 | Bacteria | 7912 |
| 514 | nmdc:mga0n895_607_c1 | 3300050512 | Bacteria | 24823 |
| 515 | nmdc:mga0rr50_13607_c1 | 3300050513 | Bacteria | 5304 |
| 516 | nmdc:mga0rr50_18914_c1 | 3300050513 | Bacteria | 4639 |
| 517 | nmdc:mga0rr50_314058_c1 | 3300050513 | Unclassified | 1313 |
| 518 | nmdc:mga08x19_297048_c1 | 3300050514 | Bacteria | 1121 |
| 519 | nmdc:mga0a205_699_c1 | 3300050515 | Bacteria | 26913 |
| 520 | nmdc:mga0sz30_15_c1 | 3300050516 | Bacteria | 83405 |
| 521 | nmdc:mga0sz30_906_c1 | 3300050516 | Bacteria | 10657 |
| 522 | Ga0495601_0015061 | 3300053077 | Bacteria | 4670 |
| 523 | Ga0495601_0077875 | 3300053077 | Unclassified | 2123 |
| 524 | Ga0500635_0014361 | 3300053080 | Bacteria | 2319 |
| 525 | Ga0495595_0000180 | 3300053084 | Bacteria | 25223 |
| 526 | Ga0495619_0023652 | 3300053085 | Bacteria | 3940 |
| 527 | Ga0500643_000097 | 3300053087 | Bacteria | 92120 |
| 528 | Ga0500647_0026590 | 3300053091 | Bacteria | 2730 |
| 529 | Ga0500651_0000964 | 3300053093 | Bacteria | 14147 |
| 530 | Ga0500566_0000009 | 3300053094 | Bacteria | 131668 |
| 531 | Ga0500566_0000029 | 3300053094 | Bacteria | 75384 |
| 532 | Ga0500640_018844 | 3300053095 | Bacteria | 2949 |
| 533 | Ga0500641_0027513 | 3300053096 | Bacteria | 2214 |
| 534 | Ga0500555_003423 | 3300053103 | Bacteria | 4523 |
| 535 | Ga0500556_0001943 | 3300053104 | Bacteria | 7309 |
| 536 | Ga0500572_000142 | 3300053111 | Bacteria | 24469 |
| 537 | Ga0500595_002504 | 3300053119 | Bacteria | 9073 |
| 538 | Ga0500595_004564 | 3300053119 | Bacteria | 6183 |
| 539 | Ga0500595_014813 | 3300053119 | Bacteria | 2947 |
| 540 | Ga0500608_005239 | 3300053122 | Bacteria | 5127 |
| 541 | Ga0500608_081297 | 3300053122 | Bacteria | 1528 |
| 542 | Ga0500614_002205 | 3300053123 | Bacteria | 4415 |
| 543 | Ga0500603_000016 | 3300053150 | Bacteria | 56563 |
| 544 | Ga0500604_0018905 | 3300053151 | Bacteria | 1925 |
| 545 | Ga0500620_003225 | 3300053155 | Bacteria | 3452 |
| 546 | Ga0500622_0047979 | 3300053156 | Bacteria | 2204 |
| 547 | Ga0500630_000034 | 3300053159 | Bacteria | 38552 |
| 548 | Ga0500634_0079014 | 3300053161 | Bacteria | 1701 |
| 549 | Ga0500638_088424 | 3300053162 | Bacteria | 1462 |
| 550 | Ga0500639_000017 | 3300053163 | Bacteria | 114464 |
| 551 | Ga0500636_0000420 | 3300053177 | Bacteria | 23339 |
| 552 | Ga0500637_0022250 | 3300053178 | Bacteria | 3452 |
| 553 | Ga0500637_0033234 | 3300053178 | Bacteria | 2880 |
| 554 | Ga0500645_030151 | 3300053730 | Bacteria | 1634 |
| 555 | Ga0500609_000642 | 3300053731 | Bacteria | 5318 |
| 556 | Ga0500601_000149 | 3300053737 | Bacteria | 14513 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046694 | Ga0495649_0093385 | Ga0495649_0093385_11_1015 | 298 |
| 2 | 3300047472 | Ga0495686_0053148 | Ga0495686_0053148_998_2173 | 304 |
| 3 | 3300048929 | Ga0496126_0106425 | Ga0496126_0106425_1386_2432 | 311 |
| 4 | 3300048918 | Ga0496115_0179133 | Ga0496115_0179133_564_1739 | 313 |
| 5 | 3300048929 | Ga0496126_0013853 | Ga0496126_0013853_6366_7541 | 313 |
| 6 | 3300005338 | Ga0068868_100089122 | Ga0068868_1000891223 | 316 |
| 7 | 3300006195 | Ga0075366_10109445 | Ga0075366_101094452 | 316 |
| 8 | 3300006871 | Ga0075434_100290929 | Ga0075434_1002909292 | 316 |
| 9 | 3300026067 | Ga0207678_10147298 | Ga0207678_101472981 | 316 |
| 10 | 3300026116 | Ga0207674_10068585 | Ga0207674_100685852 | 316 |
| 11 | 3300048909 | Ga0496106_0135656 | Ga0496106_0135656_552_1730 | 316 |
| 12 | 3300046684 | Ga0495669_0103791 | Ga0495669_0103791_22_1071 | 318 |
| 13 | 3300047472 | Ga0495686_0077384 | Ga0495686_0077384_975_2024 | 318 |
| 14 | iso_pu_bacteria | 8016557553 | 8016562238 | 319 |
| 15 | 3300025908 | Ga0207643_10073125 | Ga0207643_100731252 | 323 |
| 16 | 3300025935 | Ga0207709_10090925 | Ga0207709_100909252 | 323 |
| 17 | 3300003215 | JGI25153J46596_10000483 | JGI25153J46596_100004835 | 326 |
| 18 | 3300003794 | Ga0055531_10012320 | Ga0055531_100123205 | 326 |
| 19 | 3300025297 | Ga0209758_1000024 | Ga0209758_1000024185 | 326 |
| 20 | 3300025304 | Ga0209257_1000416 | Ga0209257_100041635 | 326 |
| 21 | 3300047469 | Ga0495673_0099165 | Ga0495673_0099165_52_1149 | 326 |
| 22 | 3300005337 | Ga0070682_100110139 | Ga0070682_1001101392 | 327 |
| 23 | 3300005455 | Ga0070663_100006379 | Ga0070663_1000063796 | 327 |
| 24 | 3300005548 | Ga0070665_100002914 | Ga0070665_1000029146 | 327 |
| 25 | 3300006048 | Ga0075363_100005934 | Ga0075363_1000059343 | 327 |
| 26 | 3300006051 | Ga0075364_10045672 | Ga0075364_100456723 | 327 |
| 27 | 3300006353 | Ga0075370_10024530 | Ga0075370_100245303 | 327 |
| 28 | 3300009177 | Ga0105248_10425602 | Ga0105248_104256022 | 327 |
| 29 | 3300011119 | Ga0105246_10128980 | Ga0105246_101289802 | 327 |
| 30 | 3300014325 | Ga0163163_10015404 | Ga0163163_100154046 | 327 |
| 31 | 3300026067 | Ga0207678_10002397 | Ga0207678_1000239711 | 327 |
| 32 | 3300028379 | Ga0268266_10001022 | Ga0268266_1000102212 | 327 |
| 33 | 3300046660 | Ga0495625_0110434 | Ga0495625_0110434_531_1706 | 327 |
| 34 | 3300048917 | Ga0496114_0107054 | Ga0496114_0107054_105_1283 | 327 |
| 35 | 3300050490 | nmdc:mga03n38_2843_c1 | nmdc:mga03n38_2843_c1_2305_3483 | 327 |
| 36 | 3300050491 | nmdc:mga00v17_38782_c1 | nmdc:mga00v17_38782_c1_555_1733 | 327 |
| 37 | 3300050494 | nmdc:mga06z11_2034_c1 | nmdc:mga06z11_2034_c1_3705_4883 | 327 |
| 38 | 3300050496 | nmdc:mga07m45_10894_c1 | nmdc:mga07m45_10894_c1_1967_3145 | 327 |
| 39 | 3300046507 | Ga0495606_0011605 | Ga0495606_0011605_4246_5373 | 328 |
| 40 | 3300048912 | Ga0496109_0124509 | Ga0496109_0124509_877_2004 | 328 |
| 41 | 3300005983 | Ga0081540_1067943 | Ga0081540_10679432 | 330 |
| 42 | 3300006844 | Ga0075428_100001568 | Ga0075428_1000015686 | 331 |
| 43 | 3300006846 | Ga0075430_100014903 | Ga0075430_1000149032 | 331 |
| 44 | 3300006847 | Ga0075431_100000110 | Ga0075431_10000011038 | 331 |
| 45 | 3300009094 | Ga0111539_10000570 | Ga0111539_1000057043 | 331 |
| 46 | 3300009147 | Ga0114129_10000766 | Ga0114129_1000076633 | 331 |
| 47 | 3300025272 | Ga0209455_1012420 | Ga0209455_10124203 | 331 |
| 48 | 3300025941 | Ga0207711_10029434 | Ga0207711_100294342 | 331 |
| 49 | 3300027907 | Ga0207428_10007040 | Ga0207428_100070402 | 331 |
| 50 | 3300050507 | nmdc:mga05p37_160_c1 | nmdc:mga05p37_160_c1_26877_28061 | 331 |
| 51 | 3300050509 | nmdc:mga0qj67_15607_c1 | nmdc:mga0qj67_15607_c1_1853_3037 | 331 |
| 52 | 3300050510 | nmdc:mga06r32_289_c1 | nmdc:mga06r32_289_c1_4743_5927 | 331 |
| 53 | 3300050511 | nmdc:mga08y16_326_c1 | nmdc:mga08y16_326_c1_5299_6483 | 331 |
| 54 | 3300005436 | Ga0070713_100150664 | Ga0070713_1001506642 | 332 |
| 55 | 3300005455 | Ga0070663_100144252 | Ga0070663_1001442522 | 332 |
| 56 | 3300009148 | Ga0105243_10007473 | Ga0105243_100074733 | 332 |
| 57 | 3300025254 | Ga0209148_1012845 | Ga0209148_10128452 | 332 |
| 58 | 3300025261 | Ga0209233_1004746 | Ga0209233_10047463 | 332 |
| 59 | 3300049460 | Ga0495682_0016089 | Ga0495682_0016089_38_1075 | 332 |
| 60 | 3300048908 | Ga0496105_0011260 | Ga0496105_0011260_5965_7005 | 333 |
| 61 | 3300005983 | Ga0081540_1016727 | Ga0081540_10167272 | 334 |
| 62 | 3300032005 | Ga0307411_10027550 | Ga0307411_100275504 | 334 |
| 63 | 3300005937 | Ga0081455_10000715 | Ga0081455_100007159 | 335 |
| 64 | 3300003752 | Ga0055539_1005156 | Ga0055539_10051562 | 336 |
| 65 | 3300005347 | Ga0070668_100112145 | Ga0070668_1001121452 | 336 |
| 66 | 3300005844 | Ga0068862_100188168 | Ga0068862_1001881682 | 336 |
| 67 | 3300025253 | Ga0209677_102808 | Ga0209677_1028082 | 336 |
| 68 | 3300048907 | Ga0496104_0066176 | Ga0496104_0066176_50_1099 | 336 |
| 69 | 3300050514 | nmdc:mga08x19_297048_c1 | nmdc:mga08x19_297048_c1_24_1067 | 336 |
| 70 | 3300006871 | Ga0075434_100002679 | Ga0075434_1000026795 | 337 |
| 71 | 3300025295 | Ga0209564_1007333 | Ga0209564_10073333 | 337 |
| 72 | 3300025299 | Ga0209256_1006206 | Ga0209256_10062062 | 337 |
| 73 | 3300050512 | nmdc:mga0n895_11454_c1 | nmdc:mga0n895_11454_c1_3348_4508 | 337 |
| 74 | 3300050513 | nmdc:mga0rr50_13607_c1 | nmdc:mga0rr50_13607_c1_862_2022 | 337 |
| 75 | 3300046460 | Ga0495638_0002575 | Ga0495638_0002575_6771_7943 | 338 |
| 76 | 3300048924 | Ga0496121_0103860 | Ga0496121_0103860_482_1672 | 338 |
| 77 | 3300005983 | Ga0081540_1002452 | Ga0081540_10024523 | 339 |
| 78 | 3300025972 | Ga0207668_10051323 | Ga0207668_100513233 | 339 |
| 79 | 3300046475 | Ga0495639_0103180 | Ga0495639_0103180_32_1090 | 339 |
| 80 | 3300050513 | nmdc:mga0rr50_314058_c1 | nmdc:mga0rr50_314058_c1_184_1236 | 339 |
| 81 | 3300053094 | Ga0500566_0000029 | Ga0500566_0000029_71555_72727 | 339 |
| 82 | 3300005347 | Ga0070668_100020486 | Ga0070668_1000204862 | 340 |
| 83 | 3300005456 | Ga0070678_100207550 | Ga0070678_1002075502 | 340 |
| 84 | 3300005459 | Ga0068867_100125340 | Ga0068867_1001253402 | 340 |
| 85 | 3300005548 | Ga0070665_100179991 | Ga0070665_1001799912 | 340 |
| 86 | 3300006038 | Ga0075365_10137808 | Ga0075365_101378081 | 340 |
| 87 | 3300006353 | Ga0075370_10045416 | Ga0075370_100454162 | 340 |
| 88 | 3300010375 | Ga0105239_10023240 | Ga0105239_100232402 | 340 |
| 89 | 3300013306 | Ga0163162_10171322 | Ga0163162_101713222 | 340 |
| 90 | 3300025945 | Ga0207679_10220388 | Ga0207679_102203882 | 340 |
| 91 | 3300025972 | Ga0207668_10014288 | Ga0207668_100142882 | 340 |
| 92 | 3300031995 | Ga0307409_100041610 | Ga0307409_1000416101 | 340 |
| 93 | 3300032126 | Ga0307415_100062558 | Ga0307415_1000625582 | 340 |
| 94 | 3300046674 | Ga0495588_0010521 | Ga0495588_0010521_140_1312 | 340 |
| 95 | 3300048908 | Ga0496105_0006689 | Ga0496105_0006689_3667_4839 | 340 |
| 96 | 3300048913 | Ga0496110_0016254 | Ga0496110_0016254_1698_2870 | 340 |
| 97 | 3300048917 | Ga0496114_0027824 | Ga0496114_0027824_10_1182 | 340 |
| 98 | 3300048922 | Ga0496119_0090890 | Ga0496119_0090890_441_1613 | 340 |
| 99 | 3300048924 | Ga0496121_0036811 | Ga0496121_0036811_974_2146 | 340 |
| 100 | 3300048929 | Ga0496126_0017979 | Ga0496126_0017979_1759_2931 | 340 |
| 101 | 3300048929 | Ga0496126_0040784 | Ga0496126_0040784_65_1237 | 340 |
| 102 | 3300050496 | nmdc:mga07m45_40886_c1 | nmdc:mga07m45_40886_c1_659_1831 | 340 |
| 103 | 3300005355 | Ga0070671_100057356 | Ga0070671_1000573564 | 341 |
| 104 | 3300005455 | Ga0070663_100025905 | Ga0070663_1000259052 | 341 |
| 105 | 3300005456 | Ga0070678_100080606 | Ga0070678_1000806062 | 341 |
| 106 | 3300005563 | Ga0068855_100070455 | Ga0068855_1000704552 | 341 |
| 107 | 3300005614 | Ga0068856_100018995 | Ga0068856_1000189956 | 341 |
| 108 | 3300005618 | Ga0068864_100091296 | Ga0068864_1000912963 | 341 |
| 109 | 3300005841 | Ga0068863_100178915 | Ga0068863_1001789152 | 341 |
| 110 | 3300005983 | Ga0081540_1011193 | Ga0081540_10111935 | 341 |
| 111 | 3300006048 | Ga0075363_100123712 | Ga0075363_1001237122 | 341 |
| 112 | 3300006186 | Ga0075369_10040648 | Ga0075369_100406482 | 341 |
| 113 | 3300007076 | Ga0075435_100208044 | Ga0075435_1002080442 | 341 |
| 114 | 3300009094 | Ga0111539_10143480 | Ga0111539_101434803 | 341 |
| 115 | 3300009101 | Ga0105247_10019784 | Ga0105247_100197845 | 341 |
| 116 | 3300009101 | Ga0105247_10222243 | Ga0105247_102222431 | 341 |
| 117 | 3300009174 | Ga0105241_10034717 | Ga0105241_100347172 | 341 |
| 118 | 3300009174 | Ga0105241_10064231 | Ga0105241_100642313 | 341 |
| 119 | 3300009176 | Ga0105242_10266828 | Ga0105242_102668282 | 341 |
| 120 | 3300009551 | Ga0105238_10076600 | Ga0105238_100766002 | 341 |
| 121 | 3300011119 | Ga0105246_10213564 | Ga0105246_102135642 | 341 |
| 122 | 3300013296 | Ga0157374_10124771 | Ga0157374_101247712 | 341 |
| 123 | 3300014969 | Ga0157376_10135314 | Ga0157376_101353142 | 341 |
| 124 | 3300025927 | Ga0207687_10003095 | Ga0207687_100030952 | 341 |
| 125 | 3300025935 | Ga0207709_10095924 | Ga0207709_100959242 | 341 |
| 126 | 3300025949 | Ga0207667_10284840 | Ga0207667_102848402 | 341 |
| 127 | 3300026067 | Ga0207678_10003316 | Ga0207678_100033166 | 341 |
| 128 | 3300026095 | Ga0207676_10079181 | Ga0207676_100791812 | 341 |
| 129 | 3300026121 | Ga0207683_10211671 | Ga0207683_102116712 | 341 |
| 130 | 3300046457 | Ga0495590_0050120 | Ga0495590_0050120_119_1291 | 341 |
| 131 | 3300046522 | Ga0495643_0026380 | Ga0495643_0026380_1415_2587 | 341 |
| 132 | 3300046660 | Ga0495625_0145442 | Ga0495625_0145442_34_1131 | 341 |
| 133 | 3300048904 | Ga0496101_0016299 | Ga0496101_0016299_2478_3650 | 341 |
| 134 | 3300048915 | Ga0496112_0182165 | Ga0496112_0182165_116_1294 | 341 |
| 135 | 3300053161 | Ga0500634_0079014 | Ga0500634_0079014_171_1346 | 341 |
| 136 | 3300005327 | Ga0070658_10018856 | Ga0070658_100188564 | 342 |
| 137 | 3300005337 | Ga0070682_100031621 | Ga0070682_1000316212 | 342 |
| 138 | 3300005455 | Ga0070663_100003069 | Ga0070663_1000030694 | 342 |
| 139 | 3300005616 | Ga0068852_100130956 | Ga0068852_1001309562 | 342 |
| 140 | 3300025909 | Ga0207705_10029754 | Ga0207705_100297542 | 342 |
| 141 | 3300026067 | Ga0207678_10014230 | Ga0207678_100142305 | 342 |
| 142 | 3300046642 | Ga0495634_0020002 | Ga0495634_0020002_123_1295 | 342 |
| 143 | 3300046690 | Ga0495624_0062665 | Ga0495624_0062665_1113_2285 | 342 |
| 144 | 3300047317 | Ga0495604_0053329 | Ga0495604_0053329_436_1608 | 342 |
| 145 | 3300047471 | Ga0495684_0003077 | Ga0495684_0003077_4370_5542 | 342 |
| 146 | 3300048924 | Ga0496121_0077900 | Ga0496121_0077900_405_1580 | 342 |
| 147 | 3300048924 | Ga0496121_0104972 | Ga0496121_0104972_495_1640 | 342 |
| 148 | 3300050492 | nmdc:mga0yw44_125676_c1 | nmdc:mga0yw44_125676_c1_418_1590 | 342 |
| 149 | 3300053731 | Ga0500609_000642 | Ga0500609_000642_2555_3727 | 342 |
| 150 | 3300006847 | Ga0075431_100145708 | Ga0075431_1001457082 | 343 |
| 151 | 3300009094 | Ga0111539_10300573 | Ga0111539_103005732 | 343 |
| 152 | 3300021441 | Ga0213871_10005103 | Ga0213871_100051032 | 343 |
| 153 | 3300035086 | Ga0373934_0015153 | Ga0373934_0015153_495_1664 | 343 |
| 154 | 3300035118 | Ga0373954_0001354 | Ga0373954_0001354_2804_3973 | 343 |
| 155 | 3300035119 | Ga0373956_0006917 | Ga0373956_0006917_1378_2547 | 343 |
| 156 | 3300035172 | Ga0373955_0001045 | Ga0373955_0001045_7437_8606 | 343 |
| 157 | 3300035410 | Ga0373924_0003482 | Ga0373924_0003482_1116_2285 | 343 |
| 158 | 3300035724 | Ga0373933_0001089 | Ga0373933_0001089_1356_2525 | 343 |
| 159 | 3300036401 | Ga0373937_0006280 | Ga0373937_0006280_2084_3253 | 343 |
| 160 | 3300039447 | Ga0436361_0961182 | Ga0436361_0961182_1034_2341 | 343 |
| 161 | 3300046454 | Ga0495592_0008630 | Ga0495592_0008630_1198_2367 | 343 |
| 162 | 3300046459 | Ga0495629_0008997 | Ga0495629_0008997_2135_3304 | 343 |
| 163 | 3300046462 | Ga0495651_0033585 | Ga0495651_0033585_698_1867 | 343 |
| 164 | 3300046463 | Ga0495653_0013015 | Ga0495653_0013015_2158_3327 | 343 |
| 165 | 3300046511 | Ga0495608_0002629 | Ga0495608_0002629_7560_8729 | 343 |
| 166 | 3300046516 | Ga0495628_0057941 | Ga0495628_0057941_809_1978 | 343 |
| 167 | 3300046533 | Ga0495640_0015625 | Ga0495640_0015625_983_2152 | 343 |
| 168 | 3300046536 | Ga0495587_0036423 | Ga0495587_0036423_1615_2784 | 343 |
| 169 | 3300046543 | Ga0495645_0002685 | Ga0495645_0002685_5844_7013 | 343 |
| 170 | 3300046559 | Ga0495667_0013388 | Ga0495667_0013388_1059_2228 | 343 |
| 171 | 3300046642 | Ga0495634_0010658 | Ga0495634_0010658_1508_2677 | 343 |
| 172 | 3300046663 | Ga0495635_0002628 | Ga0495635_0002628_6249_7418 | 343 |
| 173 | 3300046675 | Ga0495657_0038615 | Ga0495657_0038615_1418_2587 | 343 |
| 174 | 3300046678 | Ga0495599_0001303 | Ga0495599_0001303_11902_13071 | 343 |
| 175 | 3300046680 | Ga0495646_0015281 | Ga0495646_0015281_1615_2784 | 343 |
| 176 | 3300046809 | Ga0495600_0004004 | Ga0495600_0004004_6363_7532 | 343 |
| 177 | 3300047317 | Ga0495604_0029571 | Ga0495604_0029571_1772_2941 | 343 |
| 178 | 3300047322 | Ga0495680_0002436 | Ga0495680_0002436_698_1867 | 343 |
| 179 | 3300047444 | Ga0495675_0055280 | Ga0495675_0055280_698_1867 | 343 |
| 180 | 3300047471 | Ga0495684_0003990 | Ga0495684_0003990_8728_9897 | 343 |
| 181 | 3300047673 | Ga0495593_0002110 | Ga0495593_0002110_3544_4713 | 343 |
| 182 | 3300048924 | Ga0496121_0000178 | Ga0496121_0000178_91974_93152 | 343 |
| 183 | 3300050510 | nmdc:mga06r32_237637_c1 | nmdc:mga06r32_237637_c1_44_1228 | 343 |
| 184 | 3300050511 | nmdc:mga08y16_45923_c1 | nmdc:mga08y16_45923_c1_480_1664 | 343 |
| 185 | 3300053077 | Ga0495601_0015061 | Ga0495601_0015061_1128_2297 | 343 |
| 186 | 3300053084 | Ga0495595_0000180 | Ga0495595_0000180_18017_19186 | 343 |
| 187 | 3300053085 | Ga0495619_0023652 | Ga0495619_0023652_1394_2563 | 343 |
| 188 | 3300053737 | Ga0500601_000149 | Ga0500601_000149_8906_10078 | 343 |
| 189 | 3300003354 | JGI25160J50197_1001806 | JGI25160J50197_10018063 | 344 |
| 190 | 3300005262 | Ga0065165_1006645 | Ga0065165_10066452 | 344 |
| 191 | 3300025230 | Ga0209563_101772 | Ga0209563_1017722 | 344 |
| 192 | 3300025253 | Ga0209677_101975 | Ga0209677_10197510 | 344 |
| 193 | 3300025297 | Ga0209758_1008134 | Ga0209758_10081345 | 344 |
| 194 | 3300025302 | Ga0207426_1002648 | Ga0207426_100264811 | 344 |
| 195 | 3300005937 | Ga0081455_10043485 | Ga0081455_100434852 | 345 |
| 196 | 3300005262 | Ga0065165_1000342 | Ga0065165_100034243 | 346 |
| 197 | 3300053178 | Ga0500637_0022250 | Ga0500637_0022250_1823_2995 | 346 |
| 198 | 3300025919 | Ga0207657_10210886 | Ga0207657_102108862 | 347 |
| 199 | 3300028573 | Ga0265334_10011662 | Ga0265334_100116622 | 347 |
| 200 | 3300047472 | Ga0495686_0090192 | Ga0495686_0090192_287_1471 | 347 |
| 201 | 3300005293 | Ga0065715_10001703 | Ga0065715_100017033 | 348 |
| 202 | 3300005548 | Ga0070665_100182195 | Ga0070665_1001821952 | 348 |
| 203 | 3300005518 | Ga0070699_100182703 | Ga0070699_1001827032 | 349 |
| 204 | 3300005937 | Ga0081455_10074473 | Ga0081455_100744732 | 349 |
| 205 | 3300006871 | Ga0075434_100013294 | Ga0075434_1000132946 | 349 |
| 206 | 3300009177 | Ga0105248_10311580 | Ga0105248_103115802 | 349 |
| 207 | 3300050512 | nmdc:mga0n895_10230_c1 | nmdc:mga0n895_10230_c1_979_2154 | 349 |
| 208 | 3300003659 | JGI25404J52841_10000205 | JGI25404J52841_100002053 | 350 |
| 209 | 3300005439 | Ga0070711_100038316 | Ga0070711_1000383164 | 350 |
| 210 | 3300005983 | Ga0081540_1000002 | Ga0081540_100000251 | 350 |
| 211 | 3300006175 | Ga0070712_100010060 | Ga0070712_1000100607 | 350 |
| 212 | 3300006844 | Ga0075428_100064532 | Ga0075428_1000645322 | 350 |
| 213 | 3300006846 | Ga0075430_100011000 | Ga0075430_10001100011 | 350 |
| 214 | 3300006847 | Ga0075431_100085094 | Ga0075431_1000850942 | 350 |
| 215 | 3300006852 | Ga0075433_10001538 | Ga0075433_100015387 | 350 |
| 216 | 3300006880 | Ga0075429_100010965 | Ga0075429_1000109652 | 350 |
| 217 | 3300009094 | Ga0111539_10278953 | Ga0111539_102789532 | 350 |
| 218 | 3300009147 | Ga0114129_10257021 | Ga0114129_102570212 | 350 |
| 219 | 3300025906 | Ga0207699_10006269 | Ga0207699_100062693 | 350 |
| 220 | 3300025915 | Ga0207693_10003198 | Ga0207693_100031989 | 350 |
| 221 | 3300025916 | Ga0207663_10026736 | Ga0207663_100267364 | 350 |
| 222 | 3300027907 | Ga0207428_10002129 | Ga0207428_100021299 | 350 |
| 223 | 3300050508 | nmdc:mga09592_15829_c1 | nmdc:mga09592_15829_c1_214_1386 | 350 |
| 224 | 3300050509 | nmdc:mga0qj67_1410_c1 | nmdc:mga0qj67_1410_c1_2062_3234 | 350 |
| 225 | 3300050510 | nmdc:mga06r32_27771_c1 | nmdc:mga06r32_27771_c1_2098_3270 | 350 |
| 226 | 3300050512 | nmdc:mga0n895_607_c1 | nmdc:mga0n895_607_c1_4199_5371 | 350 |
| 227 | 3300050513 | nmdc:mga0rr50_18914_c1 | nmdc:mga0rr50_18914_c1_1706_2878 | 350 |
| 228 | 3300050515 | nmdc:mga0a205_699_c1 | nmdc:mga0a205_699_c1_6752_7924 | 350 |
| 229 | 3300005334 | Ga0068869_100042182 | Ga0068869_1000421822 | 351 |
| 230 | 3300005340 | Ga0070689_100070251 | Ga0070689_1000702512 | 351 |
| 231 | 3300005434 | Ga0070709_10033314 | Ga0070709_100333141 | 351 |
| 232 | 3300005435 | Ga0070714_100033979 | Ga0070714_1000339792 | 351 |
| 233 | 3300005983 | Ga0081540_1001470 | Ga0081540_100147021 | 351 |
| 234 | 3300006028 | Ga0070717_10024876 | Ga0070717_100248762 | 351 |
| 235 | 3300006173 | Ga0070716_100059836 | Ga0070716_1000598362 | 351 |
| 236 | 3300006177 | Ga0075362_10087247 | Ga0075362_100872472 | 351 |
| 237 | 3300009147 | Ga0114129_10167269 | Ga0114129_101672692 | 351 |
| 238 | 3300025916 | Ga0207663_10011977 | Ga0207663_100119772 | 351 |
| 239 | 3300025929 | Ga0207664_10007583 | Ga0207664_100075832 | 351 |
| 240 | 3300025936 | Ga0207670_10105169 | Ga0207670_101051692 | 351 |
| 241 | 3300025939 | Ga0207665_10000779 | Ga0207665_1000077914 | 351 |
| 242 | 3300032005 | Ga0307411_10092584 | Ga0307411_100925842 | 351 |
| 243 | 3300046518 | Ga0495631_0050058 | Ga0495631_0050058_172_1347 | 351 |
| 244 | 3300048088 | Ga0495602_0099140 | Ga0495602_0099140_722_1900 | 351 |
| 245 | 3300050489 | nmdc:mga03683_32382_c1 | nmdc:mga03683_32382_c1_54_1202 | 351 |
| 246 | 3300053119 | Ga0500595_002504 | Ga0500595_002504_2611_3786 | 351 |
| 247 | 3300053162 | Ga0500638_088424 | Ga0500638_088424_241_1416 | 351 |
| 248 | 3300003215 | JGI25153J46596_10001586 | JGI25153J46596_100015861 | 352 |
| 249 | 3300003215 | JGI25153J46596_10001963 | JGI25153J46596_100019639 | 352 |
| 250 | 3300003354 | JGI25160J50197_1000413 | JGI25160J50197_10004132 | 352 |
| 251 | 3300005364 | Ga0070673_100373731 | Ga0070673_1003737311 | 352 |
| 252 | 3300005548 | Ga0070665_100006487 | Ga0070665_10000648712 | 352 |
| 253 | 3300005618 | Ga0068864_100190673 | Ga0068864_1001906732 | 352 |
| 254 | 3300005937 | Ga0081455_10010592 | Ga0081455_100105928 | 352 |
| 255 | 3300006353 | Ga0075370_10026246 | Ga0075370_100262464 | 352 |
| 256 | 3300025261 | Ga0209233_1002127 | Ga0209233_10021274 | 352 |
| 257 | 3300025295 | Ga0209564_1003588 | Ga0209564_10035885 | 352 |
| 258 | 3300025297 | Ga0209758_1006334 | Ga0209758_10063343 | 352 |
| 259 | 3300025297 | Ga0209758_1007918 | Ga0209758_10079189 | 352 |
| 260 | 3300025297 | Ga0209758_1029049 | Ga0209758_10290493 | 352 |
| 261 | 3300025299 | Ga0209256_1021882 | Ga0209256_10218822 | 352 |
| 262 | 3300025302 | Ga0207426_1000237 | Ga0207426_100023735 | 352 |
| 263 | 3300025907 | Ga0207645_10151084 | Ga0207645_101510842 | 352 |
| 264 | 3300028379 | Ga0268266_10005075 | Ga0268266_1000507514 | 352 |
| 265 | 3300031995 | Ga0307409_100033655 | Ga0307409_1000336552 | 352 |
| 266 | 3300033180 | Ga0307510_10014098 | Ga0307510_100140985 | 352 |
| 267 | 3300046660 | Ga0495625_0074786 | Ga0495625_0074786_355_1527 | 352 |
| 268 | 3300048915 | Ga0496112_0097976 | Ga0496112_0097976_360_1532 | 352 |
| 269 | 3300048916 | Ga0496113_0085819 | Ga0496113_0085819_618_1790 | 352 |
| 270 | 3300048924 | Ga0496121_0001346 | Ga0496121_0001346_19636_20811 | 352 |
| 271 | 3300048924 | Ga0496121_0104292 | Ga0496121_0104292_303_1475 | 352 |
| 272 | 3300053087 | Ga0500643_000097 | Ga0500643_000097_45750_46922 | 352 |
| 273 | 3300053103 | Ga0500555_003423 | Ga0500555_003423_831_2003 | 352 |
| 274 | 3300053104 | Ga0500556_0001943 | Ga0500556_0001943_3501_4673 | 352 |
| 275 | 3300053151 | Ga0500604_0018905 | Ga0500604_0018905_726_1898 | 352 |
| 276 | 3300053156 | Ga0500622_0047979 | Ga0500622_0047979_666_1838 | 352 |
| 277 | 3300006038 | Ga0075365_10038349 | Ga0075365_100383492 | 353 |
| 278 | 3300006177 | Ga0075362_10001097 | Ga0075362_100010976 | 353 |
| 279 | 3300006178 | Ga0075367_10001959 | Ga0075367_100019596 | 353 |
| 280 | 3300006353 | Ga0075370_10007764 | Ga0075370_100077642 | 353 |
| 281 | 3300006844 | Ga0075428_100072013 | Ga0075428_1000720132 | 353 |
| 282 | 3300006846 | Ga0075430_100040472 | Ga0075430_1000404722 | 353 |
| 283 | 3300006847 | Ga0075431_100064670 | Ga0075431_1000646702 | 353 |
| 284 | 3300006880 | Ga0075429_100046476 | Ga0075429_1000464762 | 353 |
| 285 | 3300009094 | Ga0111539_10073473 | Ga0111539_100734732 | 353 |
| 286 | 3300009147 | Ga0114129_10200337 | Ga0114129_102003372 | 353 |
| 287 | 3300025297 | Ga0209758_1003797 | Ga0209758_10037976 | 353 |
| 288 | 3300027907 | Ga0207428_10011549 | Ga0207428_100115492 | 353 |
| 289 | 3300031507 | Ga0307509_10174701 | Ga0307509_101747012 | 353 |
| 290 | 3300045049 | Ga0466959_0083273 | Ga0466959_0083273_1017_2246 | 353 |
| 291 | 3300050489 | nmdc:mga03683_672_c1 | nmdc:mga03683_672_c1_1920_3218 | 353 |
| 292 | 3300050494 | nmdc:mga06z11_5543_c1 | nmdc:mga06z11_5543_c1_1919_3217 | 353 |
| 293 | 3300050496 | nmdc:mga07m45_8693_c1 | nmdc:mga07m45_8693_c1_3697_4995 | 353 |
| 294 | 3300050507 | nmdc:mga05p37_12561_c1 | nmdc:mga05p37_12561_c1_6802_7974 | 353 |
| 295 | 3300050508 | nmdc:mga09592_2214_c1 | nmdc:mga09592_2214_c1_14266_15438 | 353 |
| 296 | 3300050509 | nmdc:mga0qj67_7961_c1 | nmdc:mga0qj67_7961_c1_2138_3310 | 353 |
| 297 | 3300050510 | nmdc:mga06r32_9691_c1 | nmdc:mga06r32_9691_c1_2098_3270 | 353 |
| 298 | 3300050511 | nmdc:mga08y16_16366_c1 | nmdc:mga08y16_16366_c1_6458_7630 | 353 |
| 299 | 3300050516 | nmdc:mga0sz30_15_c1 | nmdc:mga0sz30_15_c1_1175_2473 | 353 |
| 300 | 3300053080 | Ga0500635_0014361 | Ga0500635_0014361_955_2127 | 353 |
| 301 | 3300053122 | Ga0500608_081297 | Ga0500608_081297_148_1320 | 353 |
| 302 | 3300053155 | Ga0500620_003225 | Ga0500620_003225_2005_3177 | 353 |
| 303 | 3300053177 | Ga0500636_0000420 | Ga0500636_0000420_1395_2567 | 353 |
| 304 | 3300021384 | Ga0213876_10035942 | Ga0213876_100359423 | 354 |
| 305 | 3300025915 | Ga0207693_10030609 | Ga0207693_100306092 | 354 |
| 306 | 3300039437 | Ga0436365_0999537 | Ga0436365_0999537_3042_4214 | 354 |
| 307 | 3300046463 | Ga0495653_0077153 | Ga0495653_0077153_848_2020 | 354 |
| 308 | 3300046476 | Ga0495662_0008323 | Ga0495662_0008323_1286_2458 | 354 |
| 309 | 3300046477 | Ga0495664_0011428 | Ga0495664_0011428_3185_4357 | 354 |
| 310 | 3300053077 | Ga0495601_0077875 | Ga0495601_0077875_246_1418 | 354 |
| 311 | 3300053119 | Ga0500595_014813 | Ga0500595_014813_877_2046 | 354 |
| 312 | 3300007265 | Ga0099794_10016490 | Ga0099794_100164902 | 355 |
| 313 | 3300046517 | Ga0495630_0057520 | Ga0495630_0057520_755_1927 | 355 |
| 314 | 3300003215 | JGI25153J46596_10000912 | JGI25153J46596_1000091215 | 356 |
| 315 | 3300005983 | Ga0081540_1000021 | Ga0081540_10000212 | 356 |
| 316 | 3300006038 | Ga0075365_10122771 | Ga0075365_101227712 | 356 |
| 317 | 3300025297 | Ga0209758_1000139 | Ga0209758_1000139167 | 356 |
| 318 | 3300050492 | nmdc:mga0yw44_104964_c1 | nmdc:mga0yw44_104964_c1_137_1321 | 356 |
| 319 | 3300046459 | Ga0495629_0058992 | Ga0495629_0058992_516_1688 | 357 |
| 320 | iso_pu_bacteria | 8019629233 | 8019638482 | 357 |
| 321 | 3300003659 | JGI25404J52841_10013508 | JGI25404J52841_100135082 | 358 |
| 322 | 3300005983 | Ga0081540_1006015 | Ga0081540_10060157 | 358 |
| 323 | 3300009545 | Ga0105237_10248843 | Ga0105237_102488432 | 358 |
| 324 | 3300031507 | Ga0307509_10152254 | Ga0307509_101522542 | 358 |
| 325 | 3300033180 | Ga0307510_10061641 | Ga0307510_100616413 | 358 |
| 326 | 3300048918 | Ga0496115_0075330 | Ga0496115_0075330_878_2185 | 358 |
| 327 | 3300048920 | Ga0496117_0055679 | Ga0496117_0055679_710_1885 | 358 |
| 328 | 3300050496 | nmdc:mga07m45_38426_c1 | nmdc:mga07m45_38426_c1_269_1444 | 358 |
| 329 | 3300005289 | Ga0065704_10140706 | Ga0065704_101407062 | 359 |
| 330 | 3300005347 | Ga0070668_100053069 | Ga0070668_1000530692 | 359 |
| 331 | 3300005354 | Ga0070675_100307231 | Ga0070675_1003072311 | 359 |
| 332 | 3300005367 | Ga0070667_100351286 | Ga0070667_1003512861 | 359 |
| 333 | 3300005471 | Ga0070698_100094727 | Ga0070698_1000947272 | 359 |
| 334 | 3300005518 | Ga0070699_100011652 | Ga0070699_1000116528 | 359 |
| 335 | 3300005539 | Ga0068853_100215198 | Ga0068853_1002151981 | 359 |
| 336 | 3300005546 | Ga0070696_100025911 | Ga0070696_1000259112 | 359 |
| 337 | 3300009101 | Ga0105247_10047000 | Ga0105247_100470001 | 359 |
| 338 | 3300013296 | Ga0157374_10251751 | Ga0157374_102517511 | 359 |
| 339 | 3300025904 | Ga0207647_10057719 | Ga0207647_100577192 | 359 |
| 340 | 3300025910 | Ga0207684_10182359 | Ga0207684_101823592 | 359 |
| 341 | 3300025972 | Ga0207668_10017270 | Ga0207668_100172702 | 359 |
| 342 | 3300025972 | Ga0207668_10038101 | Ga0207668_100381012 | 359 |
| 343 | 3300028379 | Ga0268266_10050761 | Ga0268266_100507612 | 359 |
| 344 | 3300028381 | Ga0268264_10156706 | Ga0268264_101567062 | 359 |
| 345 | 3300046520 | Ga0495637_0077350 | Ga0495637_0077350_13_1188 | 359 |
| 346 | 3300046615 | Ga0495656_0047775 | Ga0495656_0047775_156_1334 | 359 |
| 347 | 3300048913 | Ga0496110_0282219 | Ga0496110_0282219_257_1435 | 359 |
| 348 | 3300005457 | Ga0070662_100029456 | Ga0070662_1000294563 | 360 |
| 349 | 3300005471 | Ga0070698_100000373 | Ga0070698_10000037321 | 360 |
| 350 | 3300013306 | Ga0163162_10151128 | Ga0163162_101511283 | 360 |
| 351 | 3300025961 | Ga0207712_10017511 | Ga0207712_100175112 | 360 |
| 352 | 3300028380 | Ga0268265_10016290 | Ga0268265_100162903 | 360 |
| 353 | 3300046455 | Ga0495603_0021639 | Ga0495603_0021639_2000_3178 | 360 |
| 354 | 3300046557 | Ga0495622_0038526 | Ga0495622_0038526_361_1539 | 360 |
| 355 | 3300048905 | Ga0496102_0098305 | Ga0496102_0098305_1456_2634 | 360 |
| 356 | 3300050491 | nmdc:mga00v17_86617_c1 | nmdc:mga00v17_86617_c1_210_1388 | 360 |
| 357 | 3300005536 | Ga0070697_100154624 | Ga0070697_1001546242 | 361 |
| 358 | 3300010159 | Ga0099796_10019757 | Ga0099796_100197572 | 361 |
| 359 | 3300025928 | Ga0207700_10065195 | Ga0207700_100651953 | 361 |
| 360 | 3300046616 | Ga0495668_0034892 | Ga0495668_0034892_1047_2225 | 361 |
| 361 | 3300006028 | Ga0070717_10165456 | Ga0070717_101654561 | 362 |
| 362 | 3300005844 | Ga0068862_100149351 | Ga0068862_1001493512 | 363 |
| 363 | 3300006914 | Ga0075436_100000863 | Ga0075436_1000008634 | 363 |
| 364 | 3300007076 | Ga0075435_100103087 | Ga0075435_1001030873 | 363 |
| 365 | 3300026075 | Ga0207708_10061683 | Ga0207708_100616831 | 363 |
| 366 | 3300037068 | Ga0373925_0189165 | Ga0373925_0189165_228_1400 | 363 |
| 367 | 3300048915 | Ga0496112_0168225 | Ga0496112_0168225_225_1403 | 363 |
| 368 | 3300053096 | Ga0500641_0027513 | Ga0500641_0027513_355_1533 | 364 |
| 369 | 3300005436 | Ga0070713_100175591 | Ga0070713_1001755911 | 365 |
| 370 | 3300006028 | Ga0070717_10198724 | Ga0070717_101987242 | 365 |
| 371 | 3300006173 | Ga0070716_100126585 | Ga0070716_1001265851 | 365 |
| 372 | 3300006175 | Ga0070712_100056649 | Ga0070712_1000566492 | 365 |
| 373 | 3300013308 | Ga0157375_10356457 | Ga0157375_103564572 | 365 |
| 374 | 3300025906 | Ga0207699_10057284 | Ga0207699_100572842 | 365 |
| 375 | 3300025928 | Ga0207700_10043818 | Ga0207700_100438184 | 365 |
| 376 | 3300025939 | Ga0207665_10018743 | Ga0207665_100187433 | 365 |
| 377 | 3300025940 | Ga0207691_10241364 | Ga0207691_102413642 | 365 |
| 378 | 3300046474 | Ga0495605_0023824 | Ga0495605_0023824_587_1765 | 365 |
| 379 | 3300046492 | Ga0495585_0021409 | Ga0495585_0021409_621_1799 | 365 |
| 380 | 3300046519 | Ga0495632_0042259 | Ga0495632_0042259_331_1509 | 365 |
| 381 | 3300046520 | Ga0495637_0046525 | Ga0495637_0046525_237_1415 | 365 |
| 382 | 3300046539 | Ga0495621_0003718 | Ga0495621_0003718_11_1189 | 365 |
| 383 | 3300046648 | Ga0495611_0006627 | Ga0495611_0006627_3545_4723 | 365 |
| 384 | 3300046664 | Ga0495659_0037244 | Ga0495659_0037244_298_1476 | 365 |
| 385 | 3300046684 | Ga0495669_0004419 | Ga0495669_0004419_4447_5625 | 365 |
| 386 | 3300046692 | Ga0495671_0130530 | Ga0495671_0130530_11_1189 | 365 |
| 387 | 3300050512 | nmdc:mga0n895_107985_c1 | nmdc:mga0n895_107985_c1_483_1658 | 365 |
| 388 | 3300009553 | Ga0105249_10457758 | Ga0105249_104577581 | 366 |
| 389 | 3300025931 | Ga0207644_10145448 | Ga0207644_101454482 | 366 |
| 390 | 3300031090 | Ga0265760_10022120 | Ga0265760_100221202 | 366 |
| 391 | 3300046664 | Ga0495659_0041900 | Ga0495659_0041900_278_1462 | 366 |
| 392 | 3300047321 | Ga0495676_0106458 | Ga0495676_0106458_876_2048 | 366 |
| 393 | 3300048929 | Ga0496126_0045621 | Ga0496126_0045621_423_1607 | 366 |
| 394 | 3300005441 | Ga0070700_100047395 | Ga0070700_1000473952 | 367 |
| 395 | 3300005467 | Ga0070706_100093913 | Ga0070706_1000939132 | 367 |
| 396 | 3300006038 | Ga0075365_10005374 | Ga0075365_100053745 | 367 |
| 397 | 3300006051 | Ga0075364_10067396 | Ga0075364_100673962 | 367 |
| 398 | 3300006844 | Ga0075428_100064438 | Ga0075428_1000644382 | 367 |
| 399 | 3300009147 | Ga0114129_10045330 | Ga0114129_100453302 | 367 |
| 400 | 3300013308 | Ga0157375_10377689 | Ga0157375_103776891 | 367 |
| 401 | 3300026088 | Ga0207641_10051008 | Ga0207641_100510083 | 367 |
| 402 | 3300026118 | Ga0207675_100094094 | Ga0207675_1000940942 | 367 |
| 403 | 3300046524 | Ga0495648_0002795 | Ga0495648_0002795_764_1948 | 367 |
| 404 | 3300046663 | Ga0495635_0108406 | Ga0495635_0108406_697_1869 | 367 |
| 405 | 3300046691 | Ga0495670_0141359 | Ga0495670_0141359_75_1247 | 367 |
| 406 | 3300003215 | JGI25153J46596_10000288 | JGI25153J46596_100002882 | 368 |
| 407 | 3300003215 | JGI25153J46596_10001506 | JGI25153J46596_100015069 | 368 |
| 408 | 3300003659 | JGI25404J52841_10010408 | JGI25404J52841_100104082 | 368 |
| 409 | 3300005937 | Ga0081455_10000165 | Ga0081455_1000016534 | 368 |
| 410 | 3300005983 | Ga0081540_1003472 | Ga0081540_10034724 | 368 |
| 411 | 3300025297 | Ga0209758_1000209 | Ga0209758_100020965 | 368 |
| 412 | 3300039438 | Ga0436360_0435591 | Ga0436360_0435591_921_2120 | 368 |
| 413 | 3300005518 | Ga0070699_100018770 | Ga0070699_1000187706 | 369 |
| 414 | 3300005518 | Ga0070699_100389103 | Ga0070699_1003891031 | 369 |
| 415 | 3300005536 | Ga0070697_100069049 | Ga0070697_1000690492 | 369 |
| 416 | 3300005983 | Ga0081540_1003224 | Ga0081540_10032242 | 369 |
| 417 | 3300007265 | Ga0099794_10010403 | Ga0099794_100104032 | 369 |
| 418 | 3300025910 | Ga0207684_10105805 | Ga0207684_101058052 | 369 |
| 419 | 3300039447 | Ga0436361_0426039 | Ga0436361_0426039_183_1367 | 369 |
| 420 | 3300053730 | Ga0500645_030151 | Ga0500645_030151_66_1250 | 369 |
| 421 | 3300006038 | Ga0075365_10002250 | Ga0075365_100022506 | 370 |
| 422 | 3300006178 | Ga0075367_10001540 | Ga0075367_100015407 | 370 |
| 423 | 3300006186 | Ga0075369_10000106 | Ga0075369_1000010622 | 370 |
| 424 | 3300006195 | Ga0075366_10004804 | Ga0075366_100048046 | 370 |
| 425 | 3300006353 | Ga0075370_10003315 | Ga0075370_100033155 | 370 |
| 426 | 3300010159 | Ga0099796_10005417 | Ga0099796_100054172 | 370 |
| 427 | 3300027512 | Ga0209179_1000450 | Ga0209179_10004503 | 370 |
| 428 | 3300048924 | Ga0496121_0000868 | Ga0496121_0000868_32948_34102 | 370 |
| 429 | 3300050490 | nmdc:mga03n38_3844_c1 | nmdc:mga03n38_3844_c1_1543_2727 | 370 |
| 430 | 3300050491 | nmdc:mga00v17_27330_c1 | nmdc:mga00v17_27330_c1_369_1553 | 370 |
| 431 | 3300050492 | nmdc:mga0yw44_405_c1 | nmdc:mga0yw44_405_c1_10377_11561 | 370 |
| 432 | 3300050493 | nmdc:mga0k408_1338_c1 | nmdc:mga0k408_1338_c1_24_1208 | 370 |
| 433 | 3300050494 | nmdc:mga06z11_38_c1 | nmdc:mga06z11_38_c1_4128_5312 | 370 |
| 434 | 3300050496 | nmdc:mga07m45_106_c1 | nmdc:mga07m45_106_c1_19204_20388 | 370 |
| 435 | 3300050516 | nmdc:mga0sz30_906_c1 | nmdc:mga0sz30_906_c1_4695_5879 | 370 |
| 436 | iso_pu_bacteria | 3005710791 | 3005712189 | 370 |
| 437 | 3300046524 | Ga0495648_0008057 | Ga0495648_0008057_3376_4560 | 371 |
| 438 | 3300048925 | Ga0496122_0043294 | Ga0496122_0043294_503_1687 | 371 |
| 439 | 3300048929 | Ga0496126_0002980 | Ga0496126_0002980_17972_19156 | 371 |
| 440 | iso_pu_bacteria | 2508501128 | 2509153951 | 371 |
| 441 | iso_pu_bacteria | 2876771140 | 2876771849 | 371 |
| 442 | iso_pu_bacteria | 2876818435 | 2876826547 | 371 |
| 443 | iso_pu_bacteria | 2879074833 | 2879075701 | 371 |
| 444 | iso_pu_bacteria | 2879142872 | 2879150421 | 371 |
| 445 | iso_pu_bacteria | 2889033259 | 2889037681 | 371 |
| 446 | iso_pu_bacteria | 2906626472 | 2906629563 | 371 |
| 447 | iso_pu_bacteria | 2935732158 | 2935733617 | 371 |
| 448 | iso_pu_bacteria | 2935741537 | 2935742996 | 371 |
| 449 | iso_pu_bacteria | 2935769743 | 2935773849 | 371 |
| 450 | iso_pu_bacteria | 2935785616 | 2935788715 | 371 |
| 451 | iso_pu_bacteria | 2935793552 | 2935795659 | 371 |
| 452 | iso_pu_bacteria | 2941531003 | 2941537440 | 371 |
| 453 | iso_pu_bacteria | 8016583857 | 8016588291 | 371 |
| 454 | iso_pu_bacteria | 8016622563 | 8016624867 | 371 |
| 455 | iso_pu_bacteria | 8019547302 | 8019551909 | 371 |
| 456 | iso_pu_bacteria | 8019638758 | 8019639803 | 371 |
| 457 | iso_pu_bacteria | 8019659431 | 8019667816 | 371 |
| 458 | iso_pu_bacteria | 2643221595 | 2643983712 | 372 |
| 459 | iso_pu_bacteria | 2643221627 | 2644157395 | 372 |
| 460 | iso_pu_bacteria | 2791355123 | 2792750404 | 372 |
| 461 | iso_pu_bacteria | 2869162929 | 2869168125 | 372 |
| 462 | iso_pu_bacteria | 2958064165 | 2958065407 | 372 |
| 463 | 3300005536 | Ga0070697_100013409 | Ga0070697_1000134092 | 373 |
| 464 | 3300005549 | Ga0070704_100020603 | Ga0070704_1000206032 | 373 |
| 465 | 3300010159 | Ga0099796_10032891 | Ga0099796_100328912 | 373 |
| 466 | 3300025922 | Ga0207646_10225703 | Ga0207646_102257031 | 373 |
| 467 | 3300039447 | Ga0436361_0714685 | Ga0436361_0714685_3487_4671 | 373 |
| 468 | 3300048907 | Ga0496104_0059661 | Ga0496104_0059661_1887_3071 | 373 |
| 469 | 3300048911 | Ga0496108_0240300 | Ga0496108_0240300_228_1412 | 373 |
| 470 | 3300048913 | Ga0496110_0183101 | Ga0496110_0183101_112_1296 | 373 |
| 471 | 3300048914 | Ga0496111_0031450 | Ga0496111_0031450_1635_2819 | 373 |
| 472 | 3300048915 | Ga0496112_0219713 | Ga0496112_0219713_435_1619 | 373 |
| 473 | iso_pu_bacteria | 2508501042 | 2508693909 | 373 |
| 474 | iso_pu_bacteria | 2513237095 | 2513651984 | 373 |
| 475 | iso_pu_bacteria | 2513237101 | 2513693841 | 373 |
| 476 | iso_pu_bacteria | 2513237102 | 2513702779 | 373 |
| 477 | iso_pu_bacteria | 2517093001 | 2517101018 | 373 |
| 478 | iso_pu_bacteria | 2524023205 | 2524442555 | 373 |
| 479 | iso_pu_bacteria | 2721755755 | 2723843365 | 373 |
| 480 | iso_pu_bacteria | 2744054633 | 2745075520 | 373 |
| 481 | iso_pu_bacteria | 2791355199 | 2793077910 | 373 |
| 482 | iso_pu_bacteria | 2816332527 | 2818239168 | 373 |
| 483 | iso_pu_bacteria | 2824600985 | 2824604854 | 373 |
| 484 | iso_pu_bacteria | 2824609381 | 2824611394 | 373 |
| 485 | iso_pu_bacteria | 2824617872 | 2824620251 | 373 |
| 486 | iso_pu_bacteria | 2824626560 | 2824629516 | 373 |
| 487 | iso_pu_bacteria | 2824635225 | 2824635836 | 373 |
| 488 | iso_pu_bacteria | 2824644064 | 2824646138 | 373 |
| 489 | iso_pu_bacteria | 2824653114 | 2824656081 | 373 |
| 490 | iso_pu_bacteria | 2824661429 | 2824663183 | 373 |
| 491 | iso_pu_bacteria | 2824704595 | 2824707712 | 373 |
| 492 | iso_pu_bacteria | 2824714736 | 2824716664 | 373 |
| 493 | iso_pu_bacteria | 2824723954 | 2824726621 | 373 |
| 494 | iso_pu_bacteria | 2824753945 | 2824757901 | 373 |
| 495 | iso_pu_bacteria | 2824763712 | 2824766967 | 373 |
| 496 | iso_pu_bacteria | 2824773399 | 2824774638 | 373 |
| 497 | iso_pu_bacteria | 2841957949 | 2841961241 | 373 |
| 498 | iso_pu_bacteria | 2849076700 | 2849078859 | 373 |
| 499 | iso_pu_bacteria | 2857509624 | 2857512505 | 373 |
| 500 | iso_pu_bacteria | 2874604998 | 2874611723 | 373 |
| 501 | iso_pu_bacteria | 2874612657 | 2874617371 | 373 |
| 502 | iso_pu_bacteria | 2874628541 | 2874633799 | 373 |
| 503 | iso_pu_bacteria | 2876761206 | 2876764494 | 373 |
| 504 | iso_pu_bacteria | 2876808645 | 2876816600 | 373 |
| 505 | iso_pu_bacteria | 2879099564 | 2879104213 | 373 |
| 506 | iso_pu_bacteria | 2879110137 | 2879114964 | 373 |
| 507 | iso_pu_bacteria | 2881364244 | 2881368275 | 373 |
| 508 | iso_pu_bacteria | 2885366525 | 2885369745 | 373 |
| 509 | iso_pu_bacteria | 2888378607 | 2888379199 | 373 |
| 510 | iso_pu_bacteria | 2888388044 | 2888389491 | 373 |
| 511 | iso_pu_bacteria | 2904690495 | 2904697107 | 373 |
| 512 | iso_pu_bacteria | 2904711408 | 2904712495 | 373 |
| 513 | iso_pu_bacteria | 2908756301 | 2908762624 | 373 |
| 514 | iso_pu_bacteria | 2929615660 | 2929620790 | 373 |
| 515 | iso_pu_bacteria | 2929624759 | 2929626684 | 373 |
| 516 | iso_pu_bacteria | 2932784394 | 2932784450 | 373 |
| 517 | iso_pu_bacteria | 2932809354 | 2932809433 | 373 |
| 518 | iso_pu_bacteria | 2932818245 | 2932818824 | 373 |
| 519 | iso_pu_bacteria | 2932828146 | 2932828220 | 373 |
| 520 | iso_pu_bacteria | 2933577622 | 2933582705 | 373 |
| 521 | iso_pu_bacteria | 2935608549 | 2935610163 | 373 |
| 522 | iso_pu_bacteria | 2935616580 | 2935617194 | 373 |
| 523 | iso_pu_bacteria | 2935638405 | 2935639325 | 373 |
| 524 | iso_pu_bacteria | 2935648319 | 2935650307 | 373 |
| 525 | iso_pu_bacteria | 2935656913 | 2935658454 | 373 |
| 526 | iso_pu_bacteria | 2935665750 | 2935665824 | 373 |
| 527 | iso_pu_bacteria | 2935675223 | 2935675470 | 373 |
| 528 | iso_pu_bacteria | 2935684952 | 2935685519 | 373 |
| 529 | iso_pu_bacteria | 2935694250 | 2935698768 | 373 |
| 530 | iso_pu_bacteria | 2935703347 | 2935704332 | 373 |
| 531 | iso_pu_bacteria | 2935713505 | 2935714072 | 373 |
| 532 | iso_pu_bacteria | 2935722832 | 2935724691 | 373 |
| 533 | iso_pu_bacteria | 2935732158 | 2935732951 | 373 |
| 534 | iso_pu_bacteria | 2935741537 | 2935742330 | 373 |
| 535 | iso_pu_bacteria | 2935750917 | 2935751484 | 373 |
| 536 | iso_pu_bacteria | 2935760218 | 2935765744 | 373 |
| 537 | iso_pu_bacteria | 2935769743 | 2935776866 | 373 |
| 538 | iso_pu_bacteria | 2935777560 | 2935778342 | 373 |
| 539 | iso_pu_bacteria | 2935785616 | 2935792876 | 373 |
| 540 | iso_pu_bacteria | 2935793552 | 2935800982 | 373 |
| 541 | iso_pu_bacteria | 2935801545 | 2935802414 | 373 |
| 542 | iso_pu_bacteria | 2935810662 | 2935811238 | 373 |
| 543 | iso_pu_bacteria | 2935819856 | 2935823323 | 373 |
| 544 | iso_pu_bacteria | 2935827899 | 2935828820 | 373 |
| 545 | iso_pu_bacteria | 2935837841 | 2935840194 | 373 |
| 546 | iso_pu_bacteria | 2935855204 | 2935855819 | 373 |
| 547 | iso_pu_bacteria | 2935864058 | 2935866238 | 373 |
| 548 | iso_pu_bacteria | 2935873716 | 2935877436 | 373 |
| 549 | iso_pu_bacteria | 2935984226 | 2935986019 | 373 |
| 550 | iso_pu_bacteria | 2935992306 | 2935992381 | 373 |
| 551 | iso_pu_bacteria | 2936002035 | 2936002253 | 373 |
| 552 | iso_pu_bacteria | 2936011229 | 2936013134 | 373 |
| 553 | iso_pu_bacteria | 2936019824 | 2936021779 | 373 |
| 554 | iso_pu_bacteria | 2936028420 | 2936030427 | 373 |
| 555 | iso_pu_bacteria | 2936037263 | 2936037342 | 373 |
| 556 | iso_pu_bacteria | 2936046547 | 2936047973 | 373 |
| 557 | iso_pu_bacteria | 2936055302 | 2936057973 | 373 |
| 558 | iso_pu_bacteria | 2940556831 | 2940557714 | 373 |
| 559 | iso_pu_bacteria | 2941538514 | 2941540465 | 373 |
| 560 | iso_pu_bacteria | 8006964411 | 8006966741 | 373 |
| 561 | iso_pu_bacteria | 8006994254 | 8006994738 | 373 |
| 562 | iso_pu_bacteria | 8016511872 | 8016521316 | 373 |
| 563 | iso_pu_bacteria | 8016522445 | 8016529822 | 373 |
| 564 | iso_pu_bacteria | 8016530956 | 8016535056 | 373 |
| 565 | iso_pu_bacteria | 8016539877 | 8016548262 | 373 |
| 566 | iso_pu_bacteria | 8016548790 | 8016553864 | 373 |
| 567 | iso_pu_bacteria | 8016566248 | 8016573398 | 373 |
| 568 | iso_pu_bacteria | 8016575299 | 8016577531 | 373 |
| 569 | iso_pu_bacteria | 8016595262 | 8016600054 | 373 |
| 570 | iso_pu_bacteria | 8016603502 | 8016610707 | 373 |
| 571 | iso_pu_bacteria | 8016613128 | 8016614223 | 373 |
| 572 | iso_pu_bacteria | 8016622563 | 8016626760 | 373 |
| 573 | iso_pu_bacteria | 8017057580 | 8017064305 | 373 |
| 574 | iso_pu_bacteria | 8019530166 | 8019534811 | 373 |
| 575 | iso_pu_bacteria | 8019538911 | 8019544664 | 373 |
| 576 | iso_pu_bacteria | 8019547302 | 8019553872 | 373 |
| 577 | iso_pu_bacteria | 8019586578 | 8019591464 | 373 |
| 578 | iso_pu_bacteria | 8019597564 | 8019599878 | 373 |
| 579 | iso_pu_bacteria | 8019608314 | 8019618670 | 373 |
| 580 | iso_pu_bacteria | 8055742211 | 8055745652 | 373 |
| 581 | iso_pu_bacteria | 8056673599 | 8056680793 | 373 |
| 582 | 3300005439 | Ga0070711_100074234 | Ga0070711_1000742343 | 374 |
| 583 | 3300048921 | Ga0496118_0015721 | Ga0496118_0015721_3890_5056 | 374 |
| 584 | 3300048924 | Ga0496121_0007484 | Ga0496121_0007484_767_1933 | 374 |
| 585 | iso_pu_bacteria | 2508501128 | 2509146952 | 374 |
| 586 | iso_pu_bacteria | 2508501128 | 2509148442 | 374 |
| 587 | iso_pu_bacteria | 2508501128 | 2509150864 | 374 |
| 588 | iso_pu_bacteria | 2513237094 | 2513642441 | 374 |
| 589 | iso_pu_bacteria | 2513237098 | 2513671552 | 374 |
| 590 | iso_pu_bacteria | 2524023210 | 2524464859 | 374 |
| 591 | iso_pu_bacteria | 2524023228 | 2524533864 | 374 |
| 592 | iso_pu_bacteria | 2881665667 | 2881672310 | 374 |
| 593 | iso_pu_bacteria | 2885383462 | 2885389665 | 374 |
| 594 | iso_pu_bacteria | 2903768456 | 2903773874 | 374 |
| 595 | iso_pu_bacteria | 2922386360 | 2922387800 | 374 |
| 596 | iso_pu_bacteria | 8006984368 | 8006993905 | 374 |
| 597 | iso_pu_bacteria | 8016630954 | 8016638444 | 374 |
| 598 | iso_pu_bacteria | 8056681323 | 8056683636 | 374 |
| 599 | 3300005437 | Ga0070710_10096668 | Ga0070710_100966682 | 375 |
| 600 | 3300006175 | Ga0070712_100009376 | Ga0070712_1000093762 | 375 |
| 601 | 3300025898 | Ga0207692_10078585 | Ga0207692_100785852 | 375 |
| 602 | 3300025915 | Ga0207693_10016822 | Ga0207693_100168223 | 375 |
| 603 | 3300025915 | Ga0207693_10121953 | Ga0207693_101219532 | 375 |
| 604 | 3300046460 | Ga0495638_0010632 | Ga0495638_0010632_4717_5892 | 375 |
| 605 | 3300053093 | Ga0500651_0000964 | Ga0500651_0000964_1654_2823 | 375 |
| 606 | 3300053119 | Ga0500595_004564 | Ga0500595_004564_282_1451 | 375 |
| 607 | iso_pu_bacteria | 2513237094 | 2513642489 | 375 |
| 608 | iso_pu_bacteria | 2513237098 | 2513677478 | 375 |
| 609 | iso_pu_bacteria | 2513237141 | 2513892949 | 375 |
| 610 | iso_pu_bacteria | 2524023210 | 2524466205 | 375 |
| 611 | iso_pu_bacteria | 2874628541 | 2874632527 | 375 |
| 612 | iso_pu_bacteria | 2885383462 | 2885384803 | 375 |
| 613 | iso_pu_bacteria | 2903768456 | 2903771331 | 375 |
| 614 | iso_pu_bacteria | 2906626472 | 2906627622 | 375 |
| 615 | iso_pu_bacteria | 2932801729 | 2932801850 | 375 |
| 616 | iso_pu_bacteria | 2932818245 | 2932826056 | 375 |
| 617 | iso_pu_bacteria | 2935630451 | 2935636355 | 375 |
| 618 | iso_pu_bacteria | 2935908558 | 2935916285 | 375 |
| 619 | iso_pu_bacteria | 2935916978 | 2935923566 | 375 |
| 620 | iso_pu_bacteria | 2935926038 | 2935933727 | 375 |
| 621 | iso_pu_bacteria | 2935934488 | 2935942211 | 375 |
| 622 | iso_pu_bacteria | 2935942939 | 2935950703 | 375 |
| 623 | iso_pu_bacteria | 2935951376 | 2935959118 | 375 |
| 624 | iso_pu_bacteria | 2935959822 | 2935961589 | 375 |
| 625 | iso_pu_bacteria | 2935967501 | 2935975220 | 375 |
| 626 | iso_pu_bacteria | 2941507105 | 2941512986 | 375 |
| 627 | iso_pu_bacteria | 2941515067 | 2941520712 | 375 |
| 628 | iso_pu_bacteria | 2941523033 | 2941528727 | 375 |
| 629 | iso_pu_bacteria | 8016630954 | 8016631130 | 375 |
| 630 | iso_pu_bacteria | 8019555841 | 8019559280 | 375 |
| 631 | iso_pu_bacteria | 8019565922 | 8019566018 | 375 |
| 632 | iso_pu_bacteria | 8019619141 | 8019625835 | 375 |
| 633 | iso_pu_bacteria | 8019687851 | 8019691573 | 375 |
| 634 | 3300005341 | Ga0070691_10018531 | Ga0070691_100185313 | 376 |
| 635 | 3300005439 | Ga0070711_100288852 | Ga0070711_1002888521 | 376 |
| 636 | 3300005444 | Ga0070694_100012064 | Ga0070694_1000120644 | 376 |
| 637 | 3300005548 | Ga0070665_100024100 | Ga0070665_1000241004 | 376 |
| 638 | 3300009098 | Ga0105245_10130209 | Ga0105245_101302092 | 376 |
| 639 | 3300035695 | Ga0373927_0017396 | Ga0373927_0017396_824_1996 | 376 |
| 640 | 3300037068 | Ga0373925_0097765 | Ga0373925_0097765_869_2041 | 376 |
| 641 | 3300046642 | Ga0495634_0181157 | Ga0495634_0181157_88_1260 | 376 |
| 642 | 3300047319 | Ga0495674_0120296 | Ga0495674_0120296_155_1327 | 376 |
| 643 | 3300047472 | Ga0495686_0120278 | Ga0495686_0120278_224_1402 | 376 |
| 644 | 3300053091 | Ga0500647_0026590 | Ga0500647_0026590_1389_2558 | 376 |
| 645 | 3300053094 | Ga0500566_0000009 | Ga0500566_0000009_84863_86032 | 376 |
| 646 | 3300053095 | Ga0500640_018844 | Ga0500640_018844_499_1668 | 376 |
| 647 | 3300053111 | Ga0500572_000142 | Ga0500572_000142_13417_14586 | 376 |
| 648 | 3300053122 | Ga0500608_005239 | Ga0500608_005239_2074_3243 | 376 |
| 649 | 3300053123 | Ga0500614_002205 | Ga0500614_002205_1421_2590 | 376 |
| 650 | 3300053150 | Ga0500603_000016 | Ga0500603_000016_46100_47269 | 376 |
| 651 | 3300053159 | Ga0500630_000034 | Ga0500630_000034_34611_35780 | 376 |
| 652 | 3300053163 | Ga0500639_000017 | Ga0500639_000017_37384_38553 | 376 |
| 653 | 3300053178 | Ga0500637_0033234 | Ga0500637_0033234_1541_2710 | 376 |
| 654 | 3300005983 | Ga0081540_1002285 | Ga0081540_10022858 | 377 |
| 655 | 3300005983 | Ga0081540_1025480 | Ga0081540_10254802 | 377 |
| 656 | 3300006846 | Ga0075430_100009419 | Ga0075430_1000094194 | 377 |
| 657 | 3300046491 | Ga0495584_0018523 | Ga0495584_0018523_597_1784 | 377 |
| 658 | 3300048917 | Ga0496114_0143490 | Ga0496114_0143490_27_1205 | 377 |
| 659 | 3300050509 | nmdc:mga0qj67_2560_c1 | nmdc:mga0qj67_2560_c1_6516_7703 | 377 |
| 660 | 3300005295 | Ga0065707_10016994 | Ga0065707_100169942 | 378 |
| 661 | 3300005437 | Ga0070710_10002899 | Ga0070710_100028992 | 378 |
| 662 | 3300005439 | Ga0070711_100096189 | Ga0070711_1000961892 | 378 |
| 663 | 3300006028 | Ga0070717_10001164 | Ga0070717_1000116418 | 378 |
| 664 | 3300006914 | Ga0075436_100249452 | Ga0075436_1002494521 | 378 |
| 665 | 3300025898 | Ga0207692_10003561 | Ga0207692_100035612 | 378 |
| 666 | 3300025906 | Ga0207699_10004084 | Ga0207699_100040842 | 378 |
| 667 | 3300025916 | Ga0207663_10023870 | Ga0207663_100238703 | 378 |
| 668 | 3300025928 | Ga0207700_10098429 | Ga0207700_100984292 | 378 |
| 669 | 3300025939 | Ga0207665_10089786 | Ga0207665_100897862 | 378 |
| 670 | 3300046524 | Ga0495648_0009873 | Ga0495648_0009873_1183_2358 | 378 |
| 671 | 3300047469 | Ga0495673_0025002 | Ga0495673_0025002_1116_2291 | 378 |
| 672 | 3300048929 | Ga0496126_0087272 | Ga0496126_0087272_45_1229 | 378 |
| 673 | 3300000532 | CNAas_1001604 | CNAas_10016042 | 379 |
| 674 | 3300005334 | Ga0068869_100003558 | Ga0068869_1000035583 | 379 |
| 675 | 3300005347 | Ga0070668_100023188 | Ga0070668_1000231882 | 379 |
| 676 | 3300005353 | Ga0070669_100001434 | Ga0070669_1000014346 | 379 |
| 677 | 3300005356 | Ga0070674_100141676 | Ga0070674_1001416762 | 379 |
| 678 | 3300005366 | Ga0070659_100156725 | Ga0070659_1001567252 | 379 |
| 679 | 3300005367 | Ga0070667_100009511 | Ga0070667_1000095113 | 379 |
| 680 | 3300005435 | Ga0070714_100092937 | Ga0070714_1000929372 | 379 |
| 681 | 3300005437 | Ga0070710_10055637 | Ga0070710_100556371 | 379 |
| 682 | 3300005439 | Ga0070711_100008672 | Ga0070711_1000086726 | 379 |
| 683 | 3300005439 | Ga0070711_100043821 | Ga0070711_1000438212 | 379 |
| 684 | 3300005536 | Ga0070697_100345431 | Ga0070697_1003454311 | 379 |
| 685 | 3300005539 | Ga0068853_100223636 | Ga0068853_1002236362 | 379 |
| 686 | 3300005719 | Ga0068861_100002985 | Ga0068861_1000029857 | 379 |
| 687 | 3300005843 | Ga0068860_100029070 | Ga0068860_1000290702 | 379 |
| 688 | 3300005844 | Ga0068862_100029695 | Ga0068862_1000296952 | 379 |
| 689 | 3300005983 | Ga0081540_1000787 | Ga0081540_100078713 | 379 |
| 690 | 3300005983 | Ga0081540_1002212 | Ga0081540_10022125 | 379 |
| 691 | 3300005983 | Ga0081540_1044147 | Ga0081540_10441472 | 379 |
| 692 | 3300006163 | Ga0070715_10035799 | Ga0070715_100357992 | 379 |
| 693 | 3300006175 | Ga0070712_100020675 | Ga0070712_1000206753 | 379 |
| 694 | 3300006175 | Ga0070712_100048398 | Ga0070712_1000483982 | 379 |
| 695 | 3300007265 | Ga0099794_10000628 | Ga0099794_100006288 | 379 |
| 696 | 3300009148 | Ga0105243_10018111 | Ga0105243_100181115 | 379 |
| 697 | 3300009553 | Ga0105249_10021556 | Ga0105249_100215562 | 379 |
| 698 | 3300010375 | Ga0105239_10060470 | Ga0105239_100604706 | 379 |
| 699 | 3300013297 | Ga0157378_10146495 | Ga0157378_101464952 | 379 |
| 700 | 3300013306 | Ga0163162_10031551 | Ga0163162_100315512 | 379 |
| 701 | 3300013306 | Ga0163162_10352472 | Ga0163162_103524722 | 379 |
| 702 | 3300017792 | Ga0163161_10046964 | Ga0163161_100469642 | 379 |
| 703 | 3300017792 | Ga0163161_10052806 | Ga0163161_100528062 | 379 |
| 704 | 3300025898 | Ga0207692_10020640 | Ga0207692_100206402 | 379 |
| 705 | 3300025906 | Ga0207699_10007551 | Ga0207699_100075514 | 379 |
| 706 | 3300025915 | Ga0207693_10004819 | Ga0207693_100048194 | 379 |
| 707 | 3300025915 | Ga0207693_10021983 | Ga0207693_100219833 | 379 |
| 708 | 3300025916 | Ga0207663_10007150 | Ga0207663_100071505 | 379 |
| 709 | 3300025916 | Ga0207663_10039546 | Ga0207663_100395463 | 379 |
| 710 | 3300025929 | Ga0207664_10019667 | Ga0207664_100196672 | 379 |
| 711 | 3300025933 | Ga0207706_10001722 | Ga0207706_100017228 | 379 |
| 712 | 3300025935 | Ga0207709_10102744 | Ga0207709_101027442 | 379 |
| 713 | 3300025939 | Ga0207665_10007372 | Ga0207665_100073723 | 379 |
| 714 | 3300025942 | Ga0207689_10009304 | Ga0207689_100093044 | 379 |
| 715 | 3300025961 | Ga0207712_10015694 | Ga0207712_100156942 | 379 |
| 716 | 3300025972 | Ga0207668_10001369 | Ga0207668_100013693 | 379 |
| 717 | 3300026041 | Ga0207639_10140765 | Ga0207639_101407652 | 379 |
| 718 | 3300026118 | Ga0207675_100010951 | Ga0207675_1000109513 | 379 |
| 719 | 3300027671 | Ga0209588_1000521 | Ga0209588_10005217 | 379 |
| 720 | 3300028380 | Ga0268265_10012713 | Ga0268265_100127132 | 379 |
| 721 | 3300028381 | Ga0268264_10011779 | Ga0268264_100117792 | 379 |
| 722 | 3300035170 | Ga0373943_0046526 | Ga0373943_0046526_634_1815 | 379 |
| 723 | 3300035695 | Ga0373927_0059883 | Ga0373927_0059883_645_1826 | 379 |
| 724 | 3300035725 | Ga0373947_0041692 | Ga0373947_0041692_843_2024 | 379 |
| 725 | 3300046538 | Ga0495609_0066868 | Ga0495609_0066868_295_1473 | 379 |
| 726 | 3300047320 | Ga0495672_0065522 | Ga0495672_0065522_348_1529 | 379 |
| 727 | 3300047323 | Ga0495683_0063856 | Ga0495683_0063856_408_1586 | 379 |
| 728 | 3300048904 | Ga0496101_0013290 | Ga0496101_0013290_1077_2258 | 379 |
| 729 | 3300048909 | Ga0496106_0030102 | Ga0496106_0030102_482_1663 | 379 |
| 730 | 3300048910 | Ga0496107_0111704 | Ga0496107_0111704_492_1673 | 379 |
| 731 | 3300048918 | Ga0496115_0035644 | Ga0496115_0035644_1535_2716 | 379 |
| 732 | 3300050489 | nmdc:mga03683_90323_c1 | nmdc:mga03683_90323_c1_28_1206 | 379 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6r1m-assembly1.cif.gz_A | crystal structure of e. coli seryl-trna synthetase complexed to seryl sulfamoyl adenosine | 0.9698 | 101 | 175 |
| 6r1o-assembly1.cif.gz_A-2 | crystal structure of e. coli seryl-trna synthetase complexed to a seryl sulfamoyl adenosine derivative | 0.9643 | 101 | 175 |
| 6r1m-assembly1.cif.gz_B | crystal structure of e. coli seryl-trna synthetase complexed to seryl sulfamoyl adenosine | 0.9588 | 101 | 175 |
| 8cwy-assembly1.cif.gz_H | accurate computational design of genetically encoded 3d protein crystals | 0.9498 | 100 | 175 |
| 8cwy-assembly1.cif.gz_R | accurate computational design of genetically encoded 3d protein crystals | 0.9494 | 100 | 175 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0P0XQ02_80_398_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.9781 | 101 | 175 | 1.20.1270.60 |
| 5azsA01 | Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) | 0.9754 | 101 | 177 | 1.20.1600.10 |
| 1vf7H02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9716 | 67 | 211 | 2.40.50.100 |
| 2f1mC03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.9638 | 103 | 174 | 1.10.287.470 |
| af_I1KAB5_393_712_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.9595 | 101 | 175 | 1.20.1270.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B0WKP4-F1-model_v4 | RND efflux system, membrane fusion protein | 0.9101 | 290 | 364 |
GO:0005886
GO:0046677 |
| AF-A0A2V7TVZ0-F1-model_v4 | Efflux RND transporter periplasmic adaptor subunit | 0.8686 | 45 | 362 |
GO:0015562
GO:0030313 GO:1990281 |
| AF-A0A7V9PGL9-F1-model_v4 | Efflux RND transporter periplasmic adaptor subunit | 0.8637 | 46 | 362 |
GO:0015562
GO:1990281 |
| AF-A0A537RT60-F1-model_v4 | Efflux RND transporter periplasmic adaptor subunit | 0.8635 | 25 | 363 |
GO:0015562
GO:1990281 |
| AF-A0A6D0ENE7-F1-model_v4 | deleted | 0.863 | 58 | 217 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar