F478052

General Info

Members Datasets Scaffolds Average Seq Length
732 451 556 373

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0075330|Ga0496115_0075330_878_2185
Length 414
Sequence LRVNRNVDGHGAVDNHRNVYDDRDLDVFHFLLTRLTGDGDSMRRKIIIAAVSFVIIAGGVGAFASMRATVAEHDVPIYLTGVGTVIAYNTVVVHSQIQGQLVSINFTEGQAVHTGDLLAQIDPRPYQAQVEQLTANRDRDQAQLTNAIANLNRYTPLEQKGYATPQLLQTQQAQVSQLQNAIKSDQALIDAANVQLSYTRLTSPIDGIAGIRQLDIGNIIHPTDANGLVVVTQIHPISLIFTLPETELPQIQQQQEKTKAPLTVIAYSQDNKIELDQGVLGLVNNEILQTTGSIQLKANSPNKTNRLWPGELVNARLLVDTRHNGLTVPAGAVQQGPNGAYSYVIKPDSSVEVRPVKVAQTSEGQSLIDSGLQANEQVVVDGQYKLKPGAQVAVLHGKAAQEAAAQSAEQAPIP

Samples

Sample ID Description Type Environment
1 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
5 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
6 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
9 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
10 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
11 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
12 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
13 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
14 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
15 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
16 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
17 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
18 2791355199
19 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
20 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
21 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
22 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
23 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
24 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
25 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
26 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
27 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
28 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
29 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
30 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
31 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
32 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
33 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
34 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
35 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
36 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
37 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
38 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
39 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
40 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
41 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
42 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
43 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
44 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
45 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
46 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
47 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
48 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
49 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
50 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
51 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
52 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
53 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
54 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
55 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
56 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
57 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
58 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
59 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
60 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
61 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
62 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
63 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
64 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
65 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
66 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
67 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
68 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
69 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
70 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
71 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
72 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
73 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
74 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
75 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
76 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
77 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
78 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
79 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
80 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
81 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
82 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
83 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
84 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
85 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
86 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
87 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
88 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
89 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
90 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
91 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
92 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
93 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
94 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
95 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
96 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
97 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
98 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
99 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
100 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
101 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
102 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
103 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
104 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
105 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
106 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
107 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
108 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
109 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
110 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
111 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
112 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
113 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
114 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
115 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
116 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
117 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
118 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
119 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
120 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
121 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
122 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
123 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
124 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
125 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
126 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
127 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
128 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
129 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
130 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
131 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
132 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
133 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
134 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
135 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
136 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
137 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
138 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
139 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
140 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
141 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
142 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
143 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
144 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
145 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
146 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
147 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
148 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
149 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
150 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
151 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
152 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
153 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
154 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
155 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
156 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
157 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
158 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
159 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
160 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
161 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
162 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
163 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
164 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
165 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
166 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
167 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
168 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
169 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
170 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
171 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
172 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
173 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
174 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
175 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
176 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
177 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
178 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
179 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
180 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
181 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
182 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
183 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
184 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
185 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
186 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
187 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
188 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
189 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
190 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
191 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
192 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
193 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
194 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
195 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
196 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
197 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
198 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
199 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
200 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
201 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
202 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
203 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
204 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
205 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
206 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
207 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
208 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
209 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
210 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
211 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
212 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
213 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
214 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
215 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
216 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
217 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
218 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
219 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
220 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
221 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
222 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
223 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
224 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
225 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
226 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
227 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
228 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
229 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
230 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
268 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
272 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
274 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
275 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
276 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
277 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
278 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
279 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
280 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
281 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
282 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
283 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
284 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
285 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
286 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
287 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
288 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
289 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
290 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
291 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
292 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
293 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
294 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
295 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
296 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
297 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
298 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
299 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
300 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
301 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
302 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
303 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
304 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
305 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
306 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
307 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
308 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
309 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
310 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
311 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
312 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
313 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
314 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
315 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
316 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
317 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
318 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
319 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
320 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
321 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
322 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
325 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
326 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
327 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
328 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
329 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
330 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
331 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
332 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
333 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
334 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
335 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
336 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
337 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
338 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
339 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
340 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
341 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
342 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
343 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
344 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
347 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
348 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
349 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
350 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
351 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
352 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
353 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
354 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
355 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
356 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
357 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
358 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
359 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
360 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
361 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
362 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
363 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
364 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
365 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
366 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
367 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
368 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
369 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
370 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
371 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
372 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
373 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
374 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
375 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
376 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
377 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
378 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
379 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
380 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
381 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
382 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
383 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
384 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
385 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
386 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
387 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
388 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
389 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
390 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
391 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
392 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
393 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
394 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
395 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
396 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
397 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
398 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
399 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
400 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
401 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
402 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
403 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
404 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
405 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
406 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
407 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
408 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
409 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
410 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
411 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
412 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
413 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
414 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
415 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
416 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
417 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
418 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
419 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
420 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
421 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
422 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
423 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
424 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
425 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
426 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
427 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
428 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
429 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
430 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
431 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
432 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
433 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
434 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
435 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
436 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
437 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
438 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
439 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
440 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
441 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
442 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
443 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
444 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
445 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
446 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
447 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
448 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
449 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
450 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
451 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.92
Metatranscriptomes 0.14
Isolates 23.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.89
Nodule 18.72
Rhizoplane 3.69
Rhizosphere 53.83
Stem 0
Stem Tuber 0
Unclassified 8.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1001604 3300000532 Bacteria 1846
2 JGI25153J46596_10000288 3300003215 Bacteria 38391
3 JGI25153J46596_10000483 3300003215 Bacteria 25554
4 JGI25153J46596_10000912 3300003215 Bacteria 17961
5 JGI25153J46596_10001506 3300003215 Bacteria 13886
6 JGI25153J46596_10001586 3300003215 Bacteria 13473
7 JGI25153J46596_10001963 3300003215 Bacteria 12198
8 JGI25160J50197_1000413 3300003354 Bacteria 27195
9 JGI25160J50197_1001806 3300003354 Bacteria 10328
10 JGI25404J52841_10000205 3300003659 Bacteria 7120
11 JGI25404J52841_10010408 3300003659 Bacteria 2000
12 JGI25404J52841_10013508 3300003659 Bacteria 1771
13 Ga0055539_1005156 3300003752 Bacteria 1707
14 Ga0055531_10012320 3300003794 Bacteria 4035
15 Ga0065165_1000342 3300005262 Bacteria 76302
16 Ga0065165_1006645 3300005262 Bacteria 5975
17 Ga0065704_10140706 3300005289 Bacteria 1521
18 Ga0065715_10001703 3300005293 Bacteria 5952
19 Ga0065707_10016994 3300005295 Bacteria 1797
20 Ga0070658_10018856 3300005327 Bacteria 5527
21 Ga0068869_100003558 3300005334 Bacteria 9557
22 Ga0068869_100042182 3300005334 Bacteria 3270
23 Ga0070682_100031621 3300005337 Bacteria 3202
24 Ga0070682_100110139 3300005337 Bacteria 1834
25 Ga0068868_100089122 3300005338 Bacteria 2483
26 Ga0070689_100070251 3300005340 Bacteria 2733
27 Ga0070691_10018531 3300005341 Bacteria 3210
28 Ga0070668_100020486 3300005347 Bacteria 4991
29 Ga0070668_100023188 3300005347 Bacteria 4693
30 Ga0070668_100053069 3300005347 Bacteria 3126
31 Ga0070668_100112145 3300005347 Bacteria 2171
32 Ga0070669_100001434 3300005353 Bacteria 17247
33 Ga0070675_100307231 3300005354 Bacteria 1398
34 Ga0070671_100057356 3300005355 Bacteria 3240
35 Ga0070674_100141676 3300005356 Bacteria 1805
36 Ga0070673_100373731 3300005364 Bacteria 1269
37 Ga0070659_100156725 3300005366 Bacteria 1860
38 Ga0070667_100009511 3300005367 Bacteria 8060
39 Ga0070667_100351286 3300005367 Bacteria 1335
40 Ga0070709_10033314 3300005434 Bacteria 3114
41 Ga0070714_100033979 3300005435 Bacteria 4269
42 Ga0070714_100092937 3300005435 Bacteria 2645
43 Ga0070713_100150664 3300005436 Bacteria 2069
44 Ga0070713_100175591 3300005436 Bacteria 1922
45 Ga0070710_10002899 3300005437 Bacteria 8165
46 Ga0070710_10055637 3300005437 Bacteria 2236
47 Ga0070710_10096668 3300005437 Bacteria 1751
48 Ga0070711_100008672 3300005439 Bacteria 6239
49 Ga0070711_100038316 3300005439 Bacteria 3223
50 Ga0070711_100043821 3300005439 Bacteria 3033
51 Ga0070711_100074234 3300005439 Bacteria 2405
52 Ga0070711_100096189 3300005439 Bacteria 2145
53 Ga0070711_100288852 3300005439 Bacteria 1300
54 Ga0070700_100047395 3300005441 Bacteria 2659
55 Ga0070694_100012064 3300005444 Bacteria 5366
56 Ga0070663_100003069 3300005455 Bacteria 9550
57 Ga0070663_100006379 3300005455 Bacteria 7088
58 Ga0070663_100025905 3300005455 Bacteria 3964
59 Ga0070663_100144252 3300005455 Bacteria 1820
60 Ga0070678_100080606 3300005456 Bacteria 2465
61 Ga0070678_100207550 3300005456 Bacteria 1621
62 Ga0070662_100029456 3300005457 Bacteria 3831
63 Ga0068867_100125340 3300005459 Bacteria 1990
64 Ga0070706_100093913 3300005467 Bacteria 2783
65 Ga0070698_100000373 3300005471 Bacteria 46692
66 Ga0070698_100094727 3300005471 Bacteria 2964
67 Ga0070699_100011652 3300005518 Bacteria 7589
68 Ga0070699_100018770 3300005518 Bacteria 5940
69 Ga0070699_100182703 3300005518 Bacteria 1861
70 Ga0070699_100389103 3300005518 Bacteria 1260
71 Ga0070697_100013409 3300005536 Bacteria 6429
72 Ga0070697_100069049 3300005536 Bacteria 2894
73 Ga0070697_100154624 3300005536 Bacteria 1935
74 Ga0070697_100345431 3300005536 Bacteria 1285
75 Ga0068853_100215198 3300005539 Bacteria 1753
76 Ga0068853_100223636 3300005539 Bacteria 1720
77 Ga0070696_100025911 3300005546 Bacteria 3988
78 Ga0070665_100002914 3300005548 Bacteria 18491
79 Ga0070665_100006487 3300005548 Bacteria 11901
80 Ga0070665_100024100 3300005548 Bacteria 6128
81 Ga0070665_100179991 3300005548 Bacteria 2115
82 Ga0070665_100182195 3300005548 Bacteria 2101
83 Ga0070704_100020603 3300005549 Bacteria 4256
84 Ga0068855_100070455 3300005563 Bacteria 4067
85 Ga0068856_100018995 3300005614 Bacteria 6669
86 Ga0068852_100130956 3300005616 Bacteria 2310
87 Ga0068864_100091296 3300005618 Bacteria 2686
88 Ga0068864_100190673 3300005618 Bacteria 1879
89 Ga0068861_100002985 3300005719 Bacteria 11163
90 Ga0068863_100178915 3300005841 Bacteria 2036
91 Ga0068860_100029070 3300005843 Bacteria 5317
92 Ga0068862_100029695 3300005844 Bacteria 4607
93 Ga0068862_100149351 3300005844 Bacteria 2079
94 Ga0068862_100188168 3300005844 Bacteria 1856
95 Ga0081455_10000165 3300005937 Bacteria 81987
96 Ga0081455_10000715 3300005937 Bacteria 43119
97 Ga0081455_10010592 3300005937 Bacteria 9331
98 Ga0081455_10043485 3300005937 Bacteria 3928
99 Ga0081455_10074473 3300005937 Bacteria 2804
100 Ga0081540_1000002 3300005983 Bacteria 251149
101 Ga0081540_1000021 3300005983 Bacteria 161624
102 Ga0081540_1000787 3300005983 Bacteria 29106
103 Ga0081540_1001470 3300005983 Bacteria 20340
104 Ga0081540_1002212 3300005983 Bacteria 16044
105 Ga0081540_1002285 3300005983 Bacteria 15735
106 Ga0081540_1002452 3300005983 Bacteria 15103
107 Ga0081540_1003224 3300005983 Bacteria 13002
108 Ga0081540_1003472 3300005983 Bacteria 12439
109 Ga0081540_1006015 3300005983 Bacteria 8929
110 Ga0081540_1011193 3300005983 Bacteria 6017
111 Ga0081540_1016727 3300005983 Bacteria 4573
112 Ga0081540_1025480 3300005983 Bacteria 3401
113 Ga0081540_1044147 3300005983 Bacteria 2278
114 Ga0081540_1067943 3300005983 Bacteria 1662
115 Ga0070717_10001164 3300006028 Bacteria 17767
116 Ga0070717_10024876 3300006028 Bacteria 4757
117 Ga0070717_10165456 3300006028 Bacteria 1921
118 Ga0070717_10198724 3300006028 Bacteria 1755
119 Ga0075365_10002250 3300006038 Bacteria 9352
120 Ga0075365_10005374 3300006038 Bacteria 6901
121 Ga0075365_10038349 3300006038 Bacteria 3114
122 Ga0075365_10122771 3300006038 Bacteria 1793
123 Ga0075365_10137808 3300006038 Bacteria 1692
124 Ga0075363_100005934 3300006048 Bacteria 5505
125 Ga0075363_100123712 3300006048 Bacteria 1446
126 Ga0075364_10045672 3300006051 Bacteria 2851
127 Ga0075364_10067396 3300006051 Bacteria 2352
128 Ga0070715_10035799 3300006163 Bacteria 2044
129 Ga0070716_100059836 3300006173 Bacteria 2197
130 Ga0070716_100126585 3300006173 Bacteria 1608
131 Ga0070712_100009376 3300006175 Bacteria 6166
132 Ga0070712_100010060 3300006175 Bacteria 5961
133 Ga0070712_100020675 3300006175 Bacteria 4310
134 Ga0070712_100048398 3300006175 Bacteria 2947
135 Ga0070712_100056649 3300006175 Bacteria 2750
136 Ga0075362_10001097 3300006177 Bacteria 8406
137 Ga0075362_10087247 3300006177 Bacteria 1445
138 Ga0075367_10001540 3300006178 Bacteria 9968
139 Ga0075367_10001959 3300006178 Bacteria 9156
140 Ga0075369_10000106 3300006186 Bacteria 22440
141 Ga0075369_10040648 3300006186 Bacteria 1988
142 Ga0075366_10004804 3300006195 Bacteria 7288
143 Ga0075366_10109445 3300006195 Bacteria 1661
144 Ga0075370_10003315 3300006353 Bacteria 7647
145 Ga0075370_10007764 3300006353 Bacteria 5480
146 Ga0075370_10024530 3300006353 Bacteria 3332
147 Ga0075370_10026246 3300006353 Bacteria 3226
148 Ga0075370_10045416 3300006353 Bacteria 2485
149 Ga0075428_100001568 3300006844 Bacteria 24492
150 Ga0075428_100064438 3300006844 Bacteria 4013
151 Ga0075428_100064532 3300006844 Bacteria 4010
152 Ga0075428_100072013 3300006844 Bacteria 3777
153 Ga0075430_100009419 3300006846 Bacteria 8253
154 Ga0075430_100011000 3300006846 Bacteria 7666
155 Ga0075430_100014903 3300006846 Bacteria 6621
156 Ga0075430_100040472 3300006846 Bacteria 3945
157 Ga0075431_100000110 3300006847 Bacteria 52121
158 Ga0075431_100064670 3300006847 Bacteria 3777
159 Ga0075431_100085094 3300006847 Bacteria 3264
160 Ga0075431_100145708 3300006847 Bacteria 2440
161 Ga0075433_10001538 3300006852 Bacteria 17045
162 Ga0075434_100002679 3300006871 Bacteria 15731
163 Ga0075434_100013294 3300006871 Bacteria 7828
164 Ga0075434_100290929 3300006871 Bacteria 1654
165 Ga0075429_100010965 3300006880 Bacteria 7842
166 Ga0075429_100046476 3300006880 Bacteria 3777
167 Ga0075436_100000863 3300006914 Bacteria 20151
168 Ga0075436_100249452 3300006914 Bacteria 1264
169 Ga0075435_100103087 3300007076 Bacteria 2366
170 Ga0075435_100208044 3300007076 Bacteria 1659
171 Ga0099794_10000628 3300007265 Bacteria 11768
172 Ga0099794_10010403 3300007265 Bacteria 3949
173 Ga0099794_10016490 3300007265 Bacteria 3276
174 Ga0111539_10000570 3300009094 Bacteria 47255
175 Ga0111539_10073473 3300009094 Bacteria 4032
176 Ga0111539_10143480 3300009094 Bacteria 2795
177 Ga0111539_10278953 3300009094 Bacteria 1945
178 Ga0111539_10300573 3300009094 Bacteria 1868
179 Ga0105245_10130209 3300009098 Bacteria 2359
180 Ga0105247_10019784 3300009101 Bacteria 4043
181 Ga0105247_10047000 3300009101 Bacteria 2650
182 Ga0105247_10222243 3300009101 Bacteria 1279
183 Ga0114129_10000766 3300009147 Bacteria 41029
184 Ga0114129_10045330 3300009147 Bacteria 6182
185 Ga0114129_10167269 3300009147 Bacteria 3000
186 Ga0114129_10200337 3300009147 Bacteria 2705
187 Ga0114129_10257021 3300009147 Bacteria 2343
188 Ga0105243_10007473 3300009148 Bacteria 8398
189 Ga0105243_10018111 3300009148 Bacteria 5330
190 Ga0105241_10034717 3300009174 Bacteria 3791
191 Ga0105241_10064231 3300009174 Bacteria 2833
192 Ga0105242_10266828 3300009176 Bacteria 1549
193 Ga0105248_10311580 3300009177 Bacteria 1773
194 Ga0105248_10425602 3300009177 Bacteria 1495
195 Ga0105237_10248843 3300009545 Bacteria 1779
196 Ga0105238_10076600 3300009551 Bacteria 3336
197 Ga0105249_10021556 3300009553 Bacteria 5769
198 Ga0105249_10457758 3300009553 Bacteria 1315
199 Ga0099796_10005417 3300010159 Bacteria 3185
200 Ga0099796_10019757 3300010159 Bacteria 2048
201 Ga0099796_10032891 3300010159 Bacteria 1703
202 Ga0105239_10023240 3300010375 Bacteria 6830
203 Ga0105239_10060470 3300010375 Bacteria 4158
204 Ga0105246_10128980 3300011119 Bacteria 1886
205 Ga0105246_10213564 3300011119 Bacteria 1507
206 Ga0157374_10124771 3300013296 Bacteria 2488
207 Ga0157374_10251751 3300013296 Bacteria 1738
208 Ga0157378_10146495 3300013297 Bacteria 2197
209 Ga0163162_10031551 3300013306 Bacteria 5256
210 Ga0163162_10151128 3300013306 Bacteria 2440
211 Ga0163162_10171322 3300013306 Bacteria 2295
212 Ga0163162_10352472 3300013306 Bacteria 1604
213 Ga0157375_10356457 3300013308 Bacteria 1629
214 Ga0157375_10377689 3300013308 Bacteria 1584
215 Ga0163163_10015404 3300014325 Bacteria 7069
216 Ga0157376_10135314 3300014969 Bacteria 2204
217 Ga0163161_10046964 3300017792 Bacteria 3117
218 Ga0163161_10052806 3300017792 Bacteria 2946
219 Ga0213876_10035942 3300021384 Bacteria 2613
220 Ga0213871_10005103 3300021441 Bacteria 2683
221 Ga0209563_101772 3300025230 Bacteria 5425
222 Ga0209677_101975 3300025253 Bacteria 8152
223 Ga0209677_102808 3300025253 Bacteria 6165
224 Ga0209148_1012845 3300025254 Bacteria 1520
225 Ga0209233_1002127 3300025261 Bacteria 7466
226 Ga0209233_1004746 3300025261 Bacteria 4586
227 Ga0209455_1012420 3300025272 Bacteria 2040
228 Ga0209564_1003588 3300025295 Bacteria 10355
229 Ga0209564_1007333 3300025295 Bacteria 5719
230 Ga0209758_1000024 3300025297 Bacteria 591966
231 Ga0209758_1000139 3300025297 Bacteria 175148
232 Ga0209758_1000209 3300025297 Bacteria 128038
233 Ga0209758_1003797 3300025297 Bacteria 13306
234 Ga0209758_1006334 3300025297 Bacteria 8576
235 Ga0209758_1007918 3300025297 Bacteria 7053
236 Ga0209758_1008134 3300025297 Bacteria 6894
237 Ga0209758_1029049 3300025297 Bacteria 2323
238 Ga0209256_1006206 3300025299 Bacteria 6443
239 Ga0209256_1021882 3300025299 Bacteria 1950
240 Ga0207426_1000237 3300025302 Bacteria 124707
241 Ga0207426_1002648 3300025302 Bacteria 11036
242 Ga0209257_1000416 3300025304 Bacteria 82474
243 Ga0207692_10003561 3300025898 Bacteria 6093
244 Ga0207692_10020640 3300025898 Bacteria 3001
245 Ga0207692_10078585 3300025898 Bacteria 1758
246 Ga0207647_10057719 3300025904 Bacteria 2379
247 Ga0207699_10004084 3300025906 Bacteria 6984
248 Ga0207699_10006269 3300025906 Bacteria 5746
249 Ga0207699_10007551 3300025906 Bacteria 5321
250 Ga0207699_10057284 3300025906 Bacteria 2326
251 Ga0207645_10151084 3300025907 Bacteria 1516
252 Ga0207643_10073125 3300025908 Bacteria 1976
253 Ga0207705_10029754 3300025909 Bacteria 3893
254 Ga0207684_10105805 3300025910 Bacteria 2407
255 Ga0207684_10182359 3300025910 Bacteria 1810
256 Ga0207693_10003198 3300025915 Bacteria 14054
257 Ga0207693_10004819 3300025915 Bacteria 11344
258 Ga0207693_10016822 3300025915 Bacteria 5837
259 Ga0207693_10021983 3300025915 Bacteria 5071
260 Ga0207693_10030609 3300025915 Bacteria 4252
261 Ga0207693_10121953 3300025915 Bacteria 2047
262 Ga0207663_10007150 3300025916 Bacteria 5769
263 Ga0207663_10011977 3300025916 Bacteria 4674
264 Ga0207663_10023870 3300025916 Bacteria 3517
265 Ga0207663_10026736 3300025916 Bacteria 3353
266 Ga0207663_10039546 3300025916 Bacteria 2858
267 Ga0207657_10210886 3300025919 Bacteria 1559
268 Ga0207646_10225703 3300025922 Bacteria 1692
269 Ga0207687_10003095 3300025927 Bacteria 11284
270 Ga0207700_10043818 3300025928 Bacteria 3290
271 Ga0207700_10065195 3300025928 Bacteria 2778
272 Ga0207700_10098429 3300025928 Bacteria 2327
273 Ga0207664_10007583 3300025929 Bacteria 7526
274 Ga0207664_10019667 3300025929 Bacteria 4996
275 Ga0207644_10145448 3300025931 Bacteria 1830
276 Ga0207706_10001722 3300025933 Bacteria 21565
277 Ga0207709_10090925 3300025935 Bacteria 1995
278 Ga0207709_10095924 3300025935 Bacteria 1950
279 Ga0207709_10102744 3300025935 Bacteria 1893
280 Ga0207670_10105169 3300025936 Bacteria 2023
281 Ga0207665_10000779 3300025939 Bacteria 21462
282 Ga0207665_10007372 3300025939 Bacteria 7270
283 Ga0207665_10018743 3300025939 Bacteria 4548
284 Ga0207665_10089786 3300025939 Bacteria 2129
285 Ga0207691_10241364 3300025940 Bacteria 1562
286 Ga0207711_10029434 3300025941 Bacteria 4632
287 Ga0207689_10009304 3300025942 Bacteria 8495
288 Ga0207679_10220388 3300025945 Bacteria 1596
289 Ga0207667_10284840 3300025949 Bacteria 1688
290 Ga0207712_10015694 3300025961 Bacteria 4891
291 Ga0207712_10017511 3300025961 Bacteria 4654
292 Ga0207668_10001369 3300025972 Bacteria 14371
293 Ga0207668_10014288 3300025972 Bacteria 4913
294 Ga0207668_10017270 3300025972 Bacteria 4516
295 Ga0207668_10038101 3300025972 Bacteria 3223
296 Ga0207668_10051323 3300025972 Bacteria 2848
297 Ga0207639_10140765 3300026041 Bacteria 2009
298 Ga0207678_10002397 3300026067 Bacteria 17029
299 Ga0207678_10003316 3300026067 Bacteria 14518
300 Ga0207678_10014230 3300026067 Bacteria 6994
301 Ga0207678_10147298 3300026067 Bacteria 2009
302 Ga0207708_10061683 3300026075 Bacteria 2863
303 Ga0207641_10051008 3300026088 Bacteria 3503
304 Ga0207676_10079181 3300026095 Bacteria 2664
305 Ga0207674_10068585 3300026116 Bacteria 3569
306 Ga0207675_100010951 3300026118 Bacteria 8495
307 Ga0207675_100094094 3300026118 Bacteria 2819
308 Ga0207683_10211671 3300026121 Bacteria 1765
309 Ga0209179_1000450 3300027512 Bacteria 4162
310 Ga0209588_1000521 3300027671 Bacteria 9849
311 Ga0207428_10002129 3300027907 Bacteria 19919
312 Ga0207428_10007040 3300027907 Bacteria 10295
313 Ga0207428_10011549 3300027907 Bacteria 7799
314 Ga0268266_10001022 3300028379 Bacteria 35236
315 Ga0268266_10005075 3300028379 Bacteria 12419
316 Ga0268266_10050761 3300028379 Bacteria 3558
317 Ga0268265_10012713 3300028380 Bacteria 5712
318 Ga0268265_10016290 3300028380 Bacteria 5102
319 Ga0268264_10011779 3300028381 Bacteria 7211
320 Ga0268264_10156706 3300028381 Bacteria 2047
321 Ga0265334_10011662 3300028573 Bacteria 3696
322 Ga0265760_10022120 3300031090 Bacteria 1841
323 Ga0307509_10152254 3300031507 Bacteria 2226
324 Ga0307509_10174701 3300031507 Bacteria 2022
325 Ga0307409_100033655 3300031995 Bacteria 3732
326 Ga0307409_100041610 3300031995 Bacteria 3433
327 Ga0307411_10027550 3300032005 Bacteria 3440
328 Ga0307411_10092584 3300032005 Bacteria 2114
329 Ga0307415_100062558 3300032126 Bacteria 2582
330 Ga0307510_10014098 3300033180 Bacteria 9465
331 Ga0307510_10061641 3300033180 Bacteria 3842
332 Ga0373934_0015153 3300035086 Bacteria 2922
333 Ga0373954_0001354 3300035118 Bacteria 9877
334 Ga0373956_0006917 3300035119 Bacteria 4556
335 Ga0373943_0046526 3300035170 Bacteria 2118
336 Ga0373955_0001045 3300035172 Bacteria 11768
337 Ga0373924_0003482 3300035410 Bacteria 5420
338 Ga0373927_0017396 3300035695 Bacteria 4731
339 Ga0373927_0059883 3300035695 Bacteria 2463
340 Ga0373933_0001089 3300035724 Bacteria 16221
341 Ga0373947_0041692 3300035725 Bacteria 2738
342 Ga0373937_0006280 3300036401 Bacteria 10247
343 Ga0373925_0097765 3300037068 Bacteria 2252
344 Ga0373925_0189165 3300037068 Bacteria 1633
345 Ga0436365_0999537 3300039437 Bacteria 4812
346 Ga0436360_0435591 3300039438 Bacteria 2276
347 Ga0436361_0426039 3300039447 Bacteria 2325
348 Ga0436361_0714685 3300039447 Bacteria 6869
349 Ga0436361_0961182 3300039447 Bacteria 2513
350 Ga0466959_0083273 3300045049 Bacteria 2304
351 Ga0495592_0008630 3300046454 Bacteria 7648
352 Ga0495603_0021639 3300046455 Bacteria 3895
353 Ga0495590_0050120 3300046457 Bacteria 1457
354 Ga0495629_0008997 3300046459 Bacteria 7328
355 Ga0495629_0058992 3300046459 Bacteria 2683
356 Ga0495638_0002575 3300046460 Bacteria 14674
357 Ga0495638_0010632 3300046460 Bacteria 6374
358 Ga0495651_0033585 3300046462 Bacteria 4001
359 Ga0495653_0013015 3300046463 Bacteria 6786
360 Ga0495653_0077153 3300046463 Unclassified 2475
361 Ga0495605_0023824 3300046474 Bacteria 3213
362 Ga0495639_0103180 3300046475 Bacteria 1348
363 Ga0495662_0008323 3300046476 Bacteria 5100
364 Ga0495664_0011428 3300046477 Bacteria 5006
365 Ga0495584_0018523 3300046491 Bacteria 3539
366 Ga0495585_0021409 3300046492 Bacteria 3712
367 Ga0495606_0011605 3300046507 Bacteria 7163
368 Ga0495608_0002629 3300046511 Bacteria 12898
369 Ga0495628_0057941 3300046516 Bacteria 3047
370 Ga0495630_0057520 3300046517 Bacteria 2914
371 Ga0495631_0050058 3300046518 Bacteria 1828
372 Ga0495632_0042259 3300046519 Bacteria 2285
373 Ga0495637_0046525 3300046520 Bacteria 1835
374 Ga0495637_0077350 3300046520 Bacteria 1332
375 Ga0495643_0026380 3300046522 Bacteria 3279
376 Ga0495648_0002795 3300046524 Bacteria 15731
377 Ga0495648_0008057 3300046524 Bacteria 8336
378 Ga0495648_0009873 3300046524 Bacteria 7335
379 Ga0495640_0015625 3300046533 Bacteria 5705
380 Ga0495587_0036423 3300046536 Bacteria 2959
381 Ga0495609_0066868 3300046538 Bacteria 1583
382 Ga0495621_0003718 3300046539 Bacteria 4225
383 Ga0495645_0002685 3300046543 Bacteria 12074
384 Ga0495622_0038526 3300046557 Bacteria 2226
385 Ga0495667_0013388 3300046559 Bacteria 5552
386 Ga0495656_0047775 3300046615 Bacteria 1816
387 Ga0495668_0034892 3300046616 Bacteria 2820
388 Ga0495634_0010658 3300046642 Bacteria 6729
389 Ga0495634_0020002 3300046642 Bacteria 4750
390 Ga0495634_0181157 3300046642 Bacteria 1319
391 Ga0495611_0006627 3300046648 Bacteria 4932
392 Ga0495625_0074786 3300046660 Bacteria 2372
393 Ga0495625_0110434 3300046660 Bacteria 1880
394 Ga0495625_0145442 3300046660 Bacteria 1596
395 Ga0495635_0002628 3300046663 Bacteria 12288
396 Ga0495635_0108406 3300046663 Bacteria 1897
397 Ga0495659_0037244 3300046664 Bacteria 1722
398 Ga0495659_0041900 3300046664 Bacteria 1637
399 Ga0495588_0010521 3300046674 Bacteria 4304
400 Ga0495657_0038615 3300046675 Bacteria 3284
401 Ga0495599_0001303 3300046678 Bacteria 14181
402 Ga0495646_0015281 3300046680 Bacteria 4874
403 Ga0495669_0004419 3300046684 Bacteria 5807
404 Ga0495669_0103791 3300046684 Bacteria 1322
405 Ga0495624_0062665 3300046690 Bacteria 2326
406 Ga0495670_0141359 3300046691 Bacteria 1259
407 Ga0495671_0130530 3300046692 Bacteria 1225
408 Ga0495649_0093385 3300046694 Bacteria 1602
409 Ga0495600_0004004 3300046809 Bacteria 8757
410 Ga0495604_0029571 3300047317 Bacteria 4358
411 Ga0495604_0053329 3300047317 Bacteria 3126
412 Ga0495674_0120296 3300047319 Bacteria 2219
413 Ga0495672_0065522 3300047320 Bacteria 2076
414 Ga0495676_0106458 3300047321 Bacteria 2066
415 Ga0495680_0002436 3300047322 Bacteria 19039
416 Ga0495683_0063856 3300047323 Bacteria 1819
417 Ga0495675_0055280 3300047444 Bacteria 2517
418 Ga0495673_0025002 3300047469 Bacteria 2874
419 Ga0495673_0099165 3300047469 Bacteria 1180
420 Ga0495684_0003077 3300047471 Bacteria 13110
421 Ga0495684_0003990 3300047471 Bacteria 11511
422 Ga0495686_0053148 3300047472 Bacteria 2539
423 Ga0495686_0077384 3300047472 Bacteria 2037
424 Ga0495686_0090192 3300047472 Bacteria 1862
425 Ga0495686_0120278 3300047472 Bacteria 1566
426 Ga0495593_0002110 3300047673 Bacteria 11877
427 Ga0495602_0099140 3300048088 Bacteria 2396
428 Ga0496101_0013290 3300048904 Bacteria 5514
429 Ga0496101_0016299 3300048904 Bacteria 5016
430 Ga0496102_0098305 3300048905 Bacteria 2716
431 Ga0496104_0059661 3300048907 Bacteria 3612
432 Ga0496104_0066176 3300048907 Bacteria 3431
433 Ga0496105_0006689 3300048908 Bacteria 8873
434 Ga0496105_0011260 3300048908 Bacteria 7060
435 Ga0496106_0030102 3300048909 Bacteria 4047
436 Ga0496106_0135656 3300048909 Bacteria 1933
437 Ga0496107_0111704 3300048910 Bacteria 2009
438 Ga0496108_0240300 3300048911 Bacteria 1575
439 Ga0496109_0124509 3300048912 Bacteria 2403
440 Ga0496110_0016254 3300048913 Bacteria 6210
441 Ga0496110_0183101 3300048913 Bacteria 1902
442 Ga0496110_0282219 3300048913 Bacteria 1512
443 Ga0496111_0031450 3300048914 Bacteria 3781
444 Ga0496112_0097976 3300048915 Bacteria 2902
445 Ga0496112_0168225 3300048915 Bacteria 2158
446 Ga0496112_0182165 3300048915 Bacteria 2064
447 Ga0496112_0219713 3300048915 Bacteria 1856
448 Ga0496113_0085819 3300048916 Bacteria 2418
449 Ga0496114_0027824 3300048917 Bacteria 4634
450 Ga0496114_0107054 3300048917 Bacteria 2393
451 Ga0496114_0143490 3300048917 Bacteria 2069
452 Ga0496115_0035644 3300048918 Bacteria 3937
453 Ga0496115_0075330 3300048918 Bacteria 2741
454 Ga0496115_0179133 3300048918 Bacteria 1752
455 Ga0496117_0055679 3300048920 Bacteria 2761
456 Ga0496118_0015721 3300048921 Bacteria 6987
457 Ga0496119_0090890 3300048922 Bacteria 1735
458 Ga0496121_0000178 3300048924 Bacteria 141429
459 Ga0496121_0000868 3300048924 Bacteria 54616
460 Ga0496121_0001346 3300048924 Bacteria 41986
461 Ga0496121_0007484 3300048924 Bacteria 13190
462 Ga0496121_0036811 3300048924 Bacteria 4355
463 Ga0496121_0077900 3300048924 Bacteria 2638
464 Ga0496121_0103860 3300048924 Bacteria 2185
465 Ga0496121_0104292 3300048924 Bacteria 2179
466 Ga0496121_0104972 3300048924 Bacteria 2169
467 Ga0496122_0043294 3300048925 Bacteria 3529
468 Ga0496126_0002980 3300048929 Bacteria 21982
469 Ga0496126_0013853 3300048929 Bacteria 8180
470 Ga0496126_0017979 3300048929 Bacteria 7028
471 Ga0496126_0040784 3300048929 Bacteria 4302
472 Ga0496126_0045621 3300048929 Bacteria 4026
473 Ga0496126_0087272 3300048929 Bacteria 2749
474 Ga0496126_0106425 3300048929 Bacteria 2448
475 Ga0495682_0016089 3300049460 Bacteria 2829
476 nmdc:mga03683_32382_c1 3300050489 Bacteria 2103
477 nmdc:mga03683_672_c1 3300050489 Bacteria 7052
478 nmdc:mga03683_90323_c1 3300050489 Bacteria 1334
479 nmdc:mga03n38_2843_c1 3300050490 Bacteria 5449
480 nmdc:mga03n38_3844_c1 3300050490 Bacteria 4884
481 nmdc:mga00v17_27330_c1 3300050491 Bacteria 3330
482 nmdc:mga00v17_38782_c1 3300050491 Bacteria 2850
483 nmdc:mga00v17_86617_c1 3300050491 Bacteria 1963
484 nmdc:mga0yw44_104964_c1 3300050492 Bacteria 1804
485 nmdc:mga0yw44_125676_c1 3300050492 Bacteria 1656
486 nmdc:mga0yw44_405_c1 3300050492 Bacteria 15044
487 nmdc:mga0k408_1338_c1 3300050493 Bacteria 2214
488 nmdc:mga06z11_2034_c1 3300050494 Bacteria 7665
489 nmdc:mga06z11_38_c1 3300050494 Bacteria 54827
490 nmdc:mga06z11_5543_c1 3300050494 Bacteria 5074
491 nmdc:mga07m45_106_c1 3300050496 Bacteria 28440
492 nmdc:mga07m45_10894_c1 3300050496 Bacteria 4761
493 nmdc:mga07m45_38426_c1 3300050496 Bacteria 2671
494 nmdc:mga07m45_40886_c1 3300050496 Bacteria 2595
495 nmdc:mga07m45_8693_c1 3300050496 Bacteria 5231
496 nmdc:mga05p37_12561_c1 3300050507 Bacteria 10112
497 nmdc:mga05p37_160_c1 3300050507 Bacteria 64997
498 nmdc:mga09592_15829_c1 3300050508 Bacteria 6163
499 nmdc:mga09592_2214_c1 3300050508 Bacteria 15651
500 nmdc:mga0qj67_1410_c1 3300050509 Bacteria 16811
501 nmdc:mga0qj67_15607_c1 3300050509 Bacteria 5751
502 nmdc:mga0qj67_2560_c1 3300050509 Bacteria 12991
503 nmdc:mga0qj67_7961_c1 3300050509 Bacteria 7834
504 nmdc:mga06r32_237637_c1 3300050510 Bacteria 1810
505 nmdc:mga06r32_27771_c1 3300050510 Bacteria 5291
506 nmdc:mga06r32_289_c1 3300050510 Bacteria 41773
507 nmdc:mga06r32_9691_c1 3300050510 Bacteria 8703
508 nmdc:mga08y16_16366_c1 3300050511 Bacteria 7797
509 nmdc:mga08y16_326_c1 3300050511 Bacteria 43249
510 nmdc:mga08y16_45923_c1 3300050511 Bacteria 4575
511 nmdc:mga0n895_10230_c1 3300050512 Bacteria 8264
512 nmdc:mga0n895_107985_c1 3300050512 Bacteria 2797
513 nmdc:mga0n895_11454_c1 3300050512 Bacteria 7912
514 nmdc:mga0n895_607_c1 3300050512 Bacteria 24823
515 nmdc:mga0rr50_13607_c1 3300050513 Bacteria 5304
516 nmdc:mga0rr50_18914_c1 3300050513 Bacteria 4639
517 nmdc:mga0rr50_314058_c1 3300050513 Unclassified 1313
518 nmdc:mga08x19_297048_c1 3300050514 Bacteria 1121
519 nmdc:mga0a205_699_c1 3300050515 Bacteria 26913
520 nmdc:mga0sz30_15_c1 3300050516 Bacteria 83405
521 nmdc:mga0sz30_906_c1 3300050516 Bacteria 10657
522 Ga0495601_0015061 3300053077 Bacteria 4670
523 Ga0495601_0077875 3300053077 Unclassified 2123
524 Ga0500635_0014361 3300053080 Bacteria 2319
525 Ga0495595_0000180 3300053084 Bacteria 25223
526 Ga0495619_0023652 3300053085 Bacteria 3940
527 Ga0500643_000097 3300053087 Bacteria 92120
528 Ga0500647_0026590 3300053091 Bacteria 2730
529 Ga0500651_0000964 3300053093 Bacteria 14147
530 Ga0500566_0000009 3300053094 Bacteria 131668
531 Ga0500566_0000029 3300053094 Bacteria 75384
532 Ga0500640_018844 3300053095 Bacteria 2949
533 Ga0500641_0027513 3300053096 Bacteria 2214
534 Ga0500555_003423 3300053103 Bacteria 4523
535 Ga0500556_0001943 3300053104 Bacteria 7309
536 Ga0500572_000142 3300053111 Bacteria 24469
537 Ga0500595_002504 3300053119 Bacteria 9073
538 Ga0500595_004564 3300053119 Bacteria 6183
539 Ga0500595_014813 3300053119 Bacteria 2947
540 Ga0500608_005239 3300053122 Bacteria 5127
541 Ga0500608_081297 3300053122 Bacteria 1528
542 Ga0500614_002205 3300053123 Bacteria 4415
543 Ga0500603_000016 3300053150 Bacteria 56563
544 Ga0500604_0018905 3300053151 Bacteria 1925
545 Ga0500620_003225 3300053155 Bacteria 3452
546 Ga0500622_0047979 3300053156 Bacteria 2204
547 Ga0500630_000034 3300053159 Bacteria 38552
548 Ga0500634_0079014 3300053161 Bacteria 1701
549 Ga0500638_088424 3300053162 Bacteria 1462
550 Ga0500639_000017 3300053163 Bacteria 114464
551 Ga0500636_0000420 3300053177 Bacteria 23339
552 Ga0500637_0022250 3300053178 Bacteria 3452
553 Ga0500637_0033234 3300053178 Bacteria 2880
554 Ga0500645_030151 3300053730 Bacteria 1634
555 Ga0500609_000642 3300053731 Bacteria 5318
556 Ga0500601_000149 3300053737 Bacteria 14513

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046694 Ga0495649_0093385 Ga0495649_0093385_11_1015 298
2 3300047472 Ga0495686_0053148 Ga0495686_0053148_998_2173 304
3 3300048929 Ga0496126_0106425 Ga0496126_0106425_1386_2432 311
4 3300048918 Ga0496115_0179133 Ga0496115_0179133_564_1739 313
5 3300048929 Ga0496126_0013853 Ga0496126_0013853_6366_7541 313
6 3300005338 Ga0068868_100089122 Ga0068868_1000891223 316
7 3300006195 Ga0075366_10109445 Ga0075366_101094452 316
8 3300006871 Ga0075434_100290929 Ga0075434_1002909292 316
9 3300026067 Ga0207678_10147298 Ga0207678_101472981 316
10 3300026116 Ga0207674_10068585 Ga0207674_100685852 316
11 3300048909 Ga0496106_0135656 Ga0496106_0135656_552_1730 316
12 3300046684 Ga0495669_0103791 Ga0495669_0103791_22_1071 318
13 3300047472 Ga0495686_0077384 Ga0495686_0077384_975_2024 318
14 iso_pu_bacteria 8016557553 8016562238 319
15 3300025908 Ga0207643_10073125 Ga0207643_100731252 323
16 3300025935 Ga0207709_10090925 Ga0207709_100909252 323
17 3300003215 JGI25153J46596_10000483 JGI25153J46596_100004835 326
18 3300003794 Ga0055531_10012320 Ga0055531_100123205 326
19 3300025297 Ga0209758_1000024 Ga0209758_1000024185 326
20 3300025304 Ga0209257_1000416 Ga0209257_100041635 326
21 3300047469 Ga0495673_0099165 Ga0495673_0099165_52_1149 326
22 3300005337 Ga0070682_100110139 Ga0070682_1001101392 327
23 3300005455 Ga0070663_100006379 Ga0070663_1000063796 327
24 3300005548 Ga0070665_100002914 Ga0070665_1000029146 327
25 3300006048 Ga0075363_100005934 Ga0075363_1000059343 327
26 3300006051 Ga0075364_10045672 Ga0075364_100456723 327
27 3300006353 Ga0075370_10024530 Ga0075370_100245303 327
28 3300009177 Ga0105248_10425602 Ga0105248_104256022 327
29 3300011119 Ga0105246_10128980 Ga0105246_101289802 327
30 3300014325 Ga0163163_10015404 Ga0163163_100154046 327
31 3300026067 Ga0207678_10002397 Ga0207678_1000239711 327
32 3300028379 Ga0268266_10001022 Ga0268266_1000102212 327
33 3300046660 Ga0495625_0110434 Ga0495625_0110434_531_1706 327
34 3300048917 Ga0496114_0107054 Ga0496114_0107054_105_1283 327
35 3300050490 nmdc:mga03n38_2843_c1 nmdc:mga03n38_2843_c1_2305_3483 327
36 3300050491 nmdc:mga00v17_38782_c1 nmdc:mga00v17_38782_c1_555_1733 327
37 3300050494 nmdc:mga06z11_2034_c1 nmdc:mga06z11_2034_c1_3705_4883 327
38 3300050496 nmdc:mga07m45_10894_c1 nmdc:mga07m45_10894_c1_1967_3145 327
39 3300046507 Ga0495606_0011605 Ga0495606_0011605_4246_5373 328
40 3300048912 Ga0496109_0124509 Ga0496109_0124509_877_2004 328
41 3300005983 Ga0081540_1067943 Ga0081540_10679432 330
42 3300006844 Ga0075428_100001568 Ga0075428_1000015686 331
43 3300006846 Ga0075430_100014903 Ga0075430_1000149032 331
44 3300006847 Ga0075431_100000110 Ga0075431_10000011038 331
45 3300009094 Ga0111539_10000570 Ga0111539_1000057043 331
46 3300009147 Ga0114129_10000766 Ga0114129_1000076633 331
47 3300025272 Ga0209455_1012420 Ga0209455_10124203 331
48 3300025941 Ga0207711_10029434 Ga0207711_100294342 331
49 3300027907 Ga0207428_10007040 Ga0207428_100070402 331
50 3300050507 nmdc:mga05p37_160_c1 nmdc:mga05p37_160_c1_26877_28061 331
51 3300050509 nmdc:mga0qj67_15607_c1 nmdc:mga0qj67_15607_c1_1853_3037 331
52 3300050510 nmdc:mga06r32_289_c1 nmdc:mga06r32_289_c1_4743_5927 331
53 3300050511 nmdc:mga08y16_326_c1 nmdc:mga08y16_326_c1_5299_6483 331
54 3300005436 Ga0070713_100150664 Ga0070713_1001506642 332
55 3300005455 Ga0070663_100144252 Ga0070663_1001442522 332
56 3300009148 Ga0105243_10007473 Ga0105243_100074733 332
57 3300025254 Ga0209148_1012845 Ga0209148_10128452 332
58 3300025261 Ga0209233_1004746 Ga0209233_10047463 332
59 3300049460 Ga0495682_0016089 Ga0495682_0016089_38_1075 332
60 3300048908 Ga0496105_0011260 Ga0496105_0011260_5965_7005 333
61 3300005983 Ga0081540_1016727 Ga0081540_10167272 334
62 3300032005 Ga0307411_10027550 Ga0307411_100275504 334
63 3300005937 Ga0081455_10000715 Ga0081455_100007159 335
64 3300003752 Ga0055539_1005156 Ga0055539_10051562 336
65 3300005347 Ga0070668_100112145 Ga0070668_1001121452 336
66 3300005844 Ga0068862_100188168 Ga0068862_1001881682 336
67 3300025253 Ga0209677_102808 Ga0209677_1028082 336
68 3300048907 Ga0496104_0066176 Ga0496104_0066176_50_1099 336
69 3300050514 nmdc:mga08x19_297048_c1 nmdc:mga08x19_297048_c1_24_1067 336
70 3300006871 Ga0075434_100002679 Ga0075434_1000026795 337
71 3300025295 Ga0209564_1007333 Ga0209564_10073333 337
72 3300025299 Ga0209256_1006206 Ga0209256_10062062 337
73 3300050512 nmdc:mga0n895_11454_c1 nmdc:mga0n895_11454_c1_3348_4508 337
74 3300050513 nmdc:mga0rr50_13607_c1 nmdc:mga0rr50_13607_c1_862_2022 337
75 3300046460 Ga0495638_0002575 Ga0495638_0002575_6771_7943 338
76 3300048924 Ga0496121_0103860 Ga0496121_0103860_482_1672 338
77 3300005983 Ga0081540_1002452 Ga0081540_10024523 339
78 3300025972 Ga0207668_10051323 Ga0207668_100513233 339
79 3300046475 Ga0495639_0103180 Ga0495639_0103180_32_1090 339
80 3300050513 nmdc:mga0rr50_314058_c1 nmdc:mga0rr50_314058_c1_184_1236 339
81 3300053094 Ga0500566_0000029 Ga0500566_0000029_71555_72727 339
82 3300005347 Ga0070668_100020486 Ga0070668_1000204862 340
83 3300005456 Ga0070678_100207550 Ga0070678_1002075502 340
84 3300005459 Ga0068867_100125340 Ga0068867_1001253402 340
85 3300005548 Ga0070665_100179991 Ga0070665_1001799912 340
86 3300006038 Ga0075365_10137808 Ga0075365_101378081 340
87 3300006353 Ga0075370_10045416 Ga0075370_100454162 340
88 3300010375 Ga0105239_10023240 Ga0105239_100232402 340
89 3300013306 Ga0163162_10171322 Ga0163162_101713222 340
90 3300025945 Ga0207679_10220388 Ga0207679_102203882 340
91 3300025972 Ga0207668_10014288 Ga0207668_100142882 340
92 3300031995 Ga0307409_100041610 Ga0307409_1000416101 340
93 3300032126 Ga0307415_100062558 Ga0307415_1000625582 340
94 3300046674 Ga0495588_0010521 Ga0495588_0010521_140_1312 340
95 3300048908 Ga0496105_0006689 Ga0496105_0006689_3667_4839 340
96 3300048913 Ga0496110_0016254 Ga0496110_0016254_1698_2870 340
97 3300048917 Ga0496114_0027824 Ga0496114_0027824_10_1182 340
98 3300048922 Ga0496119_0090890 Ga0496119_0090890_441_1613 340
99 3300048924 Ga0496121_0036811 Ga0496121_0036811_974_2146 340
100 3300048929 Ga0496126_0017979 Ga0496126_0017979_1759_2931 340
101 3300048929 Ga0496126_0040784 Ga0496126_0040784_65_1237 340
102 3300050496 nmdc:mga07m45_40886_c1 nmdc:mga07m45_40886_c1_659_1831 340
103 3300005355 Ga0070671_100057356 Ga0070671_1000573564 341
104 3300005455 Ga0070663_100025905 Ga0070663_1000259052 341
105 3300005456 Ga0070678_100080606 Ga0070678_1000806062 341
106 3300005563 Ga0068855_100070455 Ga0068855_1000704552 341
107 3300005614 Ga0068856_100018995 Ga0068856_1000189956 341
108 3300005618 Ga0068864_100091296 Ga0068864_1000912963 341
109 3300005841 Ga0068863_100178915 Ga0068863_1001789152 341
110 3300005983 Ga0081540_1011193 Ga0081540_10111935 341
111 3300006048 Ga0075363_100123712 Ga0075363_1001237122 341
112 3300006186 Ga0075369_10040648 Ga0075369_100406482 341
113 3300007076 Ga0075435_100208044 Ga0075435_1002080442 341
114 3300009094 Ga0111539_10143480 Ga0111539_101434803 341
115 3300009101 Ga0105247_10019784 Ga0105247_100197845 341
116 3300009101 Ga0105247_10222243 Ga0105247_102222431 341
117 3300009174 Ga0105241_10034717 Ga0105241_100347172 341
118 3300009174 Ga0105241_10064231 Ga0105241_100642313 341
119 3300009176 Ga0105242_10266828 Ga0105242_102668282 341
120 3300009551 Ga0105238_10076600 Ga0105238_100766002 341
121 3300011119 Ga0105246_10213564 Ga0105246_102135642 341
122 3300013296 Ga0157374_10124771 Ga0157374_101247712 341
123 3300014969 Ga0157376_10135314 Ga0157376_101353142 341
124 3300025927 Ga0207687_10003095 Ga0207687_100030952 341
125 3300025935 Ga0207709_10095924 Ga0207709_100959242 341
126 3300025949 Ga0207667_10284840 Ga0207667_102848402 341
127 3300026067 Ga0207678_10003316 Ga0207678_100033166 341
128 3300026095 Ga0207676_10079181 Ga0207676_100791812 341
129 3300026121 Ga0207683_10211671 Ga0207683_102116712 341
130 3300046457 Ga0495590_0050120 Ga0495590_0050120_119_1291 341
131 3300046522 Ga0495643_0026380 Ga0495643_0026380_1415_2587 341
132 3300046660 Ga0495625_0145442 Ga0495625_0145442_34_1131 341
133 3300048904 Ga0496101_0016299 Ga0496101_0016299_2478_3650 341
134 3300048915 Ga0496112_0182165 Ga0496112_0182165_116_1294 341
135 3300053161 Ga0500634_0079014 Ga0500634_0079014_171_1346 341
136 3300005327 Ga0070658_10018856 Ga0070658_100188564 342
137 3300005337 Ga0070682_100031621 Ga0070682_1000316212 342
138 3300005455 Ga0070663_100003069 Ga0070663_1000030694 342
139 3300005616 Ga0068852_100130956 Ga0068852_1001309562 342
140 3300025909 Ga0207705_10029754 Ga0207705_100297542 342
141 3300026067 Ga0207678_10014230 Ga0207678_100142305 342
142 3300046642 Ga0495634_0020002 Ga0495634_0020002_123_1295 342
143 3300046690 Ga0495624_0062665 Ga0495624_0062665_1113_2285 342
144 3300047317 Ga0495604_0053329 Ga0495604_0053329_436_1608 342
145 3300047471 Ga0495684_0003077 Ga0495684_0003077_4370_5542 342
146 3300048924 Ga0496121_0077900 Ga0496121_0077900_405_1580 342
147 3300048924 Ga0496121_0104972 Ga0496121_0104972_495_1640 342
148 3300050492 nmdc:mga0yw44_125676_c1 nmdc:mga0yw44_125676_c1_418_1590 342
149 3300053731 Ga0500609_000642 Ga0500609_000642_2555_3727 342
150 3300006847 Ga0075431_100145708 Ga0075431_1001457082 343
151 3300009094 Ga0111539_10300573 Ga0111539_103005732 343
152 3300021441 Ga0213871_10005103 Ga0213871_100051032 343
153 3300035086 Ga0373934_0015153 Ga0373934_0015153_495_1664 343
154 3300035118 Ga0373954_0001354 Ga0373954_0001354_2804_3973 343
155 3300035119 Ga0373956_0006917 Ga0373956_0006917_1378_2547 343
156 3300035172 Ga0373955_0001045 Ga0373955_0001045_7437_8606 343
157 3300035410 Ga0373924_0003482 Ga0373924_0003482_1116_2285 343
158 3300035724 Ga0373933_0001089 Ga0373933_0001089_1356_2525 343
159 3300036401 Ga0373937_0006280 Ga0373937_0006280_2084_3253 343
160 3300039447 Ga0436361_0961182 Ga0436361_0961182_1034_2341 343
161 3300046454 Ga0495592_0008630 Ga0495592_0008630_1198_2367 343
162 3300046459 Ga0495629_0008997 Ga0495629_0008997_2135_3304 343
163 3300046462 Ga0495651_0033585 Ga0495651_0033585_698_1867 343
164 3300046463 Ga0495653_0013015 Ga0495653_0013015_2158_3327 343
165 3300046511 Ga0495608_0002629 Ga0495608_0002629_7560_8729 343
166 3300046516 Ga0495628_0057941 Ga0495628_0057941_809_1978 343
167 3300046533 Ga0495640_0015625 Ga0495640_0015625_983_2152 343
168 3300046536 Ga0495587_0036423 Ga0495587_0036423_1615_2784 343
169 3300046543 Ga0495645_0002685 Ga0495645_0002685_5844_7013 343
170 3300046559 Ga0495667_0013388 Ga0495667_0013388_1059_2228 343
171 3300046642 Ga0495634_0010658 Ga0495634_0010658_1508_2677 343
172 3300046663 Ga0495635_0002628 Ga0495635_0002628_6249_7418 343
173 3300046675 Ga0495657_0038615 Ga0495657_0038615_1418_2587 343
174 3300046678 Ga0495599_0001303 Ga0495599_0001303_11902_13071 343
175 3300046680 Ga0495646_0015281 Ga0495646_0015281_1615_2784 343
176 3300046809 Ga0495600_0004004 Ga0495600_0004004_6363_7532 343
177 3300047317 Ga0495604_0029571 Ga0495604_0029571_1772_2941 343
178 3300047322 Ga0495680_0002436 Ga0495680_0002436_698_1867 343
179 3300047444 Ga0495675_0055280 Ga0495675_0055280_698_1867 343
180 3300047471 Ga0495684_0003990 Ga0495684_0003990_8728_9897 343
181 3300047673 Ga0495593_0002110 Ga0495593_0002110_3544_4713 343
182 3300048924 Ga0496121_0000178 Ga0496121_0000178_91974_93152 343
183 3300050510 nmdc:mga06r32_237637_c1 nmdc:mga06r32_237637_c1_44_1228 343
184 3300050511 nmdc:mga08y16_45923_c1 nmdc:mga08y16_45923_c1_480_1664 343
185 3300053077 Ga0495601_0015061 Ga0495601_0015061_1128_2297 343
186 3300053084 Ga0495595_0000180 Ga0495595_0000180_18017_19186 343
187 3300053085 Ga0495619_0023652 Ga0495619_0023652_1394_2563 343
188 3300053737 Ga0500601_000149 Ga0500601_000149_8906_10078 343
189 3300003354 JGI25160J50197_1001806 JGI25160J50197_10018063 344
190 3300005262 Ga0065165_1006645 Ga0065165_10066452 344
191 3300025230 Ga0209563_101772 Ga0209563_1017722 344
192 3300025253 Ga0209677_101975 Ga0209677_10197510 344
193 3300025297 Ga0209758_1008134 Ga0209758_10081345 344
194 3300025302 Ga0207426_1002648 Ga0207426_100264811 344
195 3300005937 Ga0081455_10043485 Ga0081455_100434852 345
196 3300005262 Ga0065165_1000342 Ga0065165_100034243 346
197 3300053178 Ga0500637_0022250 Ga0500637_0022250_1823_2995 346
198 3300025919 Ga0207657_10210886 Ga0207657_102108862 347
199 3300028573 Ga0265334_10011662 Ga0265334_100116622 347
200 3300047472 Ga0495686_0090192 Ga0495686_0090192_287_1471 347
201 3300005293 Ga0065715_10001703 Ga0065715_100017033 348
202 3300005548 Ga0070665_100182195 Ga0070665_1001821952 348
203 3300005518 Ga0070699_100182703 Ga0070699_1001827032 349
204 3300005937 Ga0081455_10074473 Ga0081455_100744732 349
205 3300006871 Ga0075434_100013294 Ga0075434_1000132946 349
206 3300009177 Ga0105248_10311580 Ga0105248_103115802 349
207 3300050512 nmdc:mga0n895_10230_c1 nmdc:mga0n895_10230_c1_979_2154 349
208 3300003659 JGI25404J52841_10000205 JGI25404J52841_100002053 350
209 3300005439 Ga0070711_100038316 Ga0070711_1000383164 350
210 3300005983 Ga0081540_1000002 Ga0081540_100000251 350
211 3300006175 Ga0070712_100010060 Ga0070712_1000100607 350
212 3300006844 Ga0075428_100064532 Ga0075428_1000645322 350
213 3300006846 Ga0075430_100011000 Ga0075430_10001100011 350
214 3300006847 Ga0075431_100085094 Ga0075431_1000850942 350
215 3300006852 Ga0075433_10001538 Ga0075433_100015387 350
216 3300006880 Ga0075429_100010965 Ga0075429_1000109652 350
217 3300009094 Ga0111539_10278953 Ga0111539_102789532 350
218 3300009147 Ga0114129_10257021 Ga0114129_102570212 350
219 3300025906 Ga0207699_10006269 Ga0207699_100062693 350
220 3300025915 Ga0207693_10003198 Ga0207693_100031989 350
221 3300025916 Ga0207663_10026736 Ga0207663_100267364 350
222 3300027907 Ga0207428_10002129 Ga0207428_100021299 350
223 3300050508 nmdc:mga09592_15829_c1 nmdc:mga09592_15829_c1_214_1386 350
224 3300050509 nmdc:mga0qj67_1410_c1 nmdc:mga0qj67_1410_c1_2062_3234 350
225 3300050510 nmdc:mga06r32_27771_c1 nmdc:mga06r32_27771_c1_2098_3270 350
226 3300050512 nmdc:mga0n895_607_c1 nmdc:mga0n895_607_c1_4199_5371 350
227 3300050513 nmdc:mga0rr50_18914_c1 nmdc:mga0rr50_18914_c1_1706_2878 350
228 3300050515 nmdc:mga0a205_699_c1 nmdc:mga0a205_699_c1_6752_7924 350
229 3300005334 Ga0068869_100042182 Ga0068869_1000421822 351
230 3300005340 Ga0070689_100070251 Ga0070689_1000702512 351
231 3300005434 Ga0070709_10033314 Ga0070709_100333141 351
232 3300005435 Ga0070714_100033979 Ga0070714_1000339792 351
233 3300005983 Ga0081540_1001470 Ga0081540_100147021 351
234 3300006028 Ga0070717_10024876 Ga0070717_100248762 351
235 3300006173 Ga0070716_100059836 Ga0070716_1000598362 351
236 3300006177 Ga0075362_10087247 Ga0075362_100872472 351
237 3300009147 Ga0114129_10167269 Ga0114129_101672692 351
238 3300025916 Ga0207663_10011977 Ga0207663_100119772 351
239 3300025929 Ga0207664_10007583 Ga0207664_100075832 351
240 3300025936 Ga0207670_10105169 Ga0207670_101051692 351
241 3300025939 Ga0207665_10000779 Ga0207665_1000077914 351
242 3300032005 Ga0307411_10092584 Ga0307411_100925842 351
243 3300046518 Ga0495631_0050058 Ga0495631_0050058_172_1347 351
244 3300048088 Ga0495602_0099140 Ga0495602_0099140_722_1900 351
245 3300050489 nmdc:mga03683_32382_c1 nmdc:mga03683_32382_c1_54_1202 351
246 3300053119 Ga0500595_002504 Ga0500595_002504_2611_3786 351
247 3300053162 Ga0500638_088424 Ga0500638_088424_241_1416 351
248 3300003215 JGI25153J46596_10001586 JGI25153J46596_100015861 352
249 3300003215 JGI25153J46596_10001963 JGI25153J46596_100019639 352
250 3300003354 JGI25160J50197_1000413 JGI25160J50197_10004132 352
251 3300005364 Ga0070673_100373731 Ga0070673_1003737311 352
252 3300005548 Ga0070665_100006487 Ga0070665_10000648712 352
253 3300005618 Ga0068864_100190673 Ga0068864_1001906732 352
254 3300005937 Ga0081455_10010592 Ga0081455_100105928 352
255 3300006353 Ga0075370_10026246 Ga0075370_100262464 352
256 3300025261 Ga0209233_1002127 Ga0209233_10021274 352
257 3300025295 Ga0209564_1003588 Ga0209564_10035885 352
258 3300025297 Ga0209758_1006334 Ga0209758_10063343 352
259 3300025297 Ga0209758_1007918 Ga0209758_10079189 352
260 3300025297 Ga0209758_1029049 Ga0209758_10290493 352
261 3300025299 Ga0209256_1021882 Ga0209256_10218822 352
262 3300025302 Ga0207426_1000237 Ga0207426_100023735 352
263 3300025907 Ga0207645_10151084 Ga0207645_101510842 352
264 3300028379 Ga0268266_10005075 Ga0268266_1000507514 352
265 3300031995 Ga0307409_100033655 Ga0307409_1000336552 352
266 3300033180 Ga0307510_10014098 Ga0307510_100140985 352
267 3300046660 Ga0495625_0074786 Ga0495625_0074786_355_1527 352
268 3300048915 Ga0496112_0097976 Ga0496112_0097976_360_1532 352
269 3300048916 Ga0496113_0085819 Ga0496113_0085819_618_1790 352
270 3300048924 Ga0496121_0001346 Ga0496121_0001346_19636_20811 352
271 3300048924 Ga0496121_0104292 Ga0496121_0104292_303_1475 352
272 3300053087 Ga0500643_000097 Ga0500643_000097_45750_46922 352
273 3300053103 Ga0500555_003423 Ga0500555_003423_831_2003 352
274 3300053104 Ga0500556_0001943 Ga0500556_0001943_3501_4673 352
275 3300053151 Ga0500604_0018905 Ga0500604_0018905_726_1898 352
276 3300053156 Ga0500622_0047979 Ga0500622_0047979_666_1838 352
277 3300006038 Ga0075365_10038349 Ga0075365_100383492 353
278 3300006177 Ga0075362_10001097 Ga0075362_100010976 353
279 3300006178 Ga0075367_10001959 Ga0075367_100019596 353
280 3300006353 Ga0075370_10007764 Ga0075370_100077642 353
281 3300006844 Ga0075428_100072013 Ga0075428_1000720132 353
282 3300006846 Ga0075430_100040472 Ga0075430_1000404722 353
283 3300006847 Ga0075431_100064670 Ga0075431_1000646702 353
284 3300006880 Ga0075429_100046476 Ga0075429_1000464762 353
285 3300009094 Ga0111539_10073473 Ga0111539_100734732 353
286 3300009147 Ga0114129_10200337 Ga0114129_102003372 353
287 3300025297 Ga0209758_1003797 Ga0209758_10037976 353
288 3300027907 Ga0207428_10011549 Ga0207428_100115492 353
289 3300031507 Ga0307509_10174701 Ga0307509_101747012 353
290 3300045049 Ga0466959_0083273 Ga0466959_0083273_1017_2246 353
291 3300050489 nmdc:mga03683_672_c1 nmdc:mga03683_672_c1_1920_3218 353
292 3300050494 nmdc:mga06z11_5543_c1 nmdc:mga06z11_5543_c1_1919_3217 353
293 3300050496 nmdc:mga07m45_8693_c1 nmdc:mga07m45_8693_c1_3697_4995 353
294 3300050507 nmdc:mga05p37_12561_c1 nmdc:mga05p37_12561_c1_6802_7974 353
295 3300050508 nmdc:mga09592_2214_c1 nmdc:mga09592_2214_c1_14266_15438 353
296 3300050509 nmdc:mga0qj67_7961_c1 nmdc:mga0qj67_7961_c1_2138_3310 353
297 3300050510 nmdc:mga06r32_9691_c1 nmdc:mga06r32_9691_c1_2098_3270 353
298 3300050511 nmdc:mga08y16_16366_c1 nmdc:mga08y16_16366_c1_6458_7630 353
299 3300050516 nmdc:mga0sz30_15_c1 nmdc:mga0sz30_15_c1_1175_2473 353
300 3300053080 Ga0500635_0014361 Ga0500635_0014361_955_2127 353
301 3300053122 Ga0500608_081297 Ga0500608_081297_148_1320 353
302 3300053155 Ga0500620_003225 Ga0500620_003225_2005_3177 353
303 3300053177 Ga0500636_0000420 Ga0500636_0000420_1395_2567 353
304 3300021384 Ga0213876_10035942 Ga0213876_100359423 354
305 3300025915 Ga0207693_10030609 Ga0207693_100306092 354
306 3300039437 Ga0436365_0999537 Ga0436365_0999537_3042_4214 354
307 3300046463 Ga0495653_0077153 Ga0495653_0077153_848_2020 354
308 3300046476 Ga0495662_0008323 Ga0495662_0008323_1286_2458 354
309 3300046477 Ga0495664_0011428 Ga0495664_0011428_3185_4357 354
310 3300053077 Ga0495601_0077875 Ga0495601_0077875_246_1418 354
311 3300053119 Ga0500595_014813 Ga0500595_014813_877_2046 354
312 3300007265 Ga0099794_10016490 Ga0099794_100164902 355
313 3300046517 Ga0495630_0057520 Ga0495630_0057520_755_1927 355
314 3300003215 JGI25153J46596_10000912 JGI25153J46596_1000091215 356
315 3300005983 Ga0081540_1000021 Ga0081540_10000212 356
316 3300006038 Ga0075365_10122771 Ga0075365_101227712 356
317 3300025297 Ga0209758_1000139 Ga0209758_1000139167 356
318 3300050492 nmdc:mga0yw44_104964_c1 nmdc:mga0yw44_104964_c1_137_1321 356
319 3300046459 Ga0495629_0058992 Ga0495629_0058992_516_1688 357
320 iso_pu_bacteria 8019629233 8019638482 357
321 3300003659 JGI25404J52841_10013508 JGI25404J52841_100135082 358
322 3300005983 Ga0081540_1006015 Ga0081540_10060157 358
323 3300009545 Ga0105237_10248843 Ga0105237_102488432 358
324 3300031507 Ga0307509_10152254 Ga0307509_101522542 358
325 3300033180 Ga0307510_10061641 Ga0307510_100616413 358
326 3300048918 Ga0496115_0075330 Ga0496115_0075330_878_2185 358
327 3300048920 Ga0496117_0055679 Ga0496117_0055679_710_1885 358
328 3300050496 nmdc:mga07m45_38426_c1 nmdc:mga07m45_38426_c1_269_1444 358
329 3300005289 Ga0065704_10140706 Ga0065704_101407062 359
330 3300005347 Ga0070668_100053069 Ga0070668_1000530692 359
331 3300005354 Ga0070675_100307231 Ga0070675_1003072311 359
332 3300005367 Ga0070667_100351286 Ga0070667_1003512861 359
333 3300005471 Ga0070698_100094727 Ga0070698_1000947272 359
334 3300005518 Ga0070699_100011652 Ga0070699_1000116528 359
335 3300005539 Ga0068853_100215198 Ga0068853_1002151981 359
336 3300005546 Ga0070696_100025911 Ga0070696_1000259112 359
337 3300009101 Ga0105247_10047000 Ga0105247_100470001 359
338 3300013296 Ga0157374_10251751 Ga0157374_102517511 359
339 3300025904 Ga0207647_10057719 Ga0207647_100577192 359
340 3300025910 Ga0207684_10182359 Ga0207684_101823592 359
341 3300025972 Ga0207668_10017270 Ga0207668_100172702 359
342 3300025972 Ga0207668_10038101 Ga0207668_100381012 359
343 3300028379 Ga0268266_10050761 Ga0268266_100507612 359
344 3300028381 Ga0268264_10156706 Ga0268264_101567062 359
345 3300046520 Ga0495637_0077350 Ga0495637_0077350_13_1188 359
346 3300046615 Ga0495656_0047775 Ga0495656_0047775_156_1334 359
347 3300048913 Ga0496110_0282219 Ga0496110_0282219_257_1435 359
348 3300005457 Ga0070662_100029456 Ga0070662_1000294563 360
349 3300005471 Ga0070698_100000373 Ga0070698_10000037321 360
350 3300013306 Ga0163162_10151128 Ga0163162_101511283 360
351 3300025961 Ga0207712_10017511 Ga0207712_100175112 360
352 3300028380 Ga0268265_10016290 Ga0268265_100162903 360
353 3300046455 Ga0495603_0021639 Ga0495603_0021639_2000_3178 360
354 3300046557 Ga0495622_0038526 Ga0495622_0038526_361_1539 360
355 3300048905 Ga0496102_0098305 Ga0496102_0098305_1456_2634 360
356 3300050491 nmdc:mga00v17_86617_c1 nmdc:mga00v17_86617_c1_210_1388 360
357 3300005536 Ga0070697_100154624 Ga0070697_1001546242 361
358 3300010159 Ga0099796_10019757 Ga0099796_100197572 361
359 3300025928 Ga0207700_10065195 Ga0207700_100651953 361
360 3300046616 Ga0495668_0034892 Ga0495668_0034892_1047_2225 361
361 3300006028 Ga0070717_10165456 Ga0070717_101654561 362
362 3300005844 Ga0068862_100149351 Ga0068862_1001493512 363
363 3300006914 Ga0075436_100000863 Ga0075436_1000008634 363
364 3300007076 Ga0075435_100103087 Ga0075435_1001030873 363
365 3300026075 Ga0207708_10061683 Ga0207708_100616831 363
366 3300037068 Ga0373925_0189165 Ga0373925_0189165_228_1400 363
367 3300048915 Ga0496112_0168225 Ga0496112_0168225_225_1403 363
368 3300053096 Ga0500641_0027513 Ga0500641_0027513_355_1533 364
369 3300005436 Ga0070713_100175591 Ga0070713_1001755911 365
370 3300006028 Ga0070717_10198724 Ga0070717_101987242 365
371 3300006173 Ga0070716_100126585 Ga0070716_1001265851 365
372 3300006175 Ga0070712_100056649 Ga0070712_1000566492 365
373 3300013308 Ga0157375_10356457 Ga0157375_103564572 365
374 3300025906 Ga0207699_10057284 Ga0207699_100572842 365
375 3300025928 Ga0207700_10043818 Ga0207700_100438184 365
376 3300025939 Ga0207665_10018743 Ga0207665_100187433 365
377 3300025940 Ga0207691_10241364 Ga0207691_102413642 365
378 3300046474 Ga0495605_0023824 Ga0495605_0023824_587_1765 365
379 3300046492 Ga0495585_0021409 Ga0495585_0021409_621_1799 365
380 3300046519 Ga0495632_0042259 Ga0495632_0042259_331_1509 365
381 3300046520 Ga0495637_0046525 Ga0495637_0046525_237_1415 365
382 3300046539 Ga0495621_0003718 Ga0495621_0003718_11_1189 365
383 3300046648 Ga0495611_0006627 Ga0495611_0006627_3545_4723 365
384 3300046664 Ga0495659_0037244 Ga0495659_0037244_298_1476 365
385 3300046684 Ga0495669_0004419 Ga0495669_0004419_4447_5625 365
386 3300046692 Ga0495671_0130530 Ga0495671_0130530_11_1189 365
387 3300050512 nmdc:mga0n895_107985_c1 nmdc:mga0n895_107985_c1_483_1658 365
388 3300009553 Ga0105249_10457758 Ga0105249_104577581 366
389 3300025931 Ga0207644_10145448 Ga0207644_101454482 366
390 3300031090 Ga0265760_10022120 Ga0265760_100221202 366
391 3300046664 Ga0495659_0041900 Ga0495659_0041900_278_1462 366
392 3300047321 Ga0495676_0106458 Ga0495676_0106458_876_2048 366
393 3300048929 Ga0496126_0045621 Ga0496126_0045621_423_1607 366
394 3300005441 Ga0070700_100047395 Ga0070700_1000473952 367
395 3300005467 Ga0070706_100093913 Ga0070706_1000939132 367
396 3300006038 Ga0075365_10005374 Ga0075365_100053745 367
397 3300006051 Ga0075364_10067396 Ga0075364_100673962 367
398 3300006844 Ga0075428_100064438 Ga0075428_1000644382 367
399 3300009147 Ga0114129_10045330 Ga0114129_100453302 367
400 3300013308 Ga0157375_10377689 Ga0157375_103776891 367
401 3300026088 Ga0207641_10051008 Ga0207641_100510083 367
402 3300026118 Ga0207675_100094094 Ga0207675_1000940942 367
403 3300046524 Ga0495648_0002795 Ga0495648_0002795_764_1948 367
404 3300046663 Ga0495635_0108406 Ga0495635_0108406_697_1869 367
405 3300046691 Ga0495670_0141359 Ga0495670_0141359_75_1247 367
406 3300003215 JGI25153J46596_10000288 JGI25153J46596_100002882 368
407 3300003215 JGI25153J46596_10001506 JGI25153J46596_100015069 368
408 3300003659 JGI25404J52841_10010408 JGI25404J52841_100104082 368
409 3300005937 Ga0081455_10000165 Ga0081455_1000016534 368
410 3300005983 Ga0081540_1003472 Ga0081540_10034724 368
411 3300025297 Ga0209758_1000209 Ga0209758_100020965 368
412 3300039438 Ga0436360_0435591 Ga0436360_0435591_921_2120 368
413 3300005518 Ga0070699_100018770 Ga0070699_1000187706 369
414 3300005518 Ga0070699_100389103 Ga0070699_1003891031 369
415 3300005536 Ga0070697_100069049 Ga0070697_1000690492 369
416 3300005983 Ga0081540_1003224 Ga0081540_10032242 369
417 3300007265 Ga0099794_10010403 Ga0099794_100104032 369
418 3300025910 Ga0207684_10105805 Ga0207684_101058052 369
419 3300039447 Ga0436361_0426039 Ga0436361_0426039_183_1367 369
420 3300053730 Ga0500645_030151 Ga0500645_030151_66_1250 369
421 3300006038 Ga0075365_10002250 Ga0075365_100022506 370
422 3300006178 Ga0075367_10001540 Ga0075367_100015407 370
423 3300006186 Ga0075369_10000106 Ga0075369_1000010622 370
424 3300006195 Ga0075366_10004804 Ga0075366_100048046 370
425 3300006353 Ga0075370_10003315 Ga0075370_100033155 370
426 3300010159 Ga0099796_10005417 Ga0099796_100054172 370
427 3300027512 Ga0209179_1000450 Ga0209179_10004503 370
428 3300048924 Ga0496121_0000868 Ga0496121_0000868_32948_34102 370
429 3300050490 nmdc:mga03n38_3844_c1 nmdc:mga03n38_3844_c1_1543_2727 370
430 3300050491 nmdc:mga00v17_27330_c1 nmdc:mga00v17_27330_c1_369_1553 370
431 3300050492 nmdc:mga0yw44_405_c1 nmdc:mga0yw44_405_c1_10377_11561 370
432 3300050493 nmdc:mga0k408_1338_c1 nmdc:mga0k408_1338_c1_24_1208 370
433 3300050494 nmdc:mga06z11_38_c1 nmdc:mga06z11_38_c1_4128_5312 370
434 3300050496 nmdc:mga07m45_106_c1 nmdc:mga07m45_106_c1_19204_20388 370
435 3300050516 nmdc:mga0sz30_906_c1 nmdc:mga0sz30_906_c1_4695_5879 370
436 iso_pu_bacteria 3005710791 3005712189 370
437 3300046524 Ga0495648_0008057 Ga0495648_0008057_3376_4560 371
438 3300048925 Ga0496122_0043294 Ga0496122_0043294_503_1687 371
439 3300048929 Ga0496126_0002980 Ga0496126_0002980_17972_19156 371
440 iso_pu_bacteria 2508501128 2509153951 371
441 iso_pu_bacteria 2876771140 2876771849 371
442 iso_pu_bacteria 2876818435 2876826547 371
443 iso_pu_bacteria 2879074833 2879075701 371
444 iso_pu_bacteria 2879142872 2879150421 371
445 iso_pu_bacteria 2889033259 2889037681 371
446 iso_pu_bacteria 2906626472 2906629563 371
447 iso_pu_bacteria 2935732158 2935733617 371
448 iso_pu_bacteria 2935741537 2935742996 371
449 iso_pu_bacteria 2935769743 2935773849 371
450 iso_pu_bacteria 2935785616 2935788715 371
451 iso_pu_bacteria 2935793552 2935795659 371
452 iso_pu_bacteria 2941531003 2941537440 371
453 iso_pu_bacteria 8016583857 8016588291 371
454 iso_pu_bacteria 8016622563 8016624867 371
455 iso_pu_bacteria 8019547302 8019551909 371
456 iso_pu_bacteria 8019638758 8019639803 371
457 iso_pu_bacteria 8019659431 8019667816 371
458 iso_pu_bacteria 2643221595 2643983712 372
459 iso_pu_bacteria 2643221627 2644157395 372
460 iso_pu_bacteria 2791355123 2792750404 372
461 iso_pu_bacteria 2869162929 2869168125 372
462 iso_pu_bacteria 2958064165 2958065407 372
463 3300005536 Ga0070697_100013409 Ga0070697_1000134092 373
464 3300005549 Ga0070704_100020603 Ga0070704_1000206032 373
465 3300010159 Ga0099796_10032891 Ga0099796_100328912 373
466 3300025922 Ga0207646_10225703 Ga0207646_102257031 373
467 3300039447 Ga0436361_0714685 Ga0436361_0714685_3487_4671 373
468 3300048907 Ga0496104_0059661 Ga0496104_0059661_1887_3071 373
469 3300048911 Ga0496108_0240300 Ga0496108_0240300_228_1412 373
470 3300048913 Ga0496110_0183101 Ga0496110_0183101_112_1296 373
471 3300048914 Ga0496111_0031450 Ga0496111_0031450_1635_2819 373
472 3300048915 Ga0496112_0219713 Ga0496112_0219713_435_1619 373
473 iso_pu_bacteria 2508501042 2508693909 373
474 iso_pu_bacteria 2513237095 2513651984 373
475 iso_pu_bacteria 2513237101 2513693841 373
476 iso_pu_bacteria 2513237102 2513702779 373
477 iso_pu_bacteria 2517093001 2517101018 373
478 iso_pu_bacteria 2524023205 2524442555 373
479 iso_pu_bacteria 2721755755 2723843365 373
480 iso_pu_bacteria 2744054633 2745075520 373
481 iso_pu_bacteria 2791355199 2793077910 373
482 iso_pu_bacteria 2816332527 2818239168 373
483 iso_pu_bacteria 2824600985 2824604854 373
484 iso_pu_bacteria 2824609381 2824611394 373
485 iso_pu_bacteria 2824617872 2824620251 373
486 iso_pu_bacteria 2824626560 2824629516 373
487 iso_pu_bacteria 2824635225 2824635836 373
488 iso_pu_bacteria 2824644064 2824646138 373
489 iso_pu_bacteria 2824653114 2824656081 373
490 iso_pu_bacteria 2824661429 2824663183 373
491 iso_pu_bacteria 2824704595 2824707712 373
492 iso_pu_bacteria 2824714736 2824716664 373
493 iso_pu_bacteria 2824723954 2824726621 373
494 iso_pu_bacteria 2824753945 2824757901 373
495 iso_pu_bacteria 2824763712 2824766967 373
496 iso_pu_bacteria 2824773399 2824774638 373
497 iso_pu_bacteria 2841957949 2841961241 373
498 iso_pu_bacteria 2849076700 2849078859 373
499 iso_pu_bacteria 2857509624 2857512505 373
500 iso_pu_bacteria 2874604998 2874611723 373
501 iso_pu_bacteria 2874612657 2874617371 373
502 iso_pu_bacteria 2874628541 2874633799 373
503 iso_pu_bacteria 2876761206 2876764494 373
504 iso_pu_bacteria 2876808645 2876816600 373
505 iso_pu_bacteria 2879099564 2879104213 373
506 iso_pu_bacteria 2879110137 2879114964 373
507 iso_pu_bacteria 2881364244 2881368275 373
508 iso_pu_bacteria 2885366525 2885369745 373
509 iso_pu_bacteria 2888378607 2888379199 373
510 iso_pu_bacteria 2888388044 2888389491 373
511 iso_pu_bacteria 2904690495 2904697107 373
512 iso_pu_bacteria 2904711408 2904712495 373
513 iso_pu_bacteria 2908756301 2908762624 373
514 iso_pu_bacteria 2929615660 2929620790 373
515 iso_pu_bacteria 2929624759 2929626684 373
516 iso_pu_bacteria 2932784394 2932784450 373
517 iso_pu_bacteria 2932809354 2932809433 373
518 iso_pu_bacteria 2932818245 2932818824 373
519 iso_pu_bacteria 2932828146 2932828220 373
520 iso_pu_bacteria 2933577622 2933582705 373
521 iso_pu_bacteria 2935608549 2935610163 373
522 iso_pu_bacteria 2935616580 2935617194 373
523 iso_pu_bacteria 2935638405 2935639325 373
524 iso_pu_bacteria 2935648319 2935650307 373
525 iso_pu_bacteria 2935656913 2935658454 373
526 iso_pu_bacteria 2935665750 2935665824 373
527 iso_pu_bacteria 2935675223 2935675470 373
528 iso_pu_bacteria 2935684952 2935685519 373
529 iso_pu_bacteria 2935694250 2935698768 373
530 iso_pu_bacteria 2935703347 2935704332 373
531 iso_pu_bacteria 2935713505 2935714072 373
532 iso_pu_bacteria 2935722832 2935724691 373
533 iso_pu_bacteria 2935732158 2935732951 373
534 iso_pu_bacteria 2935741537 2935742330 373
535 iso_pu_bacteria 2935750917 2935751484 373
536 iso_pu_bacteria 2935760218 2935765744 373
537 iso_pu_bacteria 2935769743 2935776866 373
538 iso_pu_bacteria 2935777560 2935778342 373
539 iso_pu_bacteria 2935785616 2935792876 373
540 iso_pu_bacteria 2935793552 2935800982 373
541 iso_pu_bacteria 2935801545 2935802414 373
542 iso_pu_bacteria 2935810662 2935811238 373
543 iso_pu_bacteria 2935819856 2935823323 373
544 iso_pu_bacteria 2935827899 2935828820 373
545 iso_pu_bacteria 2935837841 2935840194 373
546 iso_pu_bacteria 2935855204 2935855819 373
547 iso_pu_bacteria 2935864058 2935866238 373
548 iso_pu_bacteria 2935873716 2935877436 373
549 iso_pu_bacteria 2935984226 2935986019 373
550 iso_pu_bacteria 2935992306 2935992381 373
551 iso_pu_bacteria 2936002035 2936002253 373
552 iso_pu_bacteria 2936011229 2936013134 373
553 iso_pu_bacteria 2936019824 2936021779 373
554 iso_pu_bacteria 2936028420 2936030427 373
555 iso_pu_bacteria 2936037263 2936037342 373
556 iso_pu_bacteria 2936046547 2936047973 373
557 iso_pu_bacteria 2936055302 2936057973 373
558 iso_pu_bacteria 2940556831 2940557714 373
559 iso_pu_bacteria 2941538514 2941540465 373
560 iso_pu_bacteria 8006964411 8006966741 373
561 iso_pu_bacteria 8006994254 8006994738 373
562 iso_pu_bacteria 8016511872 8016521316 373
563 iso_pu_bacteria 8016522445 8016529822 373
564 iso_pu_bacteria 8016530956 8016535056 373
565 iso_pu_bacteria 8016539877 8016548262 373
566 iso_pu_bacteria 8016548790 8016553864 373
567 iso_pu_bacteria 8016566248 8016573398 373
568 iso_pu_bacteria 8016575299 8016577531 373
569 iso_pu_bacteria 8016595262 8016600054 373
570 iso_pu_bacteria 8016603502 8016610707 373
571 iso_pu_bacteria 8016613128 8016614223 373
572 iso_pu_bacteria 8016622563 8016626760 373
573 iso_pu_bacteria 8017057580 8017064305 373
574 iso_pu_bacteria 8019530166 8019534811 373
575 iso_pu_bacteria 8019538911 8019544664 373
576 iso_pu_bacteria 8019547302 8019553872 373
577 iso_pu_bacteria 8019586578 8019591464 373
578 iso_pu_bacteria 8019597564 8019599878 373
579 iso_pu_bacteria 8019608314 8019618670 373
580 iso_pu_bacteria 8055742211 8055745652 373
581 iso_pu_bacteria 8056673599 8056680793 373
582 3300005439 Ga0070711_100074234 Ga0070711_1000742343 374
583 3300048921 Ga0496118_0015721 Ga0496118_0015721_3890_5056 374
584 3300048924 Ga0496121_0007484 Ga0496121_0007484_767_1933 374
585 iso_pu_bacteria 2508501128 2509146952 374
586 iso_pu_bacteria 2508501128 2509148442 374
587 iso_pu_bacteria 2508501128 2509150864 374
588 iso_pu_bacteria 2513237094 2513642441 374
589 iso_pu_bacteria 2513237098 2513671552 374
590 iso_pu_bacteria 2524023210 2524464859 374
591 iso_pu_bacteria 2524023228 2524533864 374
592 iso_pu_bacteria 2881665667 2881672310 374
593 iso_pu_bacteria 2885383462 2885389665 374
594 iso_pu_bacteria 2903768456 2903773874 374
595 iso_pu_bacteria 2922386360 2922387800 374
596 iso_pu_bacteria 8006984368 8006993905 374
597 iso_pu_bacteria 8016630954 8016638444 374
598 iso_pu_bacteria 8056681323 8056683636 374
599 3300005437 Ga0070710_10096668 Ga0070710_100966682 375
600 3300006175 Ga0070712_100009376 Ga0070712_1000093762 375
601 3300025898 Ga0207692_10078585 Ga0207692_100785852 375
602 3300025915 Ga0207693_10016822 Ga0207693_100168223 375
603 3300025915 Ga0207693_10121953 Ga0207693_101219532 375
604 3300046460 Ga0495638_0010632 Ga0495638_0010632_4717_5892 375
605 3300053093 Ga0500651_0000964 Ga0500651_0000964_1654_2823 375
606 3300053119 Ga0500595_004564 Ga0500595_004564_282_1451 375
607 iso_pu_bacteria 2513237094 2513642489 375
608 iso_pu_bacteria 2513237098 2513677478 375
609 iso_pu_bacteria 2513237141 2513892949 375
610 iso_pu_bacteria 2524023210 2524466205 375
611 iso_pu_bacteria 2874628541 2874632527 375
612 iso_pu_bacteria 2885383462 2885384803 375
613 iso_pu_bacteria 2903768456 2903771331 375
614 iso_pu_bacteria 2906626472 2906627622 375
615 iso_pu_bacteria 2932801729 2932801850 375
616 iso_pu_bacteria 2932818245 2932826056 375
617 iso_pu_bacteria 2935630451 2935636355 375
618 iso_pu_bacteria 2935908558 2935916285 375
619 iso_pu_bacteria 2935916978 2935923566 375
620 iso_pu_bacteria 2935926038 2935933727 375
621 iso_pu_bacteria 2935934488 2935942211 375
622 iso_pu_bacteria 2935942939 2935950703 375
623 iso_pu_bacteria 2935951376 2935959118 375
624 iso_pu_bacteria 2935959822 2935961589 375
625 iso_pu_bacteria 2935967501 2935975220 375
626 iso_pu_bacteria 2941507105 2941512986 375
627 iso_pu_bacteria 2941515067 2941520712 375
628 iso_pu_bacteria 2941523033 2941528727 375
629 iso_pu_bacteria 8016630954 8016631130 375
630 iso_pu_bacteria 8019555841 8019559280 375
631 iso_pu_bacteria 8019565922 8019566018 375
632 iso_pu_bacteria 8019619141 8019625835 375
633 iso_pu_bacteria 8019687851 8019691573 375
634 3300005341 Ga0070691_10018531 Ga0070691_100185313 376
635 3300005439 Ga0070711_100288852 Ga0070711_1002888521 376
636 3300005444 Ga0070694_100012064 Ga0070694_1000120644 376
637 3300005548 Ga0070665_100024100 Ga0070665_1000241004 376
638 3300009098 Ga0105245_10130209 Ga0105245_101302092 376
639 3300035695 Ga0373927_0017396 Ga0373927_0017396_824_1996 376
640 3300037068 Ga0373925_0097765 Ga0373925_0097765_869_2041 376
641 3300046642 Ga0495634_0181157 Ga0495634_0181157_88_1260 376
642 3300047319 Ga0495674_0120296 Ga0495674_0120296_155_1327 376
643 3300047472 Ga0495686_0120278 Ga0495686_0120278_224_1402 376
644 3300053091 Ga0500647_0026590 Ga0500647_0026590_1389_2558 376
645 3300053094 Ga0500566_0000009 Ga0500566_0000009_84863_86032 376
646 3300053095 Ga0500640_018844 Ga0500640_018844_499_1668 376
647 3300053111 Ga0500572_000142 Ga0500572_000142_13417_14586 376
648 3300053122 Ga0500608_005239 Ga0500608_005239_2074_3243 376
649 3300053123 Ga0500614_002205 Ga0500614_002205_1421_2590 376
650 3300053150 Ga0500603_000016 Ga0500603_000016_46100_47269 376
651 3300053159 Ga0500630_000034 Ga0500630_000034_34611_35780 376
652 3300053163 Ga0500639_000017 Ga0500639_000017_37384_38553 376
653 3300053178 Ga0500637_0033234 Ga0500637_0033234_1541_2710 376
654 3300005983 Ga0081540_1002285 Ga0081540_10022858 377
655 3300005983 Ga0081540_1025480 Ga0081540_10254802 377
656 3300006846 Ga0075430_100009419 Ga0075430_1000094194 377
657 3300046491 Ga0495584_0018523 Ga0495584_0018523_597_1784 377
658 3300048917 Ga0496114_0143490 Ga0496114_0143490_27_1205 377
659 3300050509 nmdc:mga0qj67_2560_c1 nmdc:mga0qj67_2560_c1_6516_7703 377
660 3300005295 Ga0065707_10016994 Ga0065707_100169942 378
661 3300005437 Ga0070710_10002899 Ga0070710_100028992 378
662 3300005439 Ga0070711_100096189 Ga0070711_1000961892 378
663 3300006028 Ga0070717_10001164 Ga0070717_1000116418 378
664 3300006914 Ga0075436_100249452 Ga0075436_1002494521 378
665 3300025898 Ga0207692_10003561 Ga0207692_100035612 378
666 3300025906 Ga0207699_10004084 Ga0207699_100040842 378
667 3300025916 Ga0207663_10023870 Ga0207663_100238703 378
668 3300025928 Ga0207700_10098429 Ga0207700_100984292 378
669 3300025939 Ga0207665_10089786 Ga0207665_100897862 378
670 3300046524 Ga0495648_0009873 Ga0495648_0009873_1183_2358 378
671 3300047469 Ga0495673_0025002 Ga0495673_0025002_1116_2291 378
672 3300048929 Ga0496126_0087272 Ga0496126_0087272_45_1229 378
673 3300000532 CNAas_1001604 CNAas_10016042 379
674 3300005334 Ga0068869_100003558 Ga0068869_1000035583 379
675 3300005347 Ga0070668_100023188 Ga0070668_1000231882 379
676 3300005353 Ga0070669_100001434 Ga0070669_1000014346 379
677 3300005356 Ga0070674_100141676 Ga0070674_1001416762 379
678 3300005366 Ga0070659_100156725 Ga0070659_1001567252 379
679 3300005367 Ga0070667_100009511 Ga0070667_1000095113 379
680 3300005435 Ga0070714_100092937 Ga0070714_1000929372 379
681 3300005437 Ga0070710_10055637 Ga0070710_100556371 379
682 3300005439 Ga0070711_100008672 Ga0070711_1000086726 379
683 3300005439 Ga0070711_100043821 Ga0070711_1000438212 379
684 3300005536 Ga0070697_100345431 Ga0070697_1003454311 379
685 3300005539 Ga0068853_100223636 Ga0068853_1002236362 379
686 3300005719 Ga0068861_100002985 Ga0068861_1000029857 379
687 3300005843 Ga0068860_100029070 Ga0068860_1000290702 379
688 3300005844 Ga0068862_100029695 Ga0068862_1000296952 379
689 3300005983 Ga0081540_1000787 Ga0081540_100078713 379
690 3300005983 Ga0081540_1002212 Ga0081540_10022125 379
691 3300005983 Ga0081540_1044147 Ga0081540_10441472 379
692 3300006163 Ga0070715_10035799 Ga0070715_100357992 379
693 3300006175 Ga0070712_100020675 Ga0070712_1000206753 379
694 3300006175 Ga0070712_100048398 Ga0070712_1000483982 379
695 3300007265 Ga0099794_10000628 Ga0099794_100006288 379
696 3300009148 Ga0105243_10018111 Ga0105243_100181115 379
697 3300009553 Ga0105249_10021556 Ga0105249_100215562 379
698 3300010375 Ga0105239_10060470 Ga0105239_100604706 379
699 3300013297 Ga0157378_10146495 Ga0157378_101464952 379
700 3300013306 Ga0163162_10031551 Ga0163162_100315512 379
701 3300013306 Ga0163162_10352472 Ga0163162_103524722 379
702 3300017792 Ga0163161_10046964 Ga0163161_100469642 379
703 3300017792 Ga0163161_10052806 Ga0163161_100528062 379
704 3300025898 Ga0207692_10020640 Ga0207692_100206402 379
705 3300025906 Ga0207699_10007551 Ga0207699_100075514 379
706 3300025915 Ga0207693_10004819 Ga0207693_100048194 379
707 3300025915 Ga0207693_10021983 Ga0207693_100219833 379
708 3300025916 Ga0207663_10007150 Ga0207663_100071505 379
709 3300025916 Ga0207663_10039546 Ga0207663_100395463 379
710 3300025929 Ga0207664_10019667 Ga0207664_100196672 379
711 3300025933 Ga0207706_10001722 Ga0207706_100017228 379
712 3300025935 Ga0207709_10102744 Ga0207709_101027442 379
713 3300025939 Ga0207665_10007372 Ga0207665_100073723 379
714 3300025942 Ga0207689_10009304 Ga0207689_100093044 379
715 3300025961 Ga0207712_10015694 Ga0207712_100156942 379
716 3300025972 Ga0207668_10001369 Ga0207668_100013693 379
717 3300026041 Ga0207639_10140765 Ga0207639_101407652 379
718 3300026118 Ga0207675_100010951 Ga0207675_1000109513 379
719 3300027671 Ga0209588_1000521 Ga0209588_10005217 379
720 3300028380 Ga0268265_10012713 Ga0268265_100127132 379
721 3300028381 Ga0268264_10011779 Ga0268264_100117792 379
722 3300035170 Ga0373943_0046526 Ga0373943_0046526_634_1815 379
723 3300035695 Ga0373927_0059883 Ga0373927_0059883_645_1826 379
724 3300035725 Ga0373947_0041692 Ga0373947_0041692_843_2024 379
725 3300046538 Ga0495609_0066868 Ga0495609_0066868_295_1473 379
726 3300047320 Ga0495672_0065522 Ga0495672_0065522_348_1529 379
727 3300047323 Ga0495683_0063856 Ga0495683_0063856_408_1586 379
728 3300048904 Ga0496101_0013290 Ga0496101_0013290_1077_2258 379
729 3300048909 Ga0496106_0030102 Ga0496106_0030102_482_1663 379
730 3300048910 Ga0496107_0111704 Ga0496107_0111704_492_1673 379
731 3300048918 Ga0496115_0035644 Ga0496115_0035644_1535_2716 379
732 3300050489 nmdc:mga03683_90323_c1 nmdc:mga03683_90323_c1_28_1206 379

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

89

136

0.96

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

77

313

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6r1m-assembly1.cif.gz_A crystal structure of e. coli seryl-trna synthetase complexed to seryl sulfamoyl adenosine 0.9698 101 175
6r1o-assembly1.cif.gz_A-2 crystal structure of e. coli seryl-trna synthetase complexed to a seryl sulfamoyl adenosine derivative 0.9643 101 175
6r1m-assembly1.cif.gz_B crystal structure of e. coli seryl-trna synthetase complexed to seryl sulfamoyl adenosine 0.9588 101 175
8cwy-assembly1.cif.gz_H accurate computational design of genetically encoded 3d protein crystals 0.9498 100 175
8cwy-assembly1.cif.gz_R accurate computational design of genetically encoded 3d protein crystals 0.9494 100 175
ID Description Score Start End Superfamily
af_A0A0P0XQ02_80_398_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9781 101 175 1.20.1270.60
5azsA01 Mainly Alpha;Up-down Bundle;Outer membrane efflux proteins (OEP);Outer membrane efflux proteins (OEP) 0.9754 101 177 1.20.1600.10
1vf7H02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9716 67 211 2.40.50.100
2f1mC03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9638 103 174 1.10.287.470
af_I1KAB5_393_712_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9595 101 175 1.20.1270.60
ID Description Score Start End GO Terms
AF-A0A3B0WKP4-F1-model_v4 RND efflux system, membrane fusion protein 0.9101 290 364 GO:0005886
GO:0046677
AF-A0A2V7TVZ0-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8686 45 362 GO:0015562
GO:0030313
GO:1990281
AF-A0A7V9PGL9-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8637 46 362 GO:0015562
GO:1990281
AF-A0A537RT60-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.8635 25 363 GO:0015562
GO:1990281
AF-A0A6D0ENE7-F1-model_v4 deleted 0.863 58 217

Feature Viewer

pLDDT pTM Quality
81 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map