F478109

General Info

Members Datasets Scaffolds Average Seq Length
733 431 656 255

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606370|2808894123
Length 290
Sequence GSVALITGGASGLGAATARRLFDAGASVVLVDLPSSAGEAFAEELSGGKASGGKASGGNANGGNANGGNANGGNAHPAGPPEKSAVFVPADVTSEAEVQAAVDAAAALGPLRIVVNCAGVATPGKVLGREGVLPLEAFNRVIQVNLVGTFNVLRLAAAAMVANEPASTELGGPERGVIINTASAAAFEGQIGQPAYAASKGAVAAMTLPIARELARSLVRVVTIAPGIFETPMMAGLPQEAQDSLGAQVPHPSRLGKPAEYANLVAHIVDNAMLNGETIRLDGAIRMGPK

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221586 Lysobacter sp. Root667 Isolate Unclassified
7 2643221612 Lysobacter sp. Root76 Isolate Unclassified
8 2643221616 Leifsonia sp. Root227 Isolate Unclassified
9 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
10 2643221695 Lysobacter sp. Root494 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
15 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
16 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
17 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
18 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
19 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
20 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
21 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
22 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
23 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
24 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
25 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
26 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
27 2818991457 Xanthomonas translucens 569 Isolate Unclassified
28 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
29 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
30 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
31 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
32 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
33 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
34 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
35 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
36 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
37 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
38 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
39 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
40 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
41 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
42 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
43 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
44 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
45 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
46 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
47 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
48 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
49 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
50 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
51 2919395869 Microbacterium resistens 2980 Isolate Unclassified
52 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
53 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
54 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
55 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
56 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
57 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
58 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
59 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
60 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
61 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
62 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
63 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
64 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
65 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
66 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
67 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
68 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
69 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
70 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
71 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
72 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
73 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
74 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
75 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
76 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
77 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
78 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
79 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
80 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
81 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
83 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
85 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
86 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
87 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
88 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
89 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
90 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
91 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
92 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
93 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
94 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
95 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
96 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
97 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
98 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
99 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
100 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
101 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
102 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
103 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
104 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
105 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
106 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
107 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
108 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
109 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
110 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
111 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
112 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
113 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
114 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
115 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
116 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
117 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
118 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
119 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
120 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
121 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
122 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
123 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
124 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
125 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
126 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
127 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
128 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
129 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
130 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
131 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
132 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
133 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
134 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
135 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
136 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
137 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
138 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
139 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
140 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
141 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
142 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
143 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
144 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
145 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
146 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
147 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
148 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
149 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
150 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
151 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
152 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
153 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
154 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
155 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
156 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
157 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
158 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
159 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
160 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
161 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
162 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
163 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
164 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
165 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
166 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
167 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
168 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
169 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
170 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
171 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
172 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
173 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
174 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
175 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
176 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
177 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
178 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
179 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
180 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
181 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
182 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
183 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
184 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
185 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
186 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
187 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
188 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
189 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
190 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
191 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
195 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
196 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
197 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
200 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
201 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
202 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
204 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
205 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
207 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
208 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
209 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
211 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
255 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
256 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
257 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
258 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
260 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
261 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
263 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
264 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
265 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
266 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
267 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
268 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
269 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
270 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
271 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
272 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
273 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
274 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
275 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
276 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
277 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
278 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
279 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
280 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
281 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
282 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
283 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
284 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
285 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
286 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
287 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
288 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
289 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
290 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
291 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
292 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
293 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
294 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
295 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
296 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
297 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
298 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
299 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
300 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
301 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
302 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
303 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
304 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
305 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
306 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
307 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
308 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
309 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
310 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
311 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
312 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
313 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
314 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
315 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
316 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
317 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
318 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
319 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
320 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
321 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
322 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
323 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
324 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
325 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
326 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
327 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
328 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
329 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
330 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
331 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
332 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
333 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
334 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
335 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
336 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
337 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
338 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
339 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
340 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
341 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
342 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
343 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
344 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
345 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
346 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
347 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
348 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
349 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
350 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
351 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
352 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
353 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
354 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
355 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
356 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
357 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
358 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
359 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
360 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
361 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
362 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
363 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
364 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
365 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
366 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
367 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
368 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
369 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
370 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
377 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
378 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
379 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
382 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
383 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
384 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
385 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
386 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
387 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
388 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
389 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
390 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
391 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
392 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
405 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
406 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
407 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
408 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
409 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
410 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
411 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
412 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
413 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
414 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
415 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
417 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
418 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
419 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
420 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
421 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
422 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
423 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
424 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
425 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
426 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
427 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
428 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
429 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
430 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere
431 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.54
Metatranscriptomes 0.95
Isolates 10.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.37
Nodule 0.14
Rhizoplane 7.91
Rhizosphere 75.58
Stem 0
Stem Tuber 0.14
Unclassified 8.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000689 3300000549 Bacteria 5386
2 LJQas_1001056 3300000549 Bacteria 4194
3 JGI24735J21928_10078630 3300002067 Bacteria 944
4 JGI25162J39368_1010474 3300002737 Bacteria 1170
5 JGI25164J39214_1000399 3300002772 Bacteria 25187
6 JGI25152J39213_1000486 3300002773 Bacteria 22545
7 JGI25151J46595_10000059 3300003187 Bacteria 147998
8 JGI25151J46595_10002903 3300003187 Bacteria 9817
9 JGI25406J46586_10019261 3300003203 Bacteria 2786
10 JGI25406J46586_10033712 3300003203 Bacteria 1888
11 JGI25165J46597_1000148 3300003214 Bacteria 116003
12 JGI25404J52841_10003860 3300003659 Bacteria 3000
13 Ga0055539_1000103 3300003752 Bacteria 96081
14 Ga0055533_1000020 3300003756 Bacteria 353998
15 Ga0055525_1000312 3300003759 Bacteria 39548
16 Ga0055542_1006884 3300003762 Bacteria 2376
17 Ga0055526_1000617 3300003771 Bacteria 27614
18 Ga0055537_1000450 3300003773 Bacteria 26107
19 Ga0055524_1000568 3300003775 Bacteria 27614
20 Ga0055536_1003611 3300003781 Bacteria 8260
21 Ga0055534_1000385 3300003784 Bacteria 27614
22 Ga0055528_1000580 3300003790 Bacteria 27614
23 Ga0055540_1034926 3300003792 Bacteria 1127
24 Ga0055531_10022879 3300003794 Bacteria 2364
25 Ga0055541_1005026 3300003841 Bacteria 2349
26 Ga0058692_1000031 3300003856 Bacteria 188488
27 Ga0058692_1000060 3300003856 Bacteria 98866
28 Ga0065714_10016134 3300005288 Bacteria 1627
29 Ga0065704_10070531 3300005289 Bacteria 21590
30 Ga0065715_10001250 3300005293 Bacteria 8508
31 Ga0070658_10291421 3300005327 Bacteria 1391
32 Ga0070676_10034053 3300005328 Bacteria 2923
33 Ga0070676_10137939 3300005328 Bacteria 1549
34 Ga0070683_100183528 3300005329 Bacteria 1986
35 Ga0070670_100029702 3300005331 Bacteria 4707
36 Ga0070670_100064788 3300005331 Bacteria 3135
37 Ga0070670_100197699 3300005331 Bacteria 1747
38 Ga0070677_10086973 3300005333 Bacteria 1351
39 Ga0068869_100013607 3300005334 Bacteria 5416
40 Ga0070666_10059807 3300005335 Bacteria 2577
41 Ga0070680_100134724 3300005336 Bacteria 2068
42 Ga0070680_100341851 3300005336 Bacteria 1272
43 Ga0070682_100001726 3300005337 Bacteria 12151
44 Ga0070682_100196204 3300005337 Bacteria 1421
45 Ga0068868_100031924 3300005338 Bacteria 4048
46 Ga0068868_100423604 3300005338 Bacteria 1153
47 Ga0070660_100133048 3300005339 Bacteria 1991
48 Ga0070689_100337940 3300005340 Bacteria 1261
49 Ga0070687_100011905 3300005343 Bacteria 3824
50 Ga0070661_100667782 3300005344 Bacteria 845
51 Ga0070669_100014843 3300005353 Bacteria 5548
52 Ga0070669_100031578 3300005353 Bacteria 3826
53 Ga0070669_100336529 3300005353 Bacteria 1222
54 Ga0070675_100031498 3300005354 Bacteria 4287
55 Ga0070675_100031963 3300005354 Bacteria 4256
56 Ga0070675_100283792 3300005354 Bacteria 1456
57 Ga0070671_100006111 3300005355 Bacteria 9589
58 Ga0070671_100039581 3300005355 Bacteria 3913
59 Ga0070671_100081121 3300005355 Bacteria 2712
60 Ga0070671_100132600 3300005355 Bacteria 2099
61 Ga0070674_100069872 3300005356 Bacteria 2479
62 Ga0070673_100019569 3300005364 Bacteria 4862
63 Ga0070673_100194811 3300005364 Bacteria 1742
64 Ga0070659_100099320 3300005366 Bacteria 2341
65 Ga0070667_100731224 3300005367 Bacteria 917
66 Ga0070709_10069210 3300005434 Bacteria 2272
67 Ga0070713_100001424 3300005436 Bacteria 15340
68 Ga0070701_10007294 3300005438 Bacteria 4710
69 Ga0070678_100033250 3300005456 Bacteria 3578
70 Ga0070678_100034742 3300005456 Bacteria 3513
71 Ga0070681_10121318 3300005458 Bacteria 2549
72 Ga0070681_10138837 3300005458 Bacteria 2360
73 Ga0070681_10168667 3300005458 Bacteria 2111
74 Ga0070679_100089383 3300005530 Bacteria 3067
75 Ga0070679_100476289 3300005530 Bacteria 1193
76 Ga0070679_100713618 3300005530 Bacteria 945
77 Ga0070684_100602151 3300005535 Bacteria 1022
78 Ga0070672_100159620 3300005543 Bacteria 1870
79 Ga0070672_100536790 3300005543 Bacteria 1014
80 Ga0070693_100004599 3300005547 Bacteria 6548
81 Ga0070665_100406961 3300005548 Bacteria 1369
82 Ga0070665_100495072 3300005548 Bacteria 1233
83 Ga0068855_100138824 3300005563 Bacteria 2772
84 Ga0068855_100376828 3300005563 Bacteria 1559
85 Ga0070664_100152562 3300005564 Bacteria 2040
86 Ga0068854_100025286 3300005578 Bacteria 4073
87 Ga0070702_100000212 3300005615 Bacteria 19347
88 Ga0068852_100134527 3300005616 Bacteria 2281
89 Ga0068852_100282821 3300005616 Bacteria 1600
90 Ga0068859_100140908 3300005617 Bacteria 2485
91 Ga0068864_100088914 3300005618 Bacteria 2721
92 Ga0068851_10017690 3300005834 Bacteria 3427
93 Ga0068870_10000198 3300005840 Bacteria 21465
94 Ga0068863_100035364 3300005841 Bacteria 4758
95 Ga0068863_100109289 3300005841 Bacteria 2632
96 Ga0068863_100252755 3300005841 Bacteria 1703
97 Ga0068858_100041877 3300005842 Bacteria 4245
98 Ga0081540_1010321 3300005983 Bacteria 6335
99 Ga0081540_1021999 3300005983 Bacteria 3775
100 Ga0081540_1027543 3300005983 Bacteria 3216
101 Ga0081539_10001488 3300005985 Bacteria 39658
102 Ga0081539_10003292 3300005985 Bacteria 20222
103 Ga0075364_10000075 3300006051 Bacteria 38780
104 Ga0075364_10014729 3300006051 Bacteria 4836
105 Ga0075432_10002528 3300006058 Bacteria 6093
106 Ga0075432_10019085 3300006058 Bacteria 2340
107 Ga0070712_100052353 3300006175 Bacteria 2847
108 Ga0075369_10056644 3300006186 Bacteria 1704
109 Ga0068871_100002932 3300006358 Bacteria 11705
110 Ga0075428_100141407 3300006844 Bacteria 2617
111 Ga0075430_100170040 3300006846 Bacteria 1813
112 Ga0075434_100020271 3300006871 Bacteria 6446
113 Ga0075436_100005883 3300006914 Bacteria 8424
114 Ga0097620_100140916 3300006931 Bacteria 2485
115 Ga0075435_100002423 3300007076 Bacteria 12369
116 Ga0105251_10005393 3300009011 Bacteria 8373
117 Ga0105251_10069511 3300009011 Bacteria 1641
118 Ga0105244_10026337 3300009036 Bacteria 3148
119 Ga0105244_10060818 3300009036 Bacteria 1902
120 Ga0105244_10087593 3300009036 Bacteria 1534
121 Ga0105240_10152849 3300009093 Bacteria 2747
122 Ga0105240_10208895 3300009093 Bacteria 2283
123 Ga0111539_10007824 3300009094 Bacteria 13647
124 Ga0105245_10068211 3300009098 Bacteria 3222
125 Ga0105245_10181652 3300009098 Bacteria 2010
126 Ga0105245_10467159 3300009098 Bacteria 1273
127 Ga0105247_10062869 3300009101 Bacteria 2304
128 Ga0105247_10293305 3300009101 Bacteria 1126
129 Ga0114129_10169938 3300009147 Bacteria 2973
130 Ga0105243_10005982 3300009148 Bacteria 9423
131 Ga0105243_10012792 3300009148 Bacteria 6338
132 Ga0105243_10354667 3300009148 Bacteria 1348
133 Ga0105243_10385471 3300009148 Bacteria 1298
134 Ga0105243_10569870 3300009148 Bacteria 1085
135 Ga0105243_10671502 3300009148 Bacteria 1007
136 Ga0105241_10093692 3300009174 Bacteria 2374
137 Ga0105248_10060903 3300009177 Bacteria 4237
138 Ga0105248_10202027 3300009177 Bacteria 2239
139 Ga0105237_10080772 3300009545 Bacteria 3242
140 Ga0105238_10007400 3300009551 Bacteria 11000
141 Ga0105249_10522775 3300009553 Bacteria 1234
142 Ga0105239_10104594 3300010375 Bacteria 3135
143 Ga0105246_10037618 3300011119 Bacteria 3248
144 Ga0105246_10066996 3300011119 Bacteria 2515
145 Ga0105246_10201187 3300011119 Bacteria 1548
146 Ga0105246_10219096 3300011119 Bacteria 1491
147 Ga0105246_10228581 3300011119 Bacteria 1463
148 Ga0157327_1004598 3300012512 Bacteria 1077
149 Ga0157373_10033055 3300013100 Bacteria 3723
150 Ga0157373_10091699 3300013100 Bacteria 2140
151 Ga0157373_10127794 3300013100 Bacteria 1787
152 Ga0157371_10006531 3300013102 Bacteria 9596
153 Ga0157371_10079159 3300013102 Bacteria 2328
154 Ga0157371_10117872 3300013102 Bacteria 1887
155 Ga0157371_10410365 3300013102 Bacteria 992
156 Ga0157370_10112173 3300013104 Bacteria 2549
157 Ga0157370_10249793 3300013104 Bacteria 1641
158 Ga0157369_10012353 3300013105 Bacteria 9695
159 Ga0157369_10042335 3300013105 Bacteria 4968
160 Ga0157369_10093022 3300013105 Bacteria 3218
161 Ga0157369_10472479 3300013105 Bacteria 1298
162 Ga0157374_10034297 3300013296 Bacteria 4634
163 Ga0157372_10182398 3300013307 Bacteria 2430
164 Ga0157372_10310262 3300013307 Bacteria 1836
165 Ga0157372_10545996 3300013307 Bacteria 1351
166 Ga0157375_10427572 3300013308 Bacteria 1490
167 Ga0163163_10056369 3300014325 Bacteria 3884
168 Ga0163163_10732460 3300014325 Bacteria 1052
169 Ga0157380_10200341 3300014326 Bacteria 1770
170 Ga0157380_10883152 3300014326 Bacteria 919
171 Ga0157377_10108172 3300014745 Bacteria 1667
172 Ga0157379_10099465 3300014968 Bacteria 2611
173 Ga0157376_10082183 3300014969 Bacteria 2768
174 Ga0182006_1052226 3300015261 Bacteria 1571
175 Ga0182005_1011353 3300015265 Bacteria 2541
176 Ga0197907_10025204 3300020069 Bacteria 3176
177 Ga0197907_10275978 3300020069 Bacteria 2917
178 Ga0206356_10524634 3300020070 Bacteria 1931
179 Ga0206350_11092398 3300020080 Bacteria 2139
180 Ga0206354_11559491 3300020081 Bacteria 5924
181 Ga0206353_10091682 3300020082 Bacteria 1686
182 Ga0206353_11305176 3300020082 Bacteria 5623
183 Ga0209566_100043 3300025225 Bacteria 266609
184 Ga0209674_100001 3300025226 Bacteria 4013750
185 Ga0209563_100001 3300025230 Bacteria 4013775
186 Ga0209563_100183 3300025230 Bacteria 37635
187 Ga0207427_100407 3300025231 Bacteria 25132
188 Ga0209437_100315 3300025233 Bacteria 63641
189 Ga0207425_1005261 3300025245 Bacteria 3721
190 Ga0209677_100001 3300025253 Bacteria 4013787
191 Ga0209677_100407 3300025253 Bacteria 25727
192 Ga0209148_1001608 3300025254 Bacteria 10532
193 Ga0209759_1011595 3300025256 Bacteria 2495
194 Ga0209129_1000159 3300025258 Bacteria 103426
195 Ga0209233_1000014 3300025261 Bacteria 996641
196 Ga0209565_1000005 3300025263 Bacteria 947317
197 Ga0209673_1000027 3300025273 Bacteria 360561
198 Ga0209675_1000004 3300025291 Bacteria 947166
199 Ga0209676_1000068 3300025292 Bacteria 314068
200 Ga0209025_1000005 3300025294 Bacteria 1272149
201 Ga0209025_1000211 3300025294 Bacteria 139109
202 Ga0209564_1000050 3300025295 Bacteria 360560
203 Ga0209758_1004731 3300025297 Bacteria 11083
204 Ga0209050_1006127 3300025298 Bacteria 7253
205 Ga0209256_1000031 3300025299 Bacteria 410189
206 Ga0209051_1019000 3300025303 Bacteria 3017
207 Ga0209051_1021914 3300025303 Bacteria 2703
208 Ga0209257_1000645 3300025304 Bacteria 55704
209 Ga0207697_10003551 3300025315 Bacteria 7681
210 Ga0207656_10163503 3300025321 Bacteria 1060
211 Ga0207655_1019888 3300025728 Bacteria 3482
212 Ga0207655_1028626 3300025728 Bacteria 2625
213 Ga0207682_10002817 3300025893 Bacteria 7684
214 Ga0207710_10013970 3300025900 Bacteria 3382
215 Ga0207688_10031636 3300025901 Bacteria 2922
216 Ga0207688_10096039 3300025901 Bacteria 1706
217 Ga0207680_10039388 3300025903 Bacteria 2742
218 Ga0207680_10068500 3300025903 Bacteria 2189
219 Ga0207645_10023729 3300025907 Bacteria 3983
220 Ga0207643_10000202 3300025908 Bacteria 41336
221 Ga0207705_10010432 3300025909 Bacteria 6753
222 Ga0207705_10102236 3300025909 Bacteria 2109
223 Ga0207705_10229616 3300025909 Bacteria 1411
224 Ga0207707_10072709 3300025912 Bacteria 2997
225 Ga0207695_10045863 3300025913 Bacteria 4636
226 Ga0207695_10124286 3300025913 Bacteria 2544
227 Ga0207693_10212410 3300025915 Bacteria 1521
228 Ga0207660_10393572 3300025917 Bacteria 1115
229 Ga0207657_10011873 3300025919 Bacteria 8622
230 Ga0207657_10035234 3300025919 Bacteria 4489
231 Ga0207681_10033056 3300025923 Bacteria 3390
232 Ga0207694_10100706 3300025924 Bacteria 2289
233 Ga0207650_10003161 3300025925 Bacteria 11346
234 Ga0207700_10031192 3300025928 Bacteria 3783
235 Ga0207664_10024041 3300025929 Bacteria 4575
236 Ga0207644_10041703 3300025931 Bacteria 3248
237 Ga0207690_10038933 3300025932 Bacteria 3098
238 Ga0207706_10421784 3300025933 Bacteria 1156
239 Ga0207709_10000632 3300025935 Bacteria 28799
240 Ga0207709_10184352 3300025935 Bacteria 1477
241 Ga0207709_10595464 3300025935 Bacteria 875
242 Ga0207670_10321697 3300025936 Bacteria 1217
243 Ga0207691_10002149 3300025940 Bacteria 19307
244 Ga0207691_10009924 3300025940 Bacteria 9141
245 Ga0207691_10752285 3300025940 Bacteria 821
246 Ga0207689_10004258 3300025942 Bacteria 13013
247 Ga0207661_10005333 3300025944 Bacteria 9048
248 Ga0207661_10309604 3300025944 Bacteria 1417
249 Ga0207679_10008214 3300025945 Bacteria 6644
250 Ga0207679_10349168 3300025945 Bacteria 1289
251 Ga0207667_10694481 3300025949 Bacteria 1020
252 Ga0207651_10026046 3300025960 Bacteria 3646
253 Ga0207651_10072652 3300025960 Bacteria 2443
254 Ga0207640_10318566 3300025981 Bacteria 1237
255 Ga0207677_10006429 3300026023 Bacteria 6445
256 Ga0207703_10074827 3300026035 Bacteria 2805
257 Ga0207678_10001765 3300026067 Bacteria 19806
258 Ga0207708_10038908 3300026075 Bacteria 3623
259 Ga0207702_10001104 3300026078 Bacteria 27582
260 Ga0207702_10007880 3300026078 Bacteria 9030
261 Ga0207641_10029111 3300026088 Bacteria 4567
262 Ga0207641_10218608 3300026088 Bacteria 1765
263 Ga0207676_10001801 3300026095 Bacteria 15704
264 Ga0207674_10065152 3300026116 Bacteria 3673
265 Ga0207683_10008663 3300026121 Bacteria 8699
266 Ga0207683_10028397 3300026121 Bacteria 4837
267 Ga0209371_1000004 3300027312 Bacteria 1098197
268 Ga0209371_1000139 3300027312 Bacteria 120350
269 Ga0209969_1011375 3300027360 Bacteria 1278
270 Ga0209967_1023242 3300027364 Bacteria 911
271 Ga0209984_1021647 3300027424 Bacteria 883
272 Ga0209983_1007204 3300027665 Bacteria 2281
273 Ga0209974_10010966 3300027876 Bacteria 3050
274 Ga0207428_10034428 3300027907 Bacteria 4151
275 Ga0268266_10037476 3300028379 Bacteria 4131
276 Ga0268266_10084548 3300028379 Bacteria 2771
277 Ga0307517_10025256 3300028786 Bacteria 7276
278 Ga0307515_10000050 3300028794 Bacteria 275624
279 Ga0268256_1000005 3300030500 Bacteria 1082342
280 Ga0268256_1000109 3300030500 Bacteria 120350
281 Ga0307511_10002943 3300030521 Bacteria 17643
282 Ga0307512_10092674 3300030522 Bacteria 2095
283 Ga0307513_10019869 3300031456 Bacteria 7982
284 Ga0307509_10003130 3300031507 Bacteria 25663
285 Ga0307509_10011263 3300031507 Bacteria 10850
286 Ga0307509_10022296 3300031507 Bacteria 7145
287 Ga0307509_10025648 3300031507 Bacteria 6580
288 Ga0307408_100010694 3300031548 Bacteria 6053
289 Ga0307408_100012672 3300031548 Bacteria 5591
290 Ga0307408_100028576 3300031548 Bacteria 3855
291 Ga0307408_100030404 3300031548 Bacteria 3750
292 Ga0307408_100035266 3300031548 Bacteria 3509
293 Ga0307408_100035311 3300031548 Bacteria 3507
294 Ga0307408_100048800 3300031548 Bacteria 3038
295 Ga0307408_100284833 3300031548 Bacteria 1377
296 Ga0307408_100298891 3300031548 Bacteria 1347
297 Ga0307408_100585246 3300031548 Bacteria 989
298 Ga0307508_10204463 3300031616 Bacteria 1575
299 Ga0307514_10173113 3300031649 Bacteria 1406
300 Ga0316575_10011793 3300031665 Bacteria 3240
301 Ga0316576_10038680 3300031727 Bacteria 3421
302 Ga0316576_10040342 3300031727 Bacteria 3355
303 Ga0316576_10072333 3300031727 Bacteria 2545
304 Ga0316576_10327650 3300031727 Bacteria 1142
305 Ga0316578_10120001 3300031728 Bacteria 1580
306 Ga0307516_10004353 3300031730 Bacteria 17513
307 Ga0307405_10004419 3300031731 Bacteria 6646
308 Ga0307405_10016643 3300031731 Bacteria 4015
309 Ga0307405_10248530 3300031731 Bacteria 1322
310 Ga0307405_10391200 3300031731 Bacteria 1085
311 Ga0307405_10395812 3300031731 Bacteria 1080
312 Ga0307405_10553239 3300031731 Bacteria 931
313 Ga0307405_10612877 3300031731 Bacteria 890
314 Ga0307413_10001980 3300031824 Bacteria 8131
315 Ga0307413_10009030 3300031824 Bacteria 4746
316 Ga0307413_10018695 3300031824 Bacteria 3643
317 Ga0307413_10018758 3300031824 Bacteria 3638
318 Ga0307413_10062999 3300031824 Bacteria 2297
319 Ga0307413_10122379 3300031824 Bacteria 1765
320 Ga0307413_10163763 3300031824 Bacteria 1565
321 Ga0307413_10195471 3300031824 Bacteria 1456
322 Ga0307413_10335668 3300031824 Bacteria 1160
323 Ga0307413_10574935 3300031824 Bacteria 918
324 Ga0307410_10040876 3300031852 Bacteria 3054
325 Ga0307410_10054246 3300031852 Bacteria 2716
326 Ga0307410_10066085 3300031852 Bacteria 2490
327 Ga0307410_10097706 3300031852 Bacteria 2098
328 Ga0307410_10134472 3300031852 Bacteria 1821
329 Ga0307410_10190552 3300031852 Bacteria 1559
330 Ga0307410_10277074 3300031852 Bacteria 1314
331 Ga0307410_10396844 3300031852 Bacteria 1113
332 Ga0307406_10090639 3300031901 Bacteria 2058
333 Ga0307406_10092869 3300031901 Bacteria 2036
334 Ga0307406_10127338 3300031901 Bacteria 1782
335 Ga0307406_10394798 3300031901 Bacteria 1095
336 Ga0307406_10445594 3300031901 Bacteria 1037
337 Ga0307407_10015562 3300031903 Bacteria 3765
338 Ga0307407_10019104 3300031903 Bacteria 3483
339 Ga0307407_10234411 3300031903 Bacteria 1248
340 Ga0307407_10241029 3300031903 Bacteria 1233
341 Ga0307412_10002168 3300031911 Bacteria 10898
342 Ga0307412_10009159 3300031911 Bacteria 5674
343 Ga0307412_10016980 3300031911 Bacteria 4348
344 Ga0307412_10021789 3300031911 Bacteria 3919
345 Ga0307412_10035423 3300031911 Bacteria 3189
346 Ga0307412_10065910 3300031911 Bacteria 2453
347 Ga0307412_10092028 3300031911 Bacteria 2124
348 Ga0307412_10256117 3300031911 Bacteria 1361
349 Ga0307412_10267703 3300031911 Bacteria 1336
350 Ga0307409_100063441 3300031995 Bacteria 2897
351 Ga0307409_100105038 3300031995 Bacteria 2354
352 Ga0307409_100153597 3300031995 Bacteria 2002
353 Ga0307409_100202413 3300031995 Bacteria 1777
354 Ga0307409_100427300 3300031995 Bacteria 1272
355 Ga0307416_100033203 3300032002 Bacteria 3909
356 Ga0307416_100101615 3300032002 Bacteria 2504
357 Ga0307416_100110407 3300032002 Bacteria 2421
358 Ga0307416_100121954 3300032002 Bacteria 2325
359 Ga0307416_100143614 3300032002 Bacteria 2174
360 Ga0307416_100262868 3300032002 Bacteria 1688
361 Ga0307416_100741068 3300032002 Bacteria 1074
362 Ga0307416_101057864 3300032002 Bacteria 915
363 Ga0307414_10002021 3300032004 Bacteria 10541
364 Ga0307414_10049127 3300032004 Bacteria 2915
365 Ga0307414_10090822 3300032004 Bacteria 2268
366 Ga0307414_10293181 3300032004 Bacteria 1372
367 Ga0307414_10305827 3300032004 Bacteria 1347
368 Ga0307414_10502267 3300032004 Bacteria 1073
369 Ga0307411_10006487 3300032005 Bacteria 5861
370 Ga0307411_10733297 3300032005 Bacteria 864
371 Ga0307415_100011710 3300032126 Bacteria 5035
372 Ga0307415_100079701 3300032126 Bacteria 2334
373 Ga0316585_10080090 3300032137 Bacteria 1064
374 Ga0307510_10005740 3300033180 Bacteria 14791
375 Ga0307510_10249959 3300033180 Bacteria 1261
376 Ga0316574_0006917 3300035398 Bacteria 6175
377 Ga0316574_0032437 3300035398 Bacteria 3174
378 Ga0316574_0044941 3300035398 Bacteria 2733
379 Ga0316574_0048231 3300035398 Bacteria 2644
380 Ga0316574_0170441 3300035398 Bacteria 1402
381 Ga0316574_0286349 3300035398 Bacteria 1049
382 Ga0395899_0006752 3300037312 Bacteria 8889
383 Ga0395899_0006965 3300037312 Bacteria 8758
384 Ga0395899_0015045 3300037312 Bacteria 5898
385 Ga0395899_0040126 3300037312 Bacteria 3501
386 Ga0395899_0109651 3300037312 Bacteria 1985
387 Ga0395899_0125320 3300037312 Bacteria 1837
388 Ga0395899_0152367 3300037312 Bacteria 1637
389 Ga0395900_0022120 3300037418 Bacteria 6505
390 Ga0395900_0032108 3300037418 Bacteria 5398
391 Ga0395900_0120432 3300037418 Bacteria 2693
392 Ga0395900_0122009 3300037418 Bacteria 2673
393 Ga0395900_0183870 3300037418 Bacteria 2122
394 Ga0395900_0205546 3300037418 Bacteria 1990
395 Ga0395900_0325828 3300037418 Bacteria 1515
396 Ga0395898_0011125 3300037466 Bacteria 9368
397 Ga0395898_0015445 3300037466 Bacteria 7830
398 Ga0395898_0047998 3300037466 Bacteria 4188
399 Ga0395898_0073111 3300037466 Bacteria 3311
400 Ga0395898_0083391 3300037466 Bacteria 3081
401 Ga0395898_0223338 3300037466 Bacteria 1797
402 Ga0395898_0319772 3300037466 Bacteria 1480
403 Ga0395898_0361270 3300037466 Bacteria 1384
404 Ga0395898_0405738 3300037466 Bacteria 1299
405 Ga0395905_0008483 3300037471 Bacteria 10131
406 Ga0395905_0297483 3300037471 Bacteria 1501
407 Ga0395905_0468542 3300037471 Bacteria 1158
408 Ga0395901_0010870 3300038443 Bacteria 9224
409 Ga0395901_0012060 3300038443 Bacteria 8768
410 Ga0395901_0017119 3300038443 Bacteria 7390
411 Ga0395901_0019338 3300038443 Bacteria 6962
412 Ga0395901_0042420 3300038443 Bacteria 4716
413 Ga0395901_0061266 3300038443 Bacteria 3915
414 Ga0395901_0313253 3300038443 Bacteria 1625
415 Ga0395901_0316219 3300038443 Bacteria 1616
416 Ga0395901_0336293 3300038443 Bacteria 1560
417 Ga0395901_0461056 3300038443 Bacteria 1298
418 Ga0395901_0710324 3300038443 Bacteria 1002
419 Ga0237819_05553 3300038705 Bacteria 1967
420 Ga0439436_0004892 3300041404 Bacteria 4112
421 Ga0439436_0007439 3300041404 Bacteria 3369
422 Ga0439436_0023178 3300041404 Bacteria 1837
423 Ga0439436_0063248 3300041404 Bacteria 1034
424 Ga0439438_030485 3300041405 Bacteria 1438
425 Ga0439438_054448 3300041405 Bacteria 1011
426 Ga0439439_0004700 3300041406 Bacteria 3086
427 Ga0439439_0037080 3300041406 Bacteria 1256
428 Ga0439466_0017726 3300041411 Bacteria 2562
429 Ga0439466_0042261 3300041411 Bacteria 1518
430 Ga0439465_0000040 3300041413 Bacteria 26319
431 Ga0439465_0020201 3300041413 Bacteria 2085
432 Ga0451791_1883876 3300041451 Bacteria 1342
433 Ga0451793_0432375 3300041452 Bacteria 3475
434 Ga0451793_0611243 3300041452 Bacteria 1665
435 Ga0451800_1224437 3300041459 Bacteria 3605
436 Ga0451806_620901 3300041462 Bacteria 1847
437 Ga0451807_1378455 3300041486 Bacteria 2158
438 Ga0451843_1504794 3300041509 Bacteria 1242
439 Ga0451853_0174512 3300041512 Bacteria 1263
440 Ga0439433_0025077 3300041999 Bacteria 1345
441 Ga0439442_000066 3300042002 Bacteria 24598
442 Ga0439442_002302 3300042002 Bacteria 3748
443 Ga0439442_003358 3300042002 Bacteria 3164
444 Ga0439432_005823 3300042006 Bacteria 4424
445 Ga0439449_0000134 3300042007 Bacteria 25113
446 Ga0439449_0003611 3300042007 Bacteria 6005
447 Ga0439449_0008474 3300042007 Bacteria 3907
448 Ga0439449_0026802 3300042007 Bacteria 2150
449 Ga0439449_0029576 3300042007 Bacteria 2042
450 Ga0439449_0042385 3300042007 Bacteria 1691
451 Ga0439452_031797 3300042010 Bacteria 1293
452 Ga0439457_006936 3300042014 Bacteria 2740
453 Ga0439463_013653 3300042016 Bacteria 2001
454 Ga0450920_000130 3300042122 Bacteria 10289
455 Ga0450920_007667 3300042122 Bacteria 1960
456 Ga0450894_010499 3300042131 Bacteria 1202
457 Ga0450907_000127 3300042146 Bacteria 28670
458 Ga0439458_0039149 3300042157 Bacteria 1146
459 Ga0439434_0000033 3300042435 Bacteria 32845
460 Ga0450918_003438 3300042531 Bacteria 2939
461 Ga0451577_0051922 3300042876 Bacteria 3660
462 Ga0466969_0126953 3300044656 Bacteria 1185
463 Ga0466972_0080846 3300044658 Bacteria 1548
464 Ga0466972_0081652 3300044658 Bacteria 1539
465 Ga0466965_0276357 3300044683 Bacteria 906
466 Ga0466966_0010237 3300044684 Bacteria 6222
467 Ga0466961_0030561 3300044693 Bacteria 3462
468 Ga0466968_0022494 3300044735 Bacteria 2562
469 Ga0466970_0026478 3300044765 Bacteria 3038
470 Ga0466970_0289341 3300044765 Bacteria 922
471 Ga0466957_0085023 3300044842 Bacteria 1975
472 Ga0466959_0026949 3300045049 Bacteria 4262
473 Ga0466958_0003576 3300045836 Bacteria 8095
474 Ga0466967_0876924 3300045976 Bacteria 892
475 Ga0495603_0161730 3300046455 Bacteria 1299
476 Ga0495629_0015808 3300046459 Bacteria 5419
477 Ga0495629_0032461 3300046459 Bacteria 3697
478 Ga0495653_0001814 3300046463 Bacteria 16828
479 Ga0495580_0023426 3300046472 Bacteria 4534
480 Ga0495580_0042268 3300046472 Bacteria 3247
481 Ga0495639_0027634 3300046475 Bacteria 2512
482 Ga0495639_0031364 3300046475 Bacteria 2365
483 Ga0495664_0000613 3300046477 Bacteria 18136
484 Ga0495594_0019951 3300046499 Bacteria 3567
485 Ga0495594_0036701 3300046499 Bacteria 2673
486 Ga0495607_0037418 3300046501 Bacteria 2915
487 Ga0495606_0012571 3300046507 Bacteria 6776
488 Ga0495630_0025529 3300046517 Bacteria 4371
489 Ga0495631_0116539 3300046518 Bacteria 1149
490 Ga0495643_0086752 3300046522 Bacteria 1621
491 Ga0495586_0001078 3300046535 Bacteria 15403
492 Ga0495586_0003416 3300046535 Bacteria 8516
493 Ga0495586_0031754 3300046535 Bacteria 2830
494 Ga0495586_0057051 3300046535 Bacteria 2118
495 Ga0495587_0002655 3300046536 Bacteria 11943
496 Ga0495621_0001151 3300046539 Bacteria 6843
497 Ga0495645_0003098 3300046543 Bacteria 11264
498 Ga0495622_0126754 3300046557 Bacteria 1164
499 Ga0495633_0005962 3300046558 Bacteria 7322
500 Ga0495633_0183498 3300046558 Bacteria 963
501 Ga0495656_0003170 3300046615 Bacteria 5537
502 Ga0495656_0033620 3300046615 Bacteria 2094
503 Ga0495656_0049409 3300046615 Bacteria 1791
504 Ga0495656_0056328 3300046615 Bacteria 1698
505 Ga0495668_0000820 3300046616 Bacteria 35709
506 Ga0495668_0101920 3300046616 Bacteria 1570
507 Ga0495625_0002120 3300046660 Bacteria 22135
508 Ga0495588_0001848 3300046674 Bacteria 9027
509 Ga0495588_0009628 3300046674 Bacteria 4472
510 Ga0495588_0054122 3300046674 Bacteria 2070
511 Ga0495623_0007879 3300046679 Bacteria 6929
512 Ga0495670_0046189 3300046691 Bacteria 2175
513 Ga0495671_0019486 3300046692 Bacteria 3586
514 Ga0495600_0058243 3300046809 Bacteria 2523
515 Ga0495600_0059355 3300046809 Bacteria 2499
516 Ga0495581_0000128 3300047315 Bacteria 32831
517 Ga0495581_0019994 3300047315 Bacteria 3887
518 Ga0495581_0041548 3300047315 Bacteria 2661
519 Ga0495581_0122996 3300047315 Bacteria 1510
520 Ga0495604_0261973 3300047317 Bacteria 1175
521 Ga0495636_0000599 3300047318 Bacteria 13258
522 Ga0495636_0111595 3300047318 Bacteria 1203
523 Ga0495680_0015661 3300047322 Bacteria 6534
524 Ga0495687_002744 3300047443 Bacteria 13646
525 Ga0495675_0004789 3300047444 Bacteria 8224
526 Ga0495677_0032038 3300047445 Bacteria 1914
527 Ga0495681_0011450 3300047470 Bacteria 5282
528 Ga0495593_0052049 3300047673 Bacteria 2165
529 Ga0495614_0003756 3300048089 Bacteria 6822
530 Ga0495615_0015710 3300048090 Bacteria 1622
531 Ga0496100_0107150 3300048903 Bacteria 1935
532 Ga0496100_0150221 3300048903 Bacteria 1660
533 Ga0496100_0153783 3300048903 Bacteria 1643
534 Ga0496101_0061938 3300048904 Bacteria 2719
535 Ga0496101_0140312 3300048904 Bacteria 1841
536 Ga0496101_0235305 3300048904 Bacteria 1424
537 Ga0496101_0316272 3300048904 Bacteria 1224
538 Ga0496102_0015677 3300048905 Bacteria 6603
539 Ga0496102_0023629 3300048905 Bacteria 5462
540 Ga0496102_0182007 3300048905 Bacteria 1980
541 Ga0496102_0215983 3300048905 Bacteria 1807
542 Ga0496103_0021998 3300048906 Bacteria 3838
543 Ga0496103_0075902 3300048906 Bacteria 2108
544 Ga0496103_0150771 3300048906 Bacteria 1489
545 Ga0496104_0002342 3300048907 Bacteria 16376
546 Ga0496105_0001990 3300048908 Bacteria 14730
547 Ga0496105_0245855 3300048908 Bacteria 1451
548 Ga0496106_0014269 3300048909 Bacteria 5869
549 Ga0496106_0113007 3300048909 Bacteria 2116
550 Ga0496106_0155166 3300048909 Bacteria 1807
551 Ga0496107_0071071 3300048910 Bacteria 2528
552 Ga0496108_0029297 3300048911 Bacteria 4557
553 Ga0496108_0047240 3300048911 Bacteria 3598
554 Ga0496108_0101964 3300048911 Bacteria 2448
555 Ga0496108_0175385 3300048911 Unclassified 1856
556 Ga0496108_0421658 3300048911 Bacteria 1165
557 Ga0496109_0095228 3300048912 Bacteria 2756
558 Ga0496109_0201937 3300048912 Bacteria 1869
559 Ga0496109_0224372 3300048912 Bacteria 1767
560 Ga0496109_0281058 3300048912 Bacteria 1569
561 Ga0496110_0011013 3300048913 Bacteria 7380
562 Ga0496110_0060420 3300048913 Bacteria 3342
563 Ga0496110_0070083 3300048913 Bacteria 3105
564 Ga0496110_0131824 3300048913 Bacteria 2257
565 Ga0496110_0617577 3300048913 Bacteria 982
566 Ga0496111_0011112 3300048914 Bacteria 6060
567 Ga0496111_0018274 3300048914 Bacteria 4854
568 Ga0496111_0053672 3300048914 Bacteria 2912
569 Ga0496111_0284378 3300048914 Bacteria 1227
570 Ga0496112_0010013 3300048915 Bacteria 8580
571 Ga0496112_0029310 3300048915 Bacteria 5322
572 Ga0496112_0046986 3300048915 Bacteria 4234
573 Ga0496112_0534731 3300048915 Bacteria 1106
574 Ga0496112_0638958 3300048915 Bacteria 995
575 Ga0496113_0088467 3300048916 Bacteria 2382
576 Ga0496113_0120094 3300048916 Bacteria 2054
577 Ga0496113_0302582 3300048916 Bacteria 1280
578 Ga0496113_0430015 3300048916 Bacteria 1060
579 Ga0496114_0032805 3300048917 Bacteria 4277
580 Ga0496114_0135241 3300048917 Bacteria 2131
581 Ga0496114_0198065 3300048917 Bacteria 1758
582 Ga0496114_0305237 3300048917 Bacteria 1405
583 Ga0496118_0009087 3300048921 Bacteria 10122
584 Ga0496118_0066272 3300048921 Bacteria 2637
585 Ga0496122_0012430 3300048925 Bacteria 8476
586 Ga0496123_0004944 3300048926 Bacteria 13665
587 Ga0496124_0000009 3300048927 Bacteria 734820
588 Ga0496124_0159897 3300048927 Bacteria 1757
589 Ga0496124_0436455 3300048927 Bacteria 897
590 Ga0496125_0019360 3300048928 Bacteria 6423
591 Ga0496126_0271546 3300048929 Bacteria 1407
592 Ga0501290_001797 3300049513 Bacteria 2850
593 Ga0501031_0000156 3300049568 Bacteria 38816
594 Ga0501031_0076495 3300049568 Bacteria 2180
595 Ga0501032_0001239 3300049569 Bacteria 20482
596 Ga0501032_0017471 3300049569 Bacteria 5038
597 Ga0501032_0030653 3300049569 Bacteria 3690
598 Ga0501033_0002504 3300049570 Bacteria 15567
599 Ga0501033_0032947 3300049570 Bacteria 3890
600 Ga0501033_0254670 3300049570 Bacteria 1243
601 Ga0501034_0000057 3300049571 Bacteria 202455
602 Ga0501034_0040056 3300049571 Bacteria 4744
603 Ga0501034_0558402 3300049571 Bacteria 1054
604 Ga0501036_0001565 3300049572 Bacteria 17677
605 Ga0501037_0022824 3300049573 Bacteria 4626
606 Ga0501037_0047460 3300049573 Bacteria 3147
607 Ga0501037_0071373 3300049573 Bacteria 2526
608 Ga0501038_0005500 3300049574 Bacteria 11760
609 Ga0501038_0016885 3300049574 Bacteria 6606
610 Ga0501038_0380809 3300049574 Bacteria 1094
611 Ga0501042_0068334 3300049578 Bacteria 2541
612 Ga0501043_0006544 3300049579 Bacteria 9346
613 Ga0501043_0014674 3300049579 Bacteria 6134
614 Ga0501043_0016151 3300049579 Bacteria 5854
615 Ga0501043_0105858 3300049579 Bacteria 2209
616 Ga0501046_0000631 3300049580 Bacteria 34597
617 Ga0501046_0031424 3300049580 Bacteria 4303
618 Ga0501047_0011740 3300049581 Bacteria 8285
619 Ga0501047_0077892 3300049581 Bacteria 3188
620 Ga0501047_0309448 3300049581 Bacteria 1420
621 Ga0501048_0006530 3300049582 Bacteria 8865
622 Ga0501067_0018587 3300049583 Bacteria 3847
623 Ga0501067_0146578 3300049583 Bacteria 1315
624 Ga0501069_0011639 3300049585 Bacteria 4664
625 Ga0501070_0009017 3300049586 Bacteria 8440
626 Ga0501071_0056139 3300049587 Bacteria 2844
627 Ga0501073_0000422 3300049589 Bacteria 28939
628 Ga0501074_0007013 3300049590 Bacteria 8134
629 Ga0501075_0216575 3300049591 Bacteria 1461
630 Ga0501079_0018062 3300049741 Bacteria 5387
631 Ga0501080_0025172 3300049742 Bacteria 5523
632 Ga0501081_0016586 3300049743 Bacteria 4870
633 Ga0501083_0009150 3300049744 Bacteria 6997
634 Ga0501035_0026677 3300049822 Bacteria 5284
635 Ga0501035_0039279 3300049822 Bacteria 4283
636 Ga0501035_0050547 3300049822 Bacteria 3725
637 Ga0501044_0005418 3300049823 Bacteria 14173
638 Ga0501044_0018317 3300049823 Bacteria 7504
639 Ga0501044_0082740 3300049823 Bacteria 3247
640 Ga0501044_0322634 3300049823 Bacteria 1468
641 Ga0501044_0455351 3300049823 Bacteria 1185
642 nmdc:mga00v17_63631_c1 3300050491 Bacteria 2272
643 nmdc:mga00v17_6748_c1 3300050491 Bacteria 6099
644 nmdc:mga05p37_545699_c1 3300050507 Bacteria 1321
645 nmdc:mga06r32_86259_c1 3300050510 Bacteria 3061
646 nmdc:mga0n895_75665_c1 3300050512 Bacteria 3347
647 nmdc:mga0rr50_15964_c1 3300050513 Bacteria 4973
648 nmdc:mga08x19_6305_c1 3300050514 Bacteria 7023
649 Ga0495655_0004111 3300053083 Bacteria 2465
650 Ga0500644_0082720 3300053088 Bacteria 1184
651 Ga0500560_002972 3300053107 Bacteria 3347
652 Ga0500573_0000031 3300053140 Bacteria 134098
653 Ga0500573_0213382 3300053140 Bacteria 1017
654 Ga0500634_0000098 3300053161 Bacteria 34065
655 Ga0501084_0002400 3300054114 Bacteria 15070
656 Ga0501084_0373777 3300054114 Bacteria 1204

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047443 Ga0495687_002744 Ga0495687_002744_4477_5142 208
2 3300053088 Ga0500644_0082720 Ga0500644_0082720_482_1147 208
3 3300009098 Ga0105245_10181652 Ga0105245_101816522 210
4 3300048911 Ga0496108_0175385 Ga0496108_0175385_925_1593 210
5 3300031665 Ga0316575_10011793 Ga0316575_100117932 213
6 3300031727 Ga0316576_10038680 Ga0316576_100386803 213
7 3300031728 Ga0316578_10120001 Ga0316578_101200012 213
8 3300032137 Ga0316585_10080090 Ga0316585_100800901 213
9 3300035398 Ga0316574_0032437 Ga0316574_0032437_1954_2715 213
10 3300005338 Ga0068868_100423604 Ga0068868_1004236042 214
11 3300031507 Ga0307509_10025648 Ga0307509_100256484 214
12 3300048911 Ga0496108_0029297 Ga0496108_0029297_3279_4043 214
13 3300048913 Ga0496110_0011013 Ga0496110_0011013_1620_2384 214
14 3300031731 Ga0307405_10612877 Ga0307405_106128771 215
15 3300032004 Ga0307414_10293181 Ga0307414_102931812 215
16 3300048912 Ga0496109_0281058 Ga0496109_0281058_338_1156 217
17 3300041413 Ga0439465_0020201 Ga0439465_0020201_28_780 218
18 3300005337 Ga0070682_100196204 Ga0070682_1001962042 219
19 3300005535 Ga0070684_100602151 Ga0070684_1006021512 219
20 3300009148 Ga0105243_10569870 Ga0105243_105698702 219
21 3300048917 Ga0496114_0032805 Ga0496114_0032805_15_779 219
22 3300048927 Ga0496124_0000009 Ga0496124_0000009_425523_426293 220
23 3300042876 Ga0451577_0051922 Ga0451577_0051922_1700_2467 221
24 3300041413 Ga0439465_0000040 Ga0439465_0000040_16767_17537 223
25 3300042007 Ga0439449_0000134 Ga0439449_0000134_3395_4165 223
26 3300048914 Ga0496111_0284378 Ga0496111_0284378_22_783 224
27 3300053140 Ga0500573_0000031 Ga0500573_0000031_90746_91456 224
28 3300005354 Ga0070675_100283792 Ga0070675_1002837921 225
29 3300005355 Ga0070671_100081121 Ga0070671_1000811213 225
30 3300005841 Ga0068863_100252755 Ga0068863_1002527552 225
31 3300012512 Ga0157327_1004598 Ga0157327_10045982 225
32 3300013308 Ga0157375_10427572 Ga0157375_104275721 225
33 3300014326 Ga0157380_10883152 Ga0157380_108831521 225
34 3300025940 Ga0207691_10752285 Ga0207691_107522851 225
35 3300046615 Ga0495656_0003170 Ga0495656_0003170_4709_5479 225
36 3300048911 Ga0496108_0421658 Ga0496108_0421658_201_971 225
37 3300048912 Ga0496109_0224372 Ga0496109_0224372_961_1731 225
38 3300048913 Ga0496110_0131824 Ga0496110_0131824_601_1371 225
39 3300048914 Ga0496111_0018274 Ga0496111_0018274_779_1549 225
40 3300048917 Ga0496114_0135241 Ga0496114_0135241_715_1485 225
41 3300048927 Ga0496124_0159897 Ga0496124_0159897_592_1362 225
42 3300049573 Ga0501037_0047460 Ga0501037_0047460_1432_2226 225
43 3300049823 Ga0501044_0082740 Ga0501044_0082740_375_1169 225
44 3300053140 Ga0500573_0213382 Ga0500573_0213382_72_827 225
45 3300005329 Ga0070683_100183528 Ga0070683_1001835283 226
46 3300037418 Ga0395900_0120432 Ga0395900_0120432_707_1501 226
47 3300037466 Ga0395898_0319772 Ga0395898_0319772_246_1040 226
48 3300038443 Ga0395901_0336293 Ga0395901_0336293_137_931 226
49 3300037466 Ga0395898_0223338 Ga0395898_0223338_833_1582 227
50 3300042131 Ga0450894_010499 Ga0450894_010499_123_893 230
51 3300013105 Ga0157369_10012353 Ga0157369_100123534 231
52 3300003203 JGI25406J46586_10019261 JGI25406J46586_100192613 232
53 3300005563 Ga0068855_100376828 Ga0068855_1003768282 232
54 3300005985 Ga0081539_10001488 Ga0081539_1000148840 232
55 3300031903 Ga0307407_10019104 Ga0307407_100191042 232
56 3300031911 Ga0307412_10267703 Ga0307412_102677031 232
57 3300031995 Ga0307409_100427300 Ga0307409_1004273002 232
58 3300041452 Ga0451793_0611243 Ga0451793_0611243_835_1569 232
59 3300005331 Ga0070670_100197699 Ga0070670_1001976992 233
60 3300011119 Ga0105246_10201187 Ga0105246_102011872 233
61 3300048905 Ga0496102_0182007 Ga0496102_0182007_816_1634 233
62 3300048906 Ga0496103_0021998 Ga0496103_0021998_2779_3597 233
63 3300049571 Ga0501034_0558402 Ga0501034_0558402_266_1036 233
64 3300045976 Ga0466967_0876924 Ga0466967_0876924_133_879 234
65 3300045836 Ga0466958_0003576 Ga0466958_0003576_1680_2441 235
66 3300049513 Ga0501290_001797 Ga0501290_001797_269_1054 235
67 3300032002 Ga0307416_100143614 Ga0307416_1001436141 236
68 3300048903 Ga0496100_0153783 Ga0496100_0153783_201_1055 236
69 3300048904 Ga0496101_0140312 Ga0496101_0140312_70_924 236
70 3300048906 Ga0496103_0075902 Ga0496103_0075902_573_1427 236
71 iso_pu_bacteria 2537561592 2537900606 236
72 iso_pu_bacteria 2571042365 2572253699 236
73 iso_pu_bacteria 2643221559 2643818882 236
74 iso_pu_bacteria 2643221573 2643878541 236
75 iso_pu_bacteria 2643221586 2643941458 236
76 iso_pu_bacteria 2643221612 2644080302 236
77 iso_pu_bacteria 2643221616 2644094962 236
78 iso_pu_bacteria 2643221632 2644181051 236
79 iso_pu_bacteria 2643221695 2644529005 236
80 iso_pu_bacteria 2643221720 2644659852 236
81 iso_pu_bacteria 2643221727 2644696916 236
82 iso_pu_bacteria 2643221728 2644700407 236
83 iso_pu_bacteria 2747842428 2747949482 236
84 iso_pu_bacteria 2747842501 2748019772 236
85 iso_pu_bacteria 2765235840 2765578886 236
86 iso_pu_bacteria 2816332141 2816516961 236
87 iso_pu_bacteria 2818991457 2819659670 236
88 iso_pu_bacteria 2842391507 2842393056 236
89 iso_pu_bacteria 2842780639 2842780903 236
90 iso_pu_bacteria 2852684882 2852685527 236
91 iso_pu_bacteria 2874220319 2874221538 236
92 iso_pu_bacteria 2884763398 2884764341 236
93 iso_pu_bacteria 2895498888 2895500763 236
94 iso_pu_bacteria 2895511927 2895516367 236
95 iso_pu_bacteria 2895522137 2895523714 236
96 iso_pu_bacteria 2895525241 2895526705 236
97 iso_pu_bacteria 2919089067 2919089795 236
98 iso_pu_bacteria 2919130084 2919131682 236
99 iso_pu_bacteria 2919134579 2919137733 236
100 iso_pu_bacteria 2919395869 2919398841 236
101 iso_pu_bacteria 2928496128 2928500255 236
102 iso_pu_bacteria 2929195423 2929197948 236
103 iso_pu_bacteria 2931380184 2931380838 236
104 iso_pu_bacteria 2937610967 2937612355 236
105 iso_pu_bacteria 2939626828 2939630902 236
106 iso_pu_bacteria 2941489479 2941492950 236
107 iso_pu_bacteria 2961047084 2961048305 236
108 iso_pu_bacteria 2961064222 2961065302 236
109 iso_pu_bacteria 2995948881 2995952269 236
110 iso_pu_bacteria 8021622325 8021624258 236
111 iso_pu_bacteria 8021648035 8021649093 236
112 3300031901 Ga0307406_10394798 Ga0307406_103947981 237
113 iso_pu_bacteria 2868088558 2868093791 237
114 iso_pu_bacteria 2883821847 2883822344 237
115 iso_pu_bacteria 2919051321 2919053750 237
116 3300003659 JGI25404J52841_10003860 JGI25404J52841_100038602 238
117 3300005983 Ga0081540_1010321 Ga0081540_10103217 238
118 3300005983 Ga0081540_1021999 Ga0081540_10219994 238
119 3300009553 Ga0105249_10522775 Ga0105249_105227752 238
120 3300031456 Ga0307513_10019869 Ga0307513_100198697 238
121 3300031727 Ga0316576_10040342 Ga0316576_100403422 238
122 3300031727 Ga0316576_10327650 Ga0316576_103276502 238
123 3300035398 Ga0316574_0006917 Ga0316574_0006917_1188_1949 238
124 3300035398 Ga0316574_0044941 Ga0316574_0044941_983_1744 238
125 3300035398 Ga0316574_0048231 Ga0316574_0048231_1205_1966 238
126 3300035398 Ga0316574_0170441 Ga0316574_0170441_631_1392 238
127 3300035398 Ga0316574_0286349 Ga0316574_0286349_22_783 238
128 3300046475 Ga0495639_0027634 Ga0495639_0027634_548_1309 238
129 3300048903 Ga0496100_0150221 Ga0496100_0150221_149_970 238
130 3300048909 Ga0496106_0014269 Ga0496106_0014269_1934_2788 238
131 3300048910 Ga0496107_0071071 Ga0496107_0071071_667_1521 238
132 3300048913 Ga0496110_0617577 Ga0496110_0617577_55_909 238
133 3300048914 Ga0496111_0053672 Ga0496111_0053672_2017_2871 238
134 3300049578 Ga0501042_0068334 Ga0501042_0068334_753_1535 238
135 3300049583 Ga0501067_0146578 Ga0501067_0146578_352_1113 238
136 3300005328 Ga0070676_10034053 Ga0070676_100340533 239
137 3300005331 Ga0070670_100064788 Ga0070670_1000647883 239
138 3300005353 Ga0070669_100014843 Ga0070669_1000148432 239
139 3300005354 Ga0070675_100031498 Ga0070675_1000314982 239
140 3300005355 Ga0070671_100006111 Ga0070671_1000061115 239
141 3300005356 Ga0070674_100069872 Ga0070674_1000698722 239
142 3300005364 Ga0070673_100019569 Ga0070673_1000195696 239
143 3300005456 Ga0070678_100034742 Ga0070678_1000347422 239
144 3300005543 Ga0070672_100536790 Ga0070672_1005367901 239
145 3300009011 Ga0105251_10005393 Ga0105251_100053938 239
146 3300009148 Ga0105243_10671502 Ga0105243_106715021 239
147 3300009177 Ga0105248_10060903 Ga0105248_100609032 239
148 3300011119 Ga0105246_10228581 Ga0105246_102285812 239
149 3300013102 Ga0157371_10079159 Ga0157371_100791592 239
150 3300025901 Ga0207688_10096039 Ga0207688_100960392 239
151 3300025903 Ga0207680_10039388 Ga0207680_100393881 239
152 3300025925 Ga0207650_10003161 Ga0207650_100031618 239
153 3300025935 Ga0207709_10184352 Ga0207709_101843522 239
154 3300025940 Ga0207691_10002149 Ga0207691_1000214911 239
155 3300025960 Ga0207651_10072652 Ga0207651_100726523 239
156 3300026121 Ga0207683_10008663 Ga0207683_100086633 239
157 3300031548 Ga0307408_100298891 Ga0307408_1002988911 239
158 3300031901 Ga0307406_10445594 Ga0307406_104455942 239
159 3300032002 Ga0307416_100262868 Ga0307416_1002628682 239
160 3300046522 Ga0495643_0086752 Ga0495643_0086752_47_868 239
161 3300046557 Ga0495622_0126754 Ga0495622_0126754_198_1019 239
162 3300046616 Ga0495668_0101920 Ga0495668_0101920_196_1017 239
163 3300047315 Ga0495581_0122996 Ga0495581_0122996_306_1127 239
164 3300048904 Ga0496101_0316272 Ga0496101_0316272_145_966 239
165 3300048905 Ga0496102_0215983 Ga0496102_0215983_664_1485 239
166 3300048909 Ga0496106_0155166 Ga0496106_0155166_664_1485 239
167 3300048912 Ga0496109_0095228 Ga0496109_0095228_1395_2249 239
168 3300048916 Ga0496113_0088467 Ga0496113_0088467_149_970 239
169 3300048917 Ga0496114_0198065 Ga0496114_0198065_920_1741 239
170 3300048927 Ga0496124_0436455 Ga0496124_0436455_47_868 239
171 3300048928 Ga0496125_0019360 Ga0496125_0019360_3277_4098 239
172 iso_pu_bacteria 2808606700 2810363021 239
173 iso_pu_bacteria 2905926851 2905930732 239
174 iso_pu_bacteria 2946003308 2946006860 239
175 3300002067 JGI24735J21928_10078630 JGI24735J21928_100786301 240
176 3300002737 JGI25162J39368_1010474 JGI25162J39368_10104742 240
177 3300002772 JGI25164J39214_1000399 JGI25164J39214_100039917 240
178 3300003187 JGI25151J46595_10000059 JGI25151J46595_100000596 240
179 3300003203 JGI25406J46586_10033712 JGI25406J46586_100337122 240
180 3300003214 JGI25165J46597_1000148 JGI25165J46597_1000148117 240
181 3300003752 Ga0055539_1000103 Ga0055539_100010316 240
182 3300003756 Ga0055533_1000020 Ga0055533_1000020262 240
183 3300003759 Ga0055525_1000312 Ga0055525_100031217 240
184 3300003771 Ga0055526_1000617 Ga0055526_10006171 240
185 3300003773 Ga0055537_1000450 Ga0055537_100045034 240
186 3300003775 Ga0055524_1000568 Ga0055524_100056833 240
187 3300003781 Ga0055536_1003611 Ga0055536_10036117 240
188 3300003784 Ga0055534_1000385 Ga0055534_100038533 240
189 3300003790 Ga0055528_1000580 Ga0055528_100058033 240
190 3300003794 Ga0055531_10022879 Ga0055531_100228792 240
191 3300003841 Ga0055541_1005026 Ga0055541_10050262 240
192 3300003856 Ga0058692_1000031 Ga0058692_1000031124 240
193 3300003856 Ga0058692_1000060 Ga0058692_100006043 240
194 3300005288 Ga0065714_10016134 Ga0065714_100161342 240
195 3300005289 Ga0065704_10070531 Ga0065704_100705312 240
196 3300005293 Ga0065715_10001250 Ga0065715_100012507 240
197 3300005327 Ga0070658_10291421 Ga0070658_102914212 240
198 3300005328 Ga0070676_10137939 Ga0070676_101379391 240
199 3300005331 Ga0070670_100029702 Ga0070670_1000297022 240
200 3300005334 Ga0068869_100013607 Ga0068869_1000136072 240
201 3300005335 Ga0070666_10059807 Ga0070666_100598073 240
202 3300005336 Ga0070680_100134724 Ga0070680_1001347243 240
203 3300005336 Ga0070680_100341851 Ga0070680_1003418512 240
204 3300005337 Ga0070682_100001726 Ga0070682_1000017266 240
205 3300005338 Ga0068868_100031924 Ga0068868_1000319243 240
206 3300005339 Ga0070660_100133048 Ga0070660_1001330482 240
207 3300005340 Ga0070689_100337940 Ga0070689_1003379402 240
208 3300005343 Ga0070687_100011905 Ga0070687_1000119053 240
209 3300005344 Ga0070661_100667782 Ga0070661_1006677821 240
210 3300005353 Ga0070669_100031578 Ga0070669_1000315781 240
211 3300005353 Ga0070669_100336529 Ga0070669_1003365292 240
212 3300005354 Ga0070675_100031963 Ga0070675_1000319632 240
213 3300005355 Ga0070671_100039581 Ga0070671_1000395812 240
214 3300005355 Ga0070671_100132600 Ga0070671_1001326002 240
215 3300005364 Ga0070673_100194811 Ga0070673_1001948112 240
216 3300005366 Ga0070659_100099320 Ga0070659_1000993202 240
217 3300005367 Ga0070667_100731224 Ga0070667_1007312241 240
218 3300005434 Ga0070709_10069210 Ga0070709_100692102 240
219 3300005436 Ga0070713_100001424 Ga0070713_10000142412 240
220 3300005438 Ga0070701_10007294 Ga0070701_100072945 240
221 3300005456 Ga0070678_100033250 Ga0070678_1000332502 240
222 3300005458 Ga0070681_10121318 Ga0070681_101213182 240
223 3300005458 Ga0070681_10138837 Ga0070681_101388372 240
224 3300005458 Ga0070681_10168667 Ga0070681_101686673 240
225 3300005530 Ga0070679_100089383 Ga0070679_1000893832 240
226 3300005530 Ga0070679_100476289 Ga0070679_1004762892 240
227 3300005530 Ga0070679_100713618 Ga0070679_1007136181 240
228 3300005543 Ga0070672_100159620 Ga0070672_1001596202 240
229 3300005547 Ga0070693_100004599 Ga0070693_1000045996 240
230 3300005548 Ga0070665_100406961 Ga0070665_1004069612 240
231 3300005563 Ga0068855_100138824 Ga0068855_1001388242 240
232 3300005564 Ga0070664_100152562 Ga0070664_1001525623 240
233 3300005578 Ga0068854_100025286 Ga0068854_1000252864 240
234 3300005615 Ga0070702_100000212 Ga0070702_1000002122 240
235 3300005616 Ga0068852_100134527 Ga0068852_1001345272 240
236 3300005616 Ga0068852_100282821 Ga0068852_1002828213 240
237 3300005617 Ga0068859_100140908 Ga0068859_1001409082 240
238 3300005618 Ga0068864_100088914 Ga0068864_1000889142 240
239 3300005834 Ga0068851_10017690 Ga0068851_100176903 240
240 3300005840 Ga0068870_10000198 Ga0068870_100001984 240
241 3300005841 Ga0068863_100035364 Ga0068863_1000353643 240
242 3300005841 Ga0068863_100109289 Ga0068863_1001092893 240
243 3300005842 Ga0068858_100041877 Ga0068858_1000418774 240
244 3300005983 Ga0081540_1027543 Ga0081540_10275431 240
245 3300005985 Ga0081539_10003292 Ga0081539_1000329216 240
246 3300006051 Ga0075364_10000075 Ga0075364_1000007529 240
247 3300006051 Ga0075364_10014729 Ga0075364_100147298 240
248 3300006175 Ga0070712_100052353 Ga0070712_1000523532 240
249 3300006186 Ga0075369_10056644 Ga0075369_100566442 240
250 3300006358 Ga0068871_100002932 Ga0068871_10000293213 240
251 3300006844 Ga0075428_100141407 Ga0075428_1001414071 240
252 3300006846 Ga0075430_100170040 Ga0075430_1001700402 240
253 3300006871 Ga0075434_100020271 Ga0075434_1000202713 240
254 3300006914 Ga0075436_100005883 Ga0075436_1000058838 240
255 3300006931 Ga0097620_100140916 Ga0097620_1001409162 240
256 3300007076 Ga0075435_100002423 Ga0075435_1000024238 240
257 3300009011 Ga0105251_10069511 Ga0105251_100695112 240
258 3300009093 Ga0105240_10152849 Ga0105240_101528493 240
259 3300009093 Ga0105240_10208895 Ga0105240_102088952 240
260 3300009094 Ga0111539_10007824 Ga0111539_1000782416 240
261 3300009098 Ga0105245_10068211 Ga0105245_100682112 240
262 3300009098 Ga0105245_10467159 Ga0105245_104671592 240
263 3300009101 Ga0105247_10062869 Ga0105247_100628693 240
264 3300009101 Ga0105247_10293305 Ga0105247_102933051 240
265 3300009147 Ga0114129_10169938 Ga0114129_101699382 240
266 3300009148 Ga0105243_10012792 Ga0105243_100127927 240
267 3300009148 Ga0105243_10385471 Ga0105243_103854711 240
268 3300009174 Ga0105241_10093692 Ga0105241_100936922 240
269 3300009177 Ga0105248_10202027 Ga0105248_102020273 240
270 3300009545 Ga0105237_10080772 Ga0105237_100807722 240
271 3300009551 Ga0105238_10007400 Ga0105238_100074002 240
272 3300010375 Ga0105239_10104594 Ga0105239_101045944 240
273 3300011119 Ga0105246_10037618 Ga0105246_100376182 240
274 3300013100 Ga0157373_10091699 Ga0157373_100916993 240
275 3300013100 Ga0157373_10127794 Ga0157373_101277942 240
276 3300013102 Ga0157371_10006531 Ga0157371_1000653110 240
277 3300013102 Ga0157371_10117872 Ga0157371_101178722 240
278 3300013102 Ga0157371_10410365 Ga0157371_104103651 240
279 3300013104 Ga0157370_10112173 Ga0157370_101121733 240
280 3300013104 Ga0157370_10249793 Ga0157370_102497932 240
281 3300013105 Ga0157369_10042335 Ga0157369_100423354 240
282 3300013105 Ga0157369_10093022 Ga0157369_100930222 240
283 3300013105 Ga0157369_10472479 Ga0157369_104724791 240
284 3300013296 Ga0157374_10034297 Ga0157374_100342973 240
285 3300013307 Ga0157372_10182398 Ga0157372_101823983 240
286 3300013307 Ga0157372_10310262 Ga0157372_103102622 240
287 3300013307 Ga0157372_10545996 Ga0157372_105459962 240
288 3300014325 Ga0163163_10056369 Ga0163163_100563693 240
289 3300014325 Ga0163163_10732460 Ga0163163_107324602 240
290 3300014326 Ga0157380_10200341 Ga0157380_102003411 240
291 3300014745 Ga0157377_10108172 Ga0157377_101081722 240
292 3300014968 Ga0157379_10099465 Ga0157379_100994652 240
293 3300014969 Ga0157376_10082183 Ga0157376_100821832 240
294 3300015261 Ga0182006_1052226 Ga0182006_10522261 240
295 3300015265 Ga0182005_1011353 Ga0182005_10113532 240
296 3300020069 Ga0197907_10025204 Ga0197907_100252042 240
297 3300020069 Ga0197907_10275978 Ga0197907_102759783 240
298 3300020070 Ga0206356_10524634 Ga0206356_105246342 240
299 3300020080 Ga0206350_11092398 Ga0206350_110923982 240
300 3300020081 Ga0206354_11559491 Ga0206354_115594913 240
301 3300020082 Ga0206353_10091682 Ga0206353_100916822 240
302 3300020082 Ga0206353_11305176 Ga0206353_113051764 240
303 3300025225 Ga0209566_100043 Ga0209566_100043173 240
304 3300025226 Ga0209674_100001 Ga0209674_1000013637 240
305 3300025230 Ga0209563_100001 Ga0209563_1000013637 240
306 3300025230 Ga0209563_100183 Ga0209563_10018318 240
307 3300025231 Ga0207427_100407 Ga0207427_10040717 240
308 3300025233 Ga0209437_100315 Ga0209437_10031554 240
309 3300025245 Ga0207425_1005261 Ga0207425_10052614 240
310 3300025253 Ga0209677_100001 Ga0209677_1000013637 240
311 3300025253 Ga0209677_100407 Ga0209677_10040712 240
312 3300025261 Ga0209233_1000014 Ga0209233_1000014242 240
313 3300025263 Ga0209565_1000005 Ga0209565_1000005162 240
314 3300025273 Ga0209673_1000027 Ga0209673_1000027163 240
315 3300025291 Ga0209675_1000004 Ga0209675_1000004162 240
316 3300025292 Ga0209676_1000068 Ga0209676_1000068161 240
317 3300025294 Ga0209025_1000005 Ga0209025_1000005213 240
318 3300025295 Ga0209564_1000050 Ga0209564_1000050163 240
319 3300025297 Ga0209758_1004731 Ga0209758_10047315 240
320 3300025298 Ga0209050_1006127 Ga0209050_10061274 240
321 3300025299 Ga0209256_1000031 Ga0209256_1000031163 240
322 3300025304 Ga0209257_1000645 Ga0209257_100064510 240
323 3300025321 Ga0207656_10163503 Ga0207656_101635031 240
324 3300025900 Ga0207710_10013970 Ga0207710_100139702 240
325 3300025901 Ga0207688_10031636 Ga0207688_100316362 240
326 3300025903 Ga0207680_10068500 Ga0207680_100685002 240
327 3300025907 Ga0207645_10023729 Ga0207645_100237293 240
328 3300025908 Ga0207643_10000202 Ga0207643_100002025 240
329 3300025909 Ga0207705_10010432 Ga0207705_100104322 240
330 3300025909 Ga0207705_10102236 Ga0207705_101022362 240
331 3300025909 Ga0207705_10229616 Ga0207705_102296162 240
332 3300025912 Ga0207707_10072709 Ga0207707_100727092 240
333 3300025913 Ga0207695_10045863 Ga0207695_100458635 240
334 3300025913 Ga0207695_10124286 Ga0207695_101242861 240
335 3300025915 Ga0207693_10212410 Ga0207693_102124102 240
336 3300025917 Ga0207660_10393572 Ga0207660_103935721 240
337 3300025919 Ga0207657_10011873 Ga0207657_100118737 240
338 3300025919 Ga0207657_10035234 Ga0207657_100352343 240
339 3300025923 Ga0207681_10033056 Ga0207681_100330564 240
340 3300025924 Ga0207694_10100706 Ga0207694_101007062 240
341 3300025928 Ga0207700_10031192 Ga0207700_100311921 240
342 3300025929 Ga0207664_10024041 Ga0207664_100240414 240
343 3300025931 Ga0207644_10041703 Ga0207644_100417033 240
344 3300025932 Ga0207690_10038933 Ga0207690_100389334 240
345 3300025933 Ga0207706_10421784 Ga0207706_104217842 240
346 3300025935 Ga0207709_10000632 Ga0207709_100006326 240
347 3300025935 Ga0207709_10595464 Ga0207709_105954641 240
348 3300025936 Ga0207670_10321697 Ga0207670_103216972 240
349 3300025940 Ga0207691_10009924 Ga0207691_1000992410 240
350 3300025942 Ga0207689_10004258 Ga0207689_100042587 240
351 3300025944 Ga0207661_10005333 Ga0207661_100053338 240
352 3300025944 Ga0207661_10309604 Ga0207661_103096042 240
353 3300025945 Ga0207679_10008214 Ga0207679_100082144 240
354 3300025945 Ga0207679_10349168 Ga0207679_103491682 240
355 3300025949 Ga0207667_10694481 Ga0207667_106944812 240
356 3300025960 Ga0207651_10026046 Ga0207651_100260462 240
357 3300025981 Ga0207640_10318566 Ga0207640_103185661 240
358 3300026023 Ga0207677_10006429 Ga0207677_100064296 240
359 3300026035 Ga0207703_10074827 Ga0207703_100748272 240
360 3300026067 Ga0207678_10001765 Ga0207678_1000176514 240
361 3300026075 Ga0207708_10038908 Ga0207708_100389082 240
362 3300026078 Ga0207702_10001104 Ga0207702_1000110418 240
363 3300026078 Ga0207702_10007880 Ga0207702_100078806 240
364 3300026088 Ga0207641_10029111 Ga0207641_100291113 240
365 3300026088 Ga0207641_10218608 Ga0207641_102186082 240
366 3300026095 Ga0207676_10001801 Ga0207676_1000180115 240
367 3300026116 Ga0207674_10065152 Ga0207674_100651523 240
368 3300026121 Ga0207683_10028397 Ga0207683_100283974 240
369 3300027312 Ga0209371_1000004 Ga0209371_100000454 240
370 3300027312 Ga0209371_1000139 Ga0209371_100013943 240
371 3300027360 Ga0209969_1011375 Ga0209969_10113751 240
372 3300027364 Ga0209967_1023242 Ga0209967_10232421 240
373 3300027424 Ga0209984_1021647 Ga0209984_10216471 240
374 3300027665 Ga0209983_1007204 Ga0209983_10072042 240
375 3300027876 Ga0209974_10010966 Ga0209974_100109663 240
376 3300028379 Ga0268266_10037476 Ga0268266_100374765 240
377 3300028379 Ga0268266_10084548 Ga0268266_100845482 240
378 3300028786 Ga0307517_10025256 Ga0307517_100252565 240
379 3300028794 Ga0307515_10000050 Ga0307515_10000050125 240
380 3300030500 Ga0268256_1000005 Ga0268256_1000005991 240
381 3300030500 Ga0268256_1000109 Ga0268256_100010959 240
382 3300030521 Ga0307511_10002943 Ga0307511_100029436 240
383 3300030522 Ga0307512_10092674 Ga0307512_100926741 240
384 3300031507 Ga0307509_10003130 Ga0307509_1000313012 240
385 3300031507 Ga0307509_10011263 Ga0307509_100112634 240
386 3300031507 Ga0307509_10022296 Ga0307509_100222962 240
387 3300031548 Ga0307408_100010694 Ga0307408_1000106943 240
388 3300031548 Ga0307408_100028576 Ga0307408_1000285762 240
389 3300031616 Ga0307508_10204463 Ga0307508_102044632 240
390 3300031649 Ga0307514_10173113 Ga0307514_101731132 240
391 3300031727 Ga0316576_10072333 Ga0316576_100723333 240
392 3300031730 Ga0307516_10004353 Ga0307516_1000435313 240
393 3300031731 Ga0307405_10395812 Ga0307405_103958122 240
394 3300031824 Ga0307413_10001980 Ga0307413_100019804 240
395 3300031824 Ga0307413_10163763 Ga0307413_101637631 240
396 3300031824 Ga0307413_10574935 Ga0307413_105749351 240
397 3300031852 Ga0307410_10134472 Ga0307410_101344722 240
398 3300031901 Ga0307406_10092869 Ga0307406_100928693 240
399 3300031911 Ga0307412_10002168 Ga0307412_1000216812 240
400 3300031911 Ga0307412_10035423 Ga0307412_100354233 240
401 3300031911 Ga0307412_10065910 Ga0307412_100659103 240
402 3300031995 Ga0307409_100063441 Ga0307409_1000634413 240
403 3300031995 Ga0307409_100105038 Ga0307409_1001050382 240
404 3300032002 Ga0307416_100110407 Ga0307416_1001104072 240
405 3300032004 Ga0307414_10049127 Ga0307414_100491273 240
406 3300032004 Ga0307414_10305827 Ga0307414_103058272 240
407 3300032004 Ga0307414_10502267 Ga0307414_105022672 240
408 3300032126 Ga0307415_100079701 Ga0307415_1000797011 240
409 3300033180 Ga0307510_10005740 Ga0307510_100057408 240
410 3300033180 Ga0307510_10249959 Ga0307510_102499592 240
411 3300037312 Ga0395899_0040126 Ga0395899_0040126_1110_1904 240
412 3300037312 Ga0395899_0109651 Ga0395899_0109651_66_833 240
413 3300037312 Ga0395899_0125320 Ga0395899_0125320_1011_1778 240
414 3300037312 Ga0395899_0152367 Ga0395899_0152367_564_1331 240
415 3300037418 Ga0395900_0022120 Ga0395900_0022120_4920_5690 240
416 3300037418 Ga0395900_0122009 Ga0395900_0122009_225_992 240
417 3300037418 Ga0395900_0325828 Ga0395900_0325828_444_1214 240
418 3300037466 Ga0395898_0015445 Ga0395898_0015445_3507_4274 240
419 3300037466 Ga0395898_0073111 Ga0395898_0073111_1077_1844 240
420 3300037466 Ga0395898_0083391 Ga0395898_0083391_1186_1956 240
421 3300037466 Ga0395898_0361270 Ga0395898_0361270_393_1160 240
422 3300037466 Ga0395898_0405738 Ga0395898_0405738_88_849 240
423 3300037471 Ga0395905_0008483 Ga0395905_0008483_340_1110 240
424 3300037471 Ga0395905_0468542 Ga0395905_0468542_49_819 240
425 3300038443 Ga0395901_0012060 Ga0395901_0012060_7785_8552 240
426 3300038443 Ga0395901_0061266 Ga0395901_0061266_49_819 240
427 3300038443 Ga0395901_0316219 Ga0395901_0316219_694_1461 240
428 3300038443 Ga0395901_0461056 Ga0395901_0461056_307_1074 240
429 3300038705 Ga0237819_05553 Ga0237819_05553_777_1547 240
430 3300041406 Ga0439439_0037080 Ga0439439_0037080_61_831 240
431 3300041451 Ga0451791_1883876 Ga0451791_1883876_274_1035 240
432 3300041452 Ga0451793_0432375 Ga0451793_0432375_2573_3343 240
433 3300041459 Ga0451800_1224437 Ga0451800_1224437_1875_2645 240
434 3300041462 Ga0451806_620901 Ga0451806_620901_961_1731 240
435 3300041486 Ga0451807_1378455 Ga0451807_1378455_381_1151 240
436 3300041509 Ga0451843_1504794 Ga0451843_1504794_412_1173 240
437 3300041512 Ga0451853_0174512 Ga0451853_0174512_44_814 240
438 3300042006 Ga0439432_005823 Ga0439432_005823_1276_2046 240
439 3300042007 Ga0439449_0008474 Ga0439449_0008474_1714_2484 240
440 3300042007 Ga0439449_0042385 Ga0439449_0042385_412_1182 240
441 3300042016 Ga0439463_013653 Ga0439463_013653_574_1338 240
442 3300042157 Ga0439458_0039149 Ga0439458_0039149_299_1063 240
443 3300044658 Ga0466972_0080846 Ga0466972_0080846_231_992 240
444 3300044683 Ga0466965_0276357 Ga0466965_0276357_32_808 240
445 3300044684 Ga0466966_0010237 Ga0466966_0010237_1361_2122 240
446 3300044735 Ga0466968_0022494 Ga0466968_0022494_1505_2266 240
447 3300044765 Ga0466970_0026478 Ga0466970_0026478_373_1134 240
448 3300044765 Ga0466970_0289341 Ga0466970_0289341_96_857 240
449 3300044842 Ga0466957_0085023 Ga0466957_0085023_1184_1945 240
450 3300045049 Ga0466959_0026949 Ga0466959_0026949_41_802 240
451 3300046459 Ga0495629_0015808 Ga0495629_0015808_3085_3846 240
452 3300046499 Ga0495594_0019951 Ga0495594_0019951_2698_3477 240
453 3300046501 Ga0495607_0037418 Ga0495607_0037418_1645_2415 240
454 3300046507 Ga0495606_0012571 Ga0495606_0012571_785_1555 240
455 3300046518 Ga0495631_0116539 Ga0495631_0116539_18_788 240
456 3300046539 Ga0495621_0001151 Ga0495621_0001151_2267_3037 240
457 3300046558 Ga0495633_0005962 Ga0495633_0005962_4084_4854 240
458 3300046615 Ga0495656_0033620 Ga0495656_0033620_1166_1936 240
459 3300046615 Ga0495656_0049409 Ga0495656_0049409_149_919 240
460 3300046615 Ga0495656_0056328 Ga0495656_0056328_231_1001 240
461 3300046616 Ga0495668_0000820 Ga0495668_0000820_13222_13992 240
462 3300046660 Ga0495625_0002120 Ga0495625_0002120_19701_20462 240
463 3300046674 Ga0495588_0009628 Ga0495588_0009628_3227_3988 240
464 3300046692 Ga0495671_0019486 Ga0495671_0019486_1825_2586 240
465 3300047318 Ga0495636_0000599 Ga0495636_0000599_8600_9370 240
466 3300047318 Ga0495636_0111595 Ga0495636_0111595_336_1106 240
467 3300047470 Ga0495681_0011450 Ga0495681_0011450_3697_4458 240
468 3300048089 Ga0495614_0003756 Ga0495614_0003756_3134_3895 240
469 3300048904 Ga0496101_0061938 Ga0496101_0061938_352_1116 240
470 3300048905 Ga0496102_0015677 Ga0496102_0015677_1521_2285 240
471 3300048907 Ga0496104_0002342 Ga0496104_0002342_12283_13047 240
472 3300048908 Ga0496105_0001990 Ga0496105_0001990_2019_2783 240
473 3300048908 Ga0496105_0245855 Ga0496105_0245855_661_1437 240
474 3300048909 Ga0496106_0113007 Ga0496106_0113007_1305_2069 240
475 3300048911 Ga0496108_0047240 Ga0496108_0047240_310_1074 240
476 3300048912 Ga0496109_0201937 Ga0496109_0201937_652_1452 240
477 3300048913 Ga0496110_0060420 Ga0496110_0060420_1899_2663 240
478 3300048914 Ga0496111_0011112 Ga0496111_0011112_2790_3554 240
479 3300048915 Ga0496112_0010013 Ga0496112_0010013_6825_7601 240
480 3300048915 Ga0496112_0029310 Ga0496112_0029310_2084_2860 240
481 3300048915 Ga0496112_0046986 Ga0496112_0046986_2617_3417 240
482 3300048916 Ga0496113_0430015 Ga0496113_0430015_282_1046 240
483 3300048921 Ga0496118_0009087 Ga0496118_0009087_67_840 240
484 3300048921 Ga0496118_0066272 Ga0496118_0066272_1159_1929 240
485 3300048925 Ga0496122_0012430 Ga0496122_0012430_4297_5067 240
486 3300048926 Ga0496123_0004944 Ga0496123_0004944_7670_8440 240
487 3300048929 Ga0496126_0271546 Ga0496126_0271546_219_989 240
488 3300049568 Ga0501031_0000156 Ga0501031_0000156_16095_16862 240
489 3300049568 Ga0501031_0076495 Ga0501031_0076495_959_1729 240
490 3300049569 Ga0501032_0001239 Ga0501032_0001239_13543_14310 240
491 3300049570 Ga0501033_0002504 Ga0501033_0002504_1926_2693 240
492 3300049570 Ga0501033_0032947 Ga0501033_0032947_1312_2079 240
493 3300049570 Ga0501033_0254670 Ga0501033_0254670_436_1218 240
494 3300049571 Ga0501034_0040056 Ga0501034_0040056_2772_3539 240
495 3300049572 Ga0501036_0001565 Ga0501036_0001565_14679_15446 240
496 3300049573 Ga0501037_0022824 Ga0501037_0022824_3339_4106 240
497 3300049574 Ga0501038_0005500 Ga0501038_0005500_3450_4217 240
498 3300049579 Ga0501043_0006544 Ga0501043_0006544_6571_7338 240
499 3300049579 Ga0501043_0016151 Ga0501043_0016151_4010_4777 240
500 3300049580 Ga0501046_0000631 Ga0501046_0000631_19752_20519 240
501 3300049580 Ga0501046_0031424 Ga0501046_0031424_3470_4252 240
502 3300049581 Ga0501047_0011740 Ga0501047_0011740_4454_5221 240
503 3300049581 Ga0501047_0077892 Ga0501047_0077892_1113_1895 240
504 3300049581 Ga0501047_0309448 Ga0501047_0309448_133_900 240
505 3300049582 Ga0501048_0006530 Ga0501048_0006530_1798_2565 240
506 3300049583 Ga0501067_0018587 Ga0501067_0018587_2414_3181 240
507 3300049585 Ga0501069_0011639 Ga0501069_0011639_2031_2798 240
508 3300049586 Ga0501070_0009017 Ga0501070_0009017_6792_7559 240
509 3300049587 Ga0501071_0056139 Ga0501071_0056139_409_1176 240
510 3300049589 Ga0501073_0000422 Ga0501073_0000422_27653_28420 240
511 3300049590 Ga0501074_0007013 Ga0501074_0007013_952_1719 240
512 3300049591 Ga0501075_0216575 Ga0501075_0216575_650_1417 240
513 3300049741 Ga0501079_0018062 Ga0501079_0018062_1148_1915 240
514 3300049742 Ga0501080_0025172 Ga0501080_0025172_1486_2253 240
515 3300049743 Ga0501081_0016586 Ga0501081_0016586_558_1325 240
516 3300049744 Ga0501083_0009150 Ga0501083_0009150_5613_6380 240
517 3300049822 Ga0501035_0026677 Ga0501035_0026677_1376_2143 240
518 3300049822 Ga0501035_0039279 Ga0501035_0039279_1316_2083 240
519 3300049822 Ga0501035_0050547 Ga0501035_0050547_692_1459 240
520 3300049823 Ga0501044_0005418 Ga0501044_0005418_8873_9640 240
521 3300049823 Ga0501044_0018317 Ga0501044_0018317_4729_5496 240
522 3300049823 Ga0501044_0322634 Ga0501044_0322634_37_819 240
523 3300049823 Ga0501044_0455351 Ga0501044_0455351_26_793 240
524 3300050491 nmdc:mga00v17_63631_c1 nmdc:mga00v17_63631_c1_1216_1980 240
525 3300050491 nmdc:mga00v17_6748_c1 nmdc:mga00v17_6748_c1_4010_4780 240
526 3300050507 nmdc:mga05p37_545699_c1 nmdc:mga05p37_545699_c1_485_1249 240
527 3300050510 nmdc:mga06r32_86259_c1 nmdc:mga06r32_86259_c1_1526_2290 240
528 3300050512 nmdc:mga0n895_75665_c1 nmdc:mga0n895_75665_c1_310_1074 240
529 3300050513 nmdc:mga0rr50_15964_c1 nmdc:mga0rr50_15964_c1_2096_2860 240
530 3300050514 nmdc:mga08x19_6305_c1 nmdc:mga08x19_6305_c1_151_915 240
531 3300053083 Ga0495655_0004111 Ga0495655_0004111_1238_2014 240
532 3300053107 Ga0500560_002972 Ga0500560_002972_995_1756 240
533 3300053161 Ga0500634_0000098 Ga0500634_0000098_5161_5931 240
534 3300054114 Ga0501084_0002400 Ga0501084_0002400_398_1165 240
535 3300054114 Ga0501084_0373777 Ga0501084_0373777_318_1085 240
536 iso_pu_bacteria 2547132130 2547502964 240
537 3300027907 Ga0207428_10034428 Ga0207428_100344282 241
538 3300037312 Ga0395899_0006752 Ga0395899_0006752_5451_6227 241
539 3300037418 Ga0395900_0032108 Ga0395900_0032108_2560_3336 241
540 3300038443 Ga0395901_0017119 Ga0395901_0017119_844_1620 241
541 3300048090 Ga0495615_0015710 Ga0495615_0015710_65_910 241
542 3300048905 Ga0496102_0023629 Ga0496102_0023629_2304_3158 241
543 iso_pu_bacteria 2904776348 2904778807 241
544 iso_pu_bacteria 2919034639 2919038101 241
545 3300005548 Ga0070665_100495072 Ga0070665_1004950721 242
546 3300025893 Ga0207682_10002817 Ga0207682_100028172 242
547 3300031824 Ga0307413_10062999 Ga0307413_100629992 242
548 3300048903 Ga0496100_0107150 Ga0496100_0107150_20_841 242
549 3300048904 Ga0496101_0235305 Ga0496101_0235305_74_895 242
550 3300048911 Ga0496108_0101964 Ga0496108_0101964_398_1219 242
551 3300048913 Ga0496110_0070083 Ga0496110_0070083_1414_2235 242
552 3300048915 Ga0496112_0534731 Ga0496112_0534731_160_981 242
553 3300048916 Ga0496113_0302582 Ga0496113_0302582_306_1127 242
554 3300048917 Ga0496114_0305237 Ga0496114_0305237_154_975 242
555 iso_pu_bacteria 2690315906 2691512610 242
556 iso_pu_bacteria 2775506735 2775657625 242
557 iso_pu_bacteria 2808606357 2808829856 242
558 iso_pu_bacteria 2808606360 2808851036 242
559 iso_pu_bacteria 2808606366 2808876448 242
560 iso_pu_bacteria 2808606371 2808897964 242
561 iso_pu_bacteria 2811994871 2812318443 242
562 iso_pu_bacteria 2945916053 2945916197 242
563 iso_pu_bacteria 2946059875 2946060001 242
564 3300011119 Ga0105246_10219096 Ga0105246_102190962 243
565 3300031731 Ga0307405_10553239 Ga0307405_105532391 243
566 3300031911 Ga0307412_10256117 Ga0307412_102561172 243
567 3300037312 Ga0395899_0015045 Ga0395899_0015045_373_1170 243
568 3300037466 Ga0395898_0011125 Ga0395898_0011125_7195_7992 243
569 3300038443 Ga0395901_0042420 Ga0395901_0042420_2536_3333 243
570 3300038443 Ga0395901_0313253 Ga0395901_0313253_399_1196 243
571 3300038443 Ga0395901_0710324 Ga0395901_0710324_102_899 243
572 3300044656 Ga0466969_0126953 Ga0466969_0126953_192_989 243
573 3300044658 Ga0466972_0081652 Ga0466972_0081652_64_861 243
574 3300044693 Ga0466961_0030561 Ga0466961_0030561_413_1210 243
575 3300046535 Ga0495586_0031754 Ga0495586_0031754_102_935 243
576 iso_pu_bacteria 2844849076 2844851535 243
577 iso_pu_bacteria 2910809715 2910811944 243
578 iso_pu_bacteria 2919538618 2919539525 243
579 iso_pu_bacteria 2932426870 2932430231 243
580 iso_pu_bacteria 2939674588 2939676658 243
581 iso_pu_bacteria 2953998280 2954001841 243
582 3300006058 Ga0075432_10019085 Ga0075432_100190852 244
583 3300046455 Ga0495603_0161730 Ga0495603_0161730_450_1253 244
584 3300002773 JGI25152J39213_1000486 JGI25152J39213_100048623 245
585 3300003187 JGI25151J46595_10002903 JGI25151J46595_100029035 245
586 3300003792 Ga0055540_1034926 Ga0055540_10349261 245
587 3300005333 Ga0070677_10086973 Ga0070677_100869732 245
588 3300006058 Ga0075432_10002528 Ga0075432_100025283 245
589 3300009036 Ga0105244_10026337 Ga0105244_100263372 245
590 3300009036 Ga0105244_10060818 Ga0105244_100608182 245
591 3300009148 Ga0105243_10005982 Ga0105243_100059824 245
592 3300011119 Ga0105246_10066996 Ga0105246_100669962 245
593 3300025256 Ga0209759_1011595 Ga0209759_10115952 245
594 3300025258 Ga0209129_1000159 Ga0209129_100015931 245
595 3300025294 Ga0209025_1000211 Ga0209025_100021179 245
596 3300025303 Ga0209051_1019000 Ga0209051_10190003 245
597 3300025303 Ga0209051_1021914 Ga0209051_10219142 245
598 3300025728 Ga0207655_1019888 Ga0207655_10198882 245
599 3300042002 Ga0439442_002302 Ga0439442_002302_1099_1890 245
600 3300046472 Ga0495580_0042268 Ga0495580_0042268_780_1571 245
601 3300048906 Ga0496103_0150771 Ga0496103_0150771_648_1439 245
602 3300049569 Ga0501032_0017471 Ga0501032_0017471_2341_3132 245
603 3300049571 Ga0501034_0000057 Ga0501034_0000057_63666_64457 245
604 3300049574 Ga0501038_0380809 Ga0501038_0380809_142_933 245
605 3300049579 Ga0501043_0014674 Ga0501043_0014674_5216_6007 245
606 iso_pu_bacteria 2974302888 2974304142 245
607 3300003762 Ga0055542_1006884 Ga0055542_10068842 246
608 3300025254 Ga0209148_1001608 Ga0209148_10016082 246
609 3300031548 Ga0307408_100035311 Ga0307408_1000353113 246
610 3300031731 Ga0307405_10004419 Ga0307405_100044192 246
611 3300031731 Ga0307405_10016643 Ga0307405_100166432 246
612 3300031824 Ga0307413_10018695 Ga0307413_100186952 246
613 3300031852 Ga0307410_10040876 Ga0307410_100408763 246
614 3300031852 Ga0307410_10277074 Ga0307410_102770742 246
615 3300031903 Ga0307407_10234411 Ga0307407_102344112 246
616 3300031911 Ga0307412_10016980 Ga0307412_100169804 246
617 3300031911 Ga0307412_10021789 Ga0307412_100217892 246
618 3300031995 Ga0307409_100153597 Ga0307409_1001535972 246
619 3300032002 Ga0307416_100101615 Ga0307416_1001016152 246
620 3300032002 Ga0307416_100741068 Ga0307416_1007410682 246
621 3300032126 Ga0307415_100011710 Ga0307415_1000117102 246
622 3300037418 Ga0395900_0205546 Ga0395900_0205546_722_1555 246
623 3300038443 Ga0395901_0019338 Ga0395901_0019338_3176_4009 246
624 3300042010 Ga0439452_031797 Ga0439452_031797_61_855 246
625 3300046459 Ga0495629_0032461 Ga0495629_0032461_2522_3313 246
626 3300046463 Ga0495653_0001814 Ga0495653_0001814_8181_8972 246
627 3300046477 Ga0495664_0000613 Ga0495664_0000613_16272_17063 246
628 3300046499 Ga0495594_0036701 Ga0495594_0036701_1145_1936 246
629 3300046517 Ga0495630_0025529 Ga0495630_0025529_1722_2513 246
630 3300046535 Ga0495586_0001078 Ga0495586_0001078_13036_13827 246
631 3300046535 Ga0495586_0057051 Ga0495586_0057051_347_1141 246
632 3300046536 Ga0495587_0002655 Ga0495587_0002655_1070_1861 246
633 3300046543 Ga0495645_0003098 Ga0495645_0003098_4914_5705 246
634 3300046679 Ga0495623_0007879 Ga0495623_0007879_5749_6540 246
635 3300046809 Ga0495600_0058243 Ga0495600_0058243_156_947 246
636 3300047315 Ga0495581_0019994 Ga0495581_0019994_876_1667 246
637 3300047317 Ga0495604_0261973 Ga0495604_0261973_56_847 246
638 3300047322 Ga0495680_0015661 Ga0495680_0015661_1608_2399 246
639 3300047444 Ga0495675_0004789 Ga0495675_0004789_6794_7585 246
640 3300048915 Ga0496112_0638958 Ga0496112_0638958_119_913 246
641 3300048916 Ga0496113_0120094 Ga0496113_0120094_741_1535 246
642 3300049569 Ga0501032_0030653 Ga0501032_0030653_2752_3546 246
643 3300049573 Ga0501037_0071373 Ga0501037_0071373_502_1296 246
644 3300049574 Ga0501038_0016885 Ga0501038_0016885_2731_3525 246
645 3300049579 Ga0501043_0105858 Ga0501043_0105858_991_1785 246
646 3300031824 Ga0307413_10122379 Ga0307413_101223792 247
647 3300031852 Ga0307410_10066085 Ga0307410_100660851 247
648 3300031852 Ga0307410_10190552 Ga0307410_101905522 247
649 3300031901 Ga0307406_10127338 Ga0307406_101273382 247
650 3300032002 Ga0307416_100121954 Ga0307416_1001219542 247
651 3300032005 Ga0307411_10733297 Ga0307411_107332971 247
652 3300041404 Ga0439436_0063248 Ga0439436_0063248_121_918 247
653 3300042007 Ga0439449_0026802 Ga0439449_0026802_943_1740 247
654 3300046558 Ga0495633_0183498 Ga0495633_0183498_30_827 247
655 3300046691 Ga0495670_0046189 Ga0495670_0046189_427_1224 247
656 3300047445 Ga0495677_0032038 Ga0495677_0032038_60_857 247
657 iso_pu_bacteria 2945920336 2945923677 247
658 iso_pu_bacteria 2946037020 2946040596 247
659 3300041404 Ga0439436_0023178 Ga0439436_0023178_238_1035 248
660 3300041405 Ga0439438_054448 Ga0439438_054448_14_811 248
661 3300041411 Ga0439466_0042261 Ga0439466_0042261_588_1385 248
662 3300046674 Ga0495588_0054122 Ga0495588_0054122_680_1483 248
663 3300031903 Ga0307407_10241029 Ga0307407_102410292 249
664 3300032004 Ga0307414_10002021 Ga0307414_100020216 249
665 3300041404 Ga0439436_0004892 Ga0439436_0004892_2437_3282 249
666 3300041405 Ga0439438_030485 Ga0439438_030485_522_1367 249
667 3300041406 Ga0439439_0004700 Ga0439439_0004700_1325_2170 249
668 3300041411 Ga0439466_0017726 Ga0439466_0017726_490_1335 249
669 3300041999 Ga0439433_0025077 Ga0439433_0025077_167_1012 249
670 3300042002 Ga0439442_003358 Ga0439442_003358_1220_2065 249
671 3300042007 Ga0439449_0003611 Ga0439449_0003611_1704_2549 249
672 3300042014 Ga0439457_006936 Ga0439457_006936_507_1352 249
673 3300047315 Ga0495581_0041548 Ga0495581_0041548_618_1454 249
674 iso_pu_bacteria 2904497146 2904497793 249
675 3300009036 Ga0105244_10087593 Ga0105244_100875931 250
676 3300025315 Ga0207697_10003551 Ga0207697_100035512 250
677 3300025728 Ga0207655_1028626 Ga0207655_10286262 250
678 3300031548 Ga0307408_100012672 Ga0307408_1000126724 250
679 3300031824 Ga0307413_10018758 Ga0307413_100187583 250
680 3300031852 Ga0307410_10054246 Ga0307410_100542463 250
681 3300031911 Ga0307412_10092028 Ga0307412_100920282 250
682 3300031995 Ga0307409_100202413 Ga0307409_1002024132 250
683 3300032002 Ga0307416_100033203 Ga0307416_1000332032 250
684 3300032004 Ga0307414_10090822 Ga0307414_100908222 250
685 3300041404 Ga0439436_0007439 Ga0439436_0007439_1580_2386 250
686 3300042002 Ga0439442_000066 Ga0439442_000066_9433_10239 250
687 3300042007 Ga0439449_0029576 Ga0439449_0029576_727_1533 250
688 3300042122 Ga0450920_000130 Ga0450920_000130_4022_4828 250
689 3300042122 Ga0450920_007667 Ga0450920_007667_950_1756 250
690 3300042146 Ga0450907_000127 Ga0450907_000127_4161_4967 250
691 3300042435 Ga0439434_0000033 Ga0439434_0000033_24402_25208 250
692 3300042531 Ga0450918_003438 Ga0450918_003438_537_1343 250
693 3300046472 Ga0495580_0023426 Ga0495580_0023426_2203_3036 250
694 3300046475 Ga0495639_0031364 Ga0495639_0031364_1185_2018 250
695 3300046535 Ga0495586_0003416 Ga0495586_0003416_7209_8042 250
696 3300046674 Ga0495588_0001848 Ga0495588_0001848_716_1549 250
697 3300046809 Ga0495600_0059355 Ga0495600_0059355_358_1191 250
698 3300047315 Ga0495581_0000128 Ga0495581_0000128_21775_22608 250
699 3300047673 Ga0495593_0052049 Ga0495593_0052049_858_1691 250
700 iso_pu_bacteria 2919059106 2919063214 250
701 iso_pu_bacteria 2919391150 2919391766 250
702 iso_pu_bacteria 2939647034 2939647242 250
703 iso_pu_bacteria 2945956166 2945957146 250
704 3300009148 Ga0105243_10354667 Ga0105243_103546671 251
705 3300031548 Ga0307408_100030404 Ga0307408_1000304042 251
706 3300031548 Ga0307408_100284833 Ga0307408_1002848332 251
707 3300031731 Ga0307405_10391200 Ga0307405_103912002 251
708 3300031824 Ga0307413_10009030 Ga0307413_100090302 251
709 3300031824 Ga0307413_10335668 Ga0307413_103356681 251
710 3300031852 Ga0307410_10097706 Ga0307410_100977062 251
711 3300031852 Ga0307410_10396844 Ga0307410_103968441 251
712 3300031903 Ga0307407_10015562 Ga0307407_100155623 251
713 3300032002 Ga0307416_101057864 Ga0307416_1010578641 251
714 3300032005 Ga0307411_10006487 Ga0307411_100064872 251
715 iso_pu_bacteria 8054107350 8054108176 251
716 3300031548 Ga0307408_100048800 Ga0307408_1000488001 252
717 3300031548 Ga0307408_100585246 Ga0307408_1005852462 252
718 3300031731 Ga0307405_10248530 Ga0307405_102485302 252
719 3300037312 Ga0395899_0006965 Ga0395899_0006965_3011_3829 252
720 3300037418 Ga0395900_0183870 Ga0395900_0183870_485_1303 252
721 3300037466 Ga0395898_0047998 Ga0395898_0047998_2355_3173 252
722 3300037471 Ga0395905_0297483 Ga0395905_0297483_548_1366 252
723 3300038443 Ga0395901_0010870 Ga0395901_0010870_3127_3945 252
724 3300031548 Ga0307408_100035266 Ga0307408_1000352663 253
725 3300031824 Ga0307413_10195471 Ga0307413_101954712 253
726 3300031911 Ga0307412_10009159 Ga0307412_100091595 253
727 iso_pu_bacteria 2939598168 2939600716 255
728 3300013100 Ga0157373_10033055 Ga0157373_100330552 256
729 3300031901 Ga0307406_10090639 Ga0307406_100906392 256
730 iso_pu_bacteria 2808606370 2808894123 256
731 iso_pu_bacteria 2964326757 2964328746 258
732 3300000549 LJQas_1001056 LJQas_10010563 259
733 3300000549 LJQas_1000689 LJQas_10006895 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

2

56

0.93

PF00106

adh_short

short chain dehydrogenase

70

242

0.93

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

69

285

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xgn-assembly2.cif.gz_E crystal structure of 3-hydroxyacyl-coa dehydrogenase in complex with nad from burkholderia thailandensis 0.9151 1 265
4o5o-assembly1.cif.gz_B-2 x-ray crystal structure of a 3-hydroxyacyl-coa dehydrogenase from brucella suis 0.9143 1 265
6ujk-assembly1.cif.gz_B crystal structure of a probable short-chain type dehydrogenase/reductase (rv1144) from mycobacterium tuberculosis with bound nad 0.9142 4 265
7tzp-assembly3.cif.gz_G crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 in complex with nadh 0.9122 1 261
4pn3-assembly1.cif.gz_A crystal structure of 3-hydroxyacyl-coa-dehydrogenase from brucella melitensis 0.9113 1 265
ID Description Score Start End Superfamily
af_P9WGR9_1_247_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9084 2 260 3.40.50.720
af_Q99714_1_261_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9054 1 264 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9027 104 260 3.40.50.720
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8991 6 261 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8978 3 106 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2S8LQR0-F1-model_v4 deleted 0.9869 174 261
AF-A0A0F9B0H9-F1-model_v4 Uncharacterized protein 0.9837 171 262 GO:0016491
AF-A0A2P9AMG2-F1-model_v4 Putative oxidoreductase, short-chain dehydrogenase/reductase family 0.9764 181 265 GO:0016491
AF-A0A3D5NBV7-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9743 181 265 GO:0016491
AF-A0A537RAG7-F1-model_v4 SDR family oxidoreductase 0.9707 173 265 GO:0016491

Feature Viewer

pLDDT pTM Quality
90.94 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map