F478109
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 733 | 431 | 656 | 255 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2808606370|2808894123 |
| Length | 290 |
| Sequence | GSVALITGGASGLGAATARRLFDAGASVVLVDLPSSAGEAFAEELSGGKASGGKASGGNANGGNANGGNANGGNAHPAGPPEKSAVFVPADVTSEAEVQAAVDAAAALGPLRIVVNCAGVATPGKVLGREGVLPLEAFNRVIQVNLVGTFNVLRLAAAAMVANEPASTELGGPERGVIINTASAAAFEGQIGQPAYAASKGAVAAMTLPIARELARSLVRVVTIAPGIFETPMMAGLPQEAQDSLGAQVPHPSRLGKPAEYANLVAHIVDNAMLNGETIRLDGAIRMGPK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 3 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 4 | 2643221559 | Lysobacter sp. Root559 | Isolate | Unclassified |
| 5 | 2643221573 | Lysobacter sp. Root604 | Isolate | Unclassified |
| 6 | 2643221586 | Lysobacter sp. Root667 | Isolate | Unclassified |
| 7 | 2643221612 | Lysobacter sp. Root76 | Isolate | Unclassified |
| 8 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 9 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 10 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 11 | 2643221720 | Lysobacter sp. Root916 | Isolate | Unclassified |
| 12 | 2643221727 | Lysobacter sp. Root96 | Isolate | Unclassified |
| 13 | 2643221728 | Lysobacter sp. Root983 | Isolate | Unclassified |
| 14 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 15 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 16 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 17 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 18 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 19 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 20 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 21 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 22 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 23 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 24 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 25 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 26 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 27 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 28 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 29 | 2842780639 | Pseudoxanthomonas sp. R-71986 | Isolate | Unclassified |
| 30 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 31 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 32 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 33 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 34 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 35 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 36 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 37 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 38 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 39 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 40 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 41 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 42 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 43 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 44 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 45 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 46 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 47 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 48 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 49 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 50 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 51 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 52 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 53 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 54 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 55 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 56 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 57 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 58 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 59 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 60 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 61 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 62 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 63 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 64 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 65 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 66 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 67 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 68 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 69 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 70 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 71 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 72 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 73 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 74 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 75 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 76 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 77 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 78 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 79 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 80 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 81 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 83 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 85 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 86 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 87 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 88 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 89 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 90 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 91 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 92 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 93 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 94 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 95 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 96 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 97 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 98 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 99 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 100 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 101 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 107 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 111 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 113 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 114 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 116 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 123 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 124 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 125 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 127 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 128 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 129 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 133 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 134 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 135 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 136 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 137 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 138 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 139 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 140 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 141 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 142 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 143 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 144 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 145 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 146 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 147 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 148 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 149 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 150 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 151 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 152 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 153 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 154 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 156 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 164 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 165 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 166 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 168 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 172 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 173 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 176 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 177 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 178 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 179 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 185 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 186 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 187 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 188 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 189 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 190 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 191 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 200 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 201 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 203 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 204 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 205 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 206 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 208 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 211 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 261 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 263 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 264 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 265 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 266 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 267 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 268 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 269 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 270 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 271 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 272 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 273 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 274 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 275 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 276 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 277 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 278 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 279 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 280 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 281 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 282 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 283 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 284 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 285 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 286 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 287 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 288 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 289 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 290 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 291 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 292 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 293 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 294 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 295 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 296 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 297 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 298 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 299 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 300 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 301 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 302 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 303 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 304 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 305 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 306 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 307 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 308 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 309 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 310 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 311 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 312 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 313 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 314 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 315 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 316 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 317 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 318 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 319 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 320 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 321 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 322 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 323 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 324 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 325 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 326 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 327 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 328 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 329 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 330 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 331 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 332 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 333 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 371 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 372 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 373 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 374 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 375 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 376 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 377 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 378 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 379 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 380 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 381 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 382 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 383 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 384 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 385 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 386 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 387 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 388 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 389 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 390 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 391 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 392 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 397 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 398 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 401 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 418 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 419 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 420 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 421 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 422 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 423 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 424 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 425 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 426 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 427 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 428 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 429 | 8021622325 | Xanthomonas sp. LMG12462 | Isolate | Rhizosphere |
| 430 | 8021648035 | Xanthomonas sp. LMG 12461 | Isolate | Rhizosphere |
| 431 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.54 |
| Metatranscriptomes | 0.95 |
| Isolates | 10.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.37 |
| Nodule | 0.14 |
| Rhizoplane | 7.91 |
| Rhizosphere | 75.58 |
| Stem | 0 |
| Stem Tuber | 0.14 |
| Unclassified | 8.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000689 | 3300000549 | Bacteria | 5386 |
| 2 | LJQas_1001056 | 3300000549 | Bacteria | 4194 |
| 3 | JGI24735J21928_10078630 | 3300002067 | Bacteria | 944 |
| 4 | JGI25162J39368_1010474 | 3300002737 | Bacteria | 1170 |
| 5 | JGI25164J39214_1000399 | 3300002772 | Bacteria | 25187 |
| 6 | JGI25152J39213_1000486 | 3300002773 | Bacteria | 22545 |
| 7 | JGI25151J46595_10000059 | 3300003187 | Bacteria | 147998 |
| 8 | JGI25151J46595_10002903 | 3300003187 | Bacteria | 9817 |
| 9 | JGI25406J46586_10019261 | 3300003203 | Bacteria | 2786 |
| 10 | JGI25406J46586_10033712 | 3300003203 | Bacteria | 1888 |
| 11 | JGI25165J46597_1000148 | 3300003214 | Bacteria | 116003 |
| 12 | JGI25404J52841_10003860 | 3300003659 | Bacteria | 3000 |
| 13 | Ga0055539_1000103 | 3300003752 | Bacteria | 96081 |
| 14 | Ga0055533_1000020 | 3300003756 | Bacteria | 353998 |
| 15 | Ga0055525_1000312 | 3300003759 | Bacteria | 39548 |
| 16 | Ga0055542_1006884 | 3300003762 | Bacteria | 2376 |
| 17 | Ga0055526_1000617 | 3300003771 | Bacteria | 27614 |
| 18 | Ga0055537_1000450 | 3300003773 | Bacteria | 26107 |
| 19 | Ga0055524_1000568 | 3300003775 | Bacteria | 27614 |
| 20 | Ga0055536_1003611 | 3300003781 | Bacteria | 8260 |
| 21 | Ga0055534_1000385 | 3300003784 | Bacteria | 27614 |
| 22 | Ga0055528_1000580 | 3300003790 | Bacteria | 27614 |
| 23 | Ga0055540_1034926 | 3300003792 | Bacteria | 1127 |
| 24 | Ga0055531_10022879 | 3300003794 | Bacteria | 2364 |
| 25 | Ga0055541_1005026 | 3300003841 | Bacteria | 2349 |
| 26 | Ga0058692_1000031 | 3300003856 | Bacteria | 188488 |
| 27 | Ga0058692_1000060 | 3300003856 | Bacteria | 98866 |
| 28 | Ga0065714_10016134 | 3300005288 | Bacteria | 1627 |
| 29 | Ga0065704_10070531 | 3300005289 | Bacteria | 21590 |
| 30 | Ga0065715_10001250 | 3300005293 | Bacteria | 8508 |
| 31 | Ga0070658_10291421 | 3300005327 | Bacteria | 1391 |
| 32 | Ga0070676_10034053 | 3300005328 | Bacteria | 2923 |
| 33 | Ga0070676_10137939 | 3300005328 | Bacteria | 1549 |
| 34 | Ga0070683_100183528 | 3300005329 | Bacteria | 1986 |
| 35 | Ga0070670_100029702 | 3300005331 | Bacteria | 4707 |
| 36 | Ga0070670_100064788 | 3300005331 | Bacteria | 3135 |
| 37 | Ga0070670_100197699 | 3300005331 | Bacteria | 1747 |
| 38 | Ga0070677_10086973 | 3300005333 | Bacteria | 1351 |
| 39 | Ga0068869_100013607 | 3300005334 | Bacteria | 5416 |
| 40 | Ga0070666_10059807 | 3300005335 | Bacteria | 2577 |
| 41 | Ga0070680_100134724 | 3300005336 | Bacteria | 2068 |
| 42 | Ga0070680_100341851 | 3300005336 | Bacteria | 1272 |
| 43 | Ga0070682_100001726 | 3300005337 | Bacteria | 12151 |
| 44 | Ga0070682_100196204 | 3300005337 | Bacteria | 1421 |
| 45 | Ga0068868_100031924 | 3300005338 | Bacteria | 4048 |
| 46 | Ga0068868_100423604 | 3300005338 | Bacteria | 1153 |
| 47 | Ga0070660_100133048 | 3300005339 | Bacteria | 1991 |
| 48 | Ga0070689_100337940 | 3300005340 | Bacteria | 1261 |
| 49 | Ga0070687_100011905 | 3300005343 | Bacteria | 3824 |
| 50 | Ga0070661_100667782 | 3300005344 | Bacteria | 845 |
| 51 | Ga0070669_100014843 | 3300005353 | Bacteria | 5548 |
| 52 | Ga0070669_100031578 | 3300005353 | Bacteria | 3826 |
| 53 | Ga0070669_100336529 | 3300005353 | Bacteria | 1222 |
| 54 | Ga0070675_100031498 | 3300005354 | Bacteria | 4287 |
| 55 | Ga0070675_100031963 | 3300005354 | Bacteria | 4256 |
| 56 | Ga0070675_100283792 | 3300005354 | Bacteria | 1456 |
| 57 | Ga0070671_100006111 | 3300005355 | Bacteria | 9589 |
| 58 | Ga0070671_100039581 | 3300005355 | Bacteria | 3913 |
| 59 | Ga0070671_100081121 | 3300005355 | Bacteria | 2712 |
| 60 | Ga0070671_100132600 | 3300005355 | Bacteria | 2099 |
| 61 | Ga0070674_100069872 | 3300005356 | Bacteria | 2479 |
| 62 | Ga0070673_100019569 | 3300005364 | Bacteria | 4862 |
| 63 | Ga0070673_100194811 | 3300005364 | Bacteria | 1742 |
| 64 | Ga0070659_100099320 | 3300005366 | Bacteria | 2341 |
| 65 | Ga0070667_100731224 | 3300005367 | Bacteria | 917 |
| 66 | Ga0070709_10069210 | 3300005434 | Bacteria | 2272 |
| 67 | Ga0070713_100001424 | 3300005436 | Bacteria | 15340 |
| 68 | Ga0070701_10007294 | 3300005438 | Bacteria | 4710 |
| 69 | Ga0070678_100033250 | 3300005456 | Bacteria | 3578 |
| 70 | Ga0070678_100034742 | 3300005456 | Bacteria | 3513 |
| 71 | Ga0070681_10121318 | 3300005458 | Bacteria | 2549 |
| 72 | Ga0070681_10138837 | 3300005458 | Bacteria | 2360 |
| 73 | Ga0070681_10168667 | 3300005458 | Bacteria | 2111 |
| 74 | Ga0070679_100089383 | 3300005530 | Bacteria | 3067 |
| 75 | Ga0070679_100476289 | 3300005530 | Bacteria | 1193 |
| 76 | Ga0070679_100713618 | 3300005530 | Bacteria | 945 |
| 77 | Ga0070684_100602151 | 3300005535 | Bacteria | 1022 |
| 78 | Ga0070672_100159620 | 3300005543 | Bacteria | 1870 |
| 79 | Ga0070672_100536790 | 3300005543 | Bacteria | 1014 |
| 80 | Ga0070693_100004599 | 3300005547 | Bacteria | 6548 |
| 81 | Ga0070665_100406961 | 3300005548 | Bacteria | 1369 |
| 82 | Ga0070665_100495072 | 3300005548 | Bacteria | 1233 |
| 83 | Ga0068855_100138824 | 3300005563 | Bacteria | 2772 |
| 84 | Ga0068855_100376828 | 3300005563 | Bacteria | 1559 |
| 85 | Ga0070664_100152562 | 3300005564 | Bacteria | 2040 |
| 86 | Ga0068854_100025286 | 3300005578 | Bacteria | 4073 |
| 87 | Ga0070702_100000212 | 3300005615 | Bacteria | 19347 |
| 88 | Ga0068852_100134527 | 3300005616 | Bacteria | 2281 |
| 89 | Ga0068852_100282821 | 3300005616 | Bacteria | 1600 |
| 90 | Ga0068859_100140908 | 3300005617 | Bacteria | 2485 |
| 91 | Ga0068864_100088914 | 3300005618 | Bacteria | 2721 |
| 92 | Ga0068851_10017690 | 3300005834 | Bacteria | 3427 |
| 93 | Ga0068870_10000198 | 3300005840 | Bacteria | 21465 |
| 94 | Ga0068863_100035364 | 3300005841 | Bacteria | 4758 |
| 95 | Ga0068863_100109289 | 3300005841 | Bacteria | 2632 |
| 96 | Ga0068863_100252755 | 3300005841 | Bacteria | 1703 |
| 97 | Ga0068858_100041877 | 3300005842 | Bacteria | 4245 |
| 98 | Ga0081540_1010321 | 3300005983 | Bacteria | 6335 |
| 99 | Ga0081540_1021999 | 3300005983 | Bacteria | 3775 |
| 100 | Ga0081540_1027543 | 3300005983 | Bacteria | 3216 |
| 101 | Ga0081539_10001488 | 3300005985 | Bacteria | 39658 |
| 102 | Ga0081539_10003292 | 3300005985 | Bacteria | 20222 |
| 103 | Ga0075364_10000075 | 3300006051 | Bacteria | 38780 |
| 104 | Ga0075364_10014729 | 3300006051 | Bacteria | 4836 |
| 105 | Ga0075432_10002528 | 3300006058 | Bacteria | 6093 |
| 106 | Ga0075432_10019085 | 3300006058 | Bacteria | 2340 |
| 107 | Ga0070712_100052353 | 3300006175 | Bacteria | 2847 |
| 108 | Ga0075369_10056644 | 3300006186 | Bacteria | 1704 |
| 109 | Ga0068871_100002932 | 3300006358 | Bacteria | 11705 |
| 110 | Ga0075428_100141407 | 3300006844 | Bacteria | 2617 |
| 111 | Ga0075430_100170040 | 3300006846 | Bacteria | 1813 |
| 112 | Ga0075434_100020271 | 3300006871 | Bacteria | 6446 |
| 113 | Ga0075436_100005883 | 3300006914 | Bacteria | 8424 |
| 114 | Ga0097620_100140916 | 3300006931 | Bacteria | 2485 |
| 115 | Ga0075435_100002423 | 3300007076 | Bacteria | 12369 |
| 116 | Ga0105251_10005393 | 3300009011 | Bacteria | 8373 |
| 117 | Ga0105251_10069511 | 3300009011 | Bacteria | 1641 |
| 118 | Ga0105244_10026337 | 3300009036 | Bacteria | 3148 |
| 119 | Ga0105244_10060818 | 3300009036 | Bacteria | 1902 |
| 120 | Ga0105244_10087593 | 3300009036 | Bacteria | 1534 |
| 121 | Ga0105240_10152849 | 3300009093 | Bacteria | 2747 |
| 122 | Ga0105240_10208895 | 3300009093 | Bacteria | 2283 |
| 123 | Ga0111539_10007824 | 3300009094 | Bacteria | 13647 |
| 124 | Ga0105245_10068211 | 3300009098 | Bacteria | 3222 |
| 125 | Ga0105245_10181652 | 3300009098 | Bacteria | 2010 |
| 126 | Ga0105245_10467159 | 3300009098 | Bacteria | 1273 |
| 127 | Ga0105247_10062869 | 3300009101 | Bacteria | 2304 |
| 128 | Ga0105247_10293305 | 3300009101 | Bacteria | 1126 |
| 129 | Ga0114129_10169938 | 3300009147 | Bacteria | 2973 |
| 130 | Ga0105243_10005982 | 3300009148 | Bacteria | 9423 |
| 131 | Ga0105243_10012792 | 3300009148 | Bacteria | 6338 |
| 132 | Ga0105243_10354667 | 3300009148 | Bacteria | 1348 |
| 133 | Ga0105243_10385471 | 3300009148 | Bacteria | 1298 |
| 134 | Ga0105243_10569870 | 3300009148 | Bacteria | 1085 |
| 135 | Ga0105243_10671502 | 3300009148 | Bacteria | 1007 |
| 136 | Ga0105241_10093692 | 3300009174 | Bacteria | 2374 |
| 137 | Ga0105248_10060903 | 3300009177 | Bacteria | 4237 |
| 138 | Ga0105248_10202027 | 3300009177 | Bacteria | 2239 |
| 139 | Ga0105237_10080772 | 3300009545 | Bacteria | 3242 |
| 140 | Ga0105238_10007400 | 3300009551 | Bacteria | 11000 |
| 141 | Ga0105249_10522775 | 3300009553 | Bacteria | 1234 |
| 142 | Ga0105239_10104594 | 3300010375 | Bacteria | 3135 |
| 143 | Ga0105246_10037618 | 3300011119 | Bacteria | 3248 |
| 144 | Ga0105246_10066996 | 3300011119 | Bacteria | 2515 |
| 145 | Ga0105246_10201187 | 3300011119 | Bacteria | 1548 |
| 146 | Ga0105246_10219096 | 3300011119 | Bacteria | 1491 |
| 147 | Ga0105246_10228581 | 3300011119 | Bacteria | 1463 |
| 148 | Ga0157327_1004598 | 3300012512 | Bacteria | 1077 |
| 149 | Ga0157373_10033055 | 3300013100 | Bacteria | 3723 |
| 150 | Ga0157373_10091699 | 3300013100 | Bacteria | 2140 |
| 151 | Ga0157373_10127794 | 3300013100 | Bacteria | 1787 |
| 152 | Ga0157371_10006531 | 3300013102 | Bacteria | 9596 |
| 153 | Ga0157371_10079159 | 3300013102 | Bacteria | 2328 |
| 154 | Ga0157371_10117872 | 3300013102 | Bacteria | 1887 |
| 155 | Ga0157371_10410365 | 3300013102 | Bacteria | 992 |
| 156 | Ga0157370_10112173 | 3300013104 | Bacteria | 2549 |
| 157 | Ga0157370_10249793 | 3300013104 | Bacteria | 1641 |
| 158 | Ga0157369_10012353 | 3300013105 | Bacteria | 9695 |
| 159 | Ga0157369_10042335 | 3300013105 | Bacteria | 4968 |
| 160 | Ga0157369_10093022 | 3300013105 | Bacteria | 3218 |
| 161 | Ga0157369_10472479 | 3300013105 | Bacteria | 1298 |
| 162 | Ga0157374_10034297 | 3300013296 | Bacteria | 4634 |
| 163 | Ga0157372_10182398 | 3300013307 | Bacteria | 2430 |
| 164 | Ga0157372_10310262 | 3300013307 | Bacteria | 1836 |
| 165 | Ga0157372_10545996 | 3300013307 | Bacteria | 1351 |
| 166 | Ga0157375_10427572 | 3300013308 | Bacteria | 1490 |
| 167 | Ga0163163_10056369 | 3300014325 | Bacteria | 3884 |
| 168 | Ga0163163_10732460 | 3300014325 | Bacteria | 1052 |
| 169 | Ga0157380_10200341 | 3300014326 | Bacteria | 1770 |
| 170 | Ga0157380_10883152 | 3300014326 | Bacteria | 919 |
| 171 | Ga0157377_10108172 | 3300014745 | Bacteria | 1667 |
| 172 | Ga0157379_10099465 | 3300014968 | Bacteria | 2611 |
| 173 | Ga0157376_10082183 | 3300014969 | Bacteria | 2768 |
| 174 | Ga0182006_1052226 | 3300015261 | Bacteria | 1571 |
| 175 | Ga0182005_1011353 | 3300015265 | Bacteria | 2541 |
| 176 | Ga0197907_10025204 | 3300020069 | Bacteria | 3176 |
| 177 | Ga0197907_10275978 | 3300020069 | Bacteria | 2917 |
| 178 | Ga0206356_10524634 | 3300020070 | Bacteria | 1931 |
| 179 | Ga0206350_11092398 | 3300020080 | Bacteria | 2139 |
| 180 | Ga0206354_11559491 | 3300020081 | Bacteria | 5924 |
| 181 | Ga0206353_10091682 | 3300020082 | Bacteria | 1686 |
| 182 | Ga0206353_11305176 | 3300020082 | Bacteria | 5623 |
| 183 | Ga0209566_100043 | 3300025225 | Bacteria | 266609 |
| 184 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 185 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 186 | Ga0209563_100183 | 3300025230 | Bacteria | 37635 |
| 187 | Ga0207427_100407 | 3300025231 | Bacteria | 25132 |
| 188 | Ga0209437_100315 | 3300025233 | Bacteria | 63641 |
| 189 | Ga0207425_1005261 | 3300025245 | Bacteria | 3721 |
| 190 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 191 | Ga0209677_100407 | 3300025253 | Bacteria | 25727 |
| 192 | Ga0209148_1001608 | 3300025254 | Bacteria | 10532 |
| 193 | Ga0209759_1011595 | 3300025256 | Bacteria | 2495 |
| 194 | Ga0209129_1000159 | 3300025258 | Bacteria | 103426 |
| 195 | Ga0209233_1000014 | 3300025261 | Bacteria | 996641 |
| 196 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 197 | Ga0209673_1000027 | 3300025273 | Bacteria | 360561 |
| 198 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 199 | Ga0209676_1000068 | 3300025292 | Bacteria | 314068 |
| 200 | Ga0209025_1000005 | 3300025294 | Bacteria | 1272149 |
| 201 | Ga0209025_1000211 | 3300025294 | Bacteria | 139109 |
| 202 | Ga0209564_1000050 | 3300025295 | Bacteria | 360560 |
| 203 | Ga0209758_1004731 | 3300025297 | Bacteria | 11083 |
| 204 | Ga0209050_1006127 | 3300025298 | Bacteria | 7253 |
| 205 | Ga0209256_1000031 | 3300025299 | Bacteria | 410189 |
| 206 | Ga0209051_1019000 | 3300025303 | Bacteria | 3017 |
| 207 | Ga0209051_1021914 | 3300025303 | Bacteria | 2703 |
| 208 | Ga0209257_1000645 | 3300025304 | Bacteria | 55704 |
| 209 | Ga0207697_10003551 | 3300025315 | Bacteria | 7681 |
| 210 | Ga0207656_10163503 | 3300025321 | Bacteria | 1060 |
| 211 | Ga0207655_1019888 | 3300025728 | Bacteria | 3482 |
| 212 | Ga0207655_1028626 | 3300025728 | Bacteria | 2625 |
| 213 | Ga0207682_10002817 | 3300025893 | Bacteria | 7684 |
| 214 | Ga0207710_10013970 | 3300025900 | Bacteria | 3382 |
| 215 | Ga0207688_10031636 | 3300025901 | Bacteria | 2922 |
| 216 | Ga0207688_10096039 | 3300025901 | Bacteria | 1706 |
| 217 | Ga0207680_10039388 | 3300025903 | Bacteria | 2742 |
| 218 | Ga0207680_10068500 | 3300025903 | Bacteria | 2189 |
| 219 | Ga0207645_10023729 | 3300025907 | Bacteria | 3983 |
| 220 | Ga0207643_10000202 | 3300025908 | Bacteria | 41336 |
| 221 | Ga0207705_10010432 | 3300025909 | Bacteria | 6753 |
| 222 | Ga0207705_10102236 | 3300025909 | Bacteria | 2109 |
| 223 | Ga0207705_10229616 | 3300025909 | Bacteria | 1411 |
| 224 | Ga0207707_10072709 | 3300025912 | Bacteria | 2997 |
| 225 | Ga0207695_10045863 | 3300025913 | Bacteria | 4636 |
| 226 | Ga0207695_10124286 | 3300025913 | Bacteria | 2544 |
| 227 | Ga0207693_10212410 | 3300025915 | Bacteria | 1521 |
| 228 | Ga0207660_10393572 | 3300025917 | Bacteria | 1115 |
| 229 | Ga0207657_10011873 | 3300025919 | Bacteria | 8622 |
| 230 | Ga0207657_10035234 | 3300025919 | Bacteria | 4489 |
| 231 | Ga0207681_10033056 | 3300025923 | Bacteria | 3390 |
| 232 | Ga0207694_10100706 | 3300025924 | Bacteria | 2289 |
| 233 | Ga0207650_10003161 | 3300025925 | Bacteria | 11346 |
| 234 | Ga0207700_10031192 | 3300025928 | Bacteria | 3783 |
| 235 | Ga0207664_10024041 | 3300025929 | Bacteria | 4575 |
| 236 | Ga0207644_10041703 | 3300025931 | Bacteria | 3248 |
| 237 | Ga0207690_10038933 | 3300025932 | Bacteria | 3098 |
| 238 | Ga0207706_10421784 | 3300025933 | Bacteria | 1156 |
| 239 | Ga0207709_10000632 | 3300025935 | Bacteria | 28799 |
| 240 | Ga0207709_10184352 | 3300025935 | Bacteria | 1477 |
| 241 | Ga0207709_10595464 | 3300025935 | Bacteria | 875 |
| 242 | Ga0207670_10321697 | 3300025936 | Bacteria | 1217 |
| 243 | Ga0207691_10002149 | 3300025940 | Bacteria | 19307 |
| 244 | Ga0207691_10009924 | 3300025940 | Bacteria | 9141 |
| 245 | Ga0207691_10752285 | 3300025940 | Bacteria | 821 |
| 246 | Ga0207689_10004258 | 3300025942 | Bacteria | 13013 |
| 247 | Ga0207661_10005333 | 3300025944 | Bacteria | 9048 |
| 248 | Ga0207661_10309604 | 3300025944 | Bacteria | 1417 |
| 249 | Ga0207679_10008214 | 3300025945 | Bacteria | 6644 |
| 250 | Ga0207679_10349168 | 3300025945 | Bacteria | 1289 |
| 251 | Ga0207667_10694481 | 3300025949 | Bacteria | 1020 |
| 252 | Ga0207651_10026046 | 3300025960 | Bacteria | 3646 |
| 253 | Ga0207651_10072652 | 3300025960 | Bacteria | 2443 |
| 254 | Ga0207640_10318566 | 3300025981 | Bacteria | 1237 |
| 255 | Ga0207677_10006429 | 3300026023 | Bacteria | 6445 |
| 256 | Ga0207703_10074827 | 3300026035 | Bacteria | 2805 |
| 257 | Ga0207678_10001765 | 3300026067 | Bacteria | 19806 |
| 258 | Ga0207708_10038908 | 3300026075 | Bacteria | 3623 |
| 259 | Ga0207702_10001104 | 3300026078 | Bacteria | 27582 |
| 260 | Ga0207702_10007880 | 3300026078 | Bacteria | 9030 |
| 261 | Ga0207641_10029111 | 3300026088 | Bacteria | 4567 |
| 262 | Ga0207641_10218608 | 3300026088 | Bacteria | 1765 |
| 263 | Ga0207676_10001801 | 3300026095 | Bacteria | 15704 |
| 264 | Ga0207674_10065152 | 3300026116 | Bacteria | 3673 |
| 265 | Ga0207683_10008663 | 3300026121 | Bacteria | 8699 |
| 266 | Ga0207683_10028397 | 3300026121 | Bacteria | 4837 |
| 267 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 268 | Ga0209371_1000139 | 3300027312 | Bacteria | 120350 |
| 269 | Ga0209969_1011375 | 3300027360 | Bacteria | 1278 |
| 270 | Ga0209967_1023242 | 3300027364 | Bacteria | 911 |
| 271 | Ga0209984_1021647 | 3300027424 | Bacteria | 883 |
| 272 | Ga0209983_1007204 | 3300027665 | Bacteria | 2281 |
| 273 | Ga0209974_10010966 | 3300027876 | Bacteria | 3050 |
| 274 | Ga0207428_10034428 | 3300027907 | Bacteria | 4151 |
| 275 | Ga0268266_10037476 | 3300028379 | Bacteria | 4131 |
| 276 | Ga0268266_10084548 | 3300028379 | Bacteria | 2771 |
| 277 | Ga0307517_10025256 | 3300028786 | Bacteria | 7276 |
| 278 | Ga0307515_10000050 | 3300028794 | Bacteria | 275624 |
| 279 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 280 | Ga0268256_1000109 | 3300030500 | Bacteria | 120350 |
| 281 | Ga0307511_10002943 | 3300030521 | Bacteria | 17643 |
| 282 | Ga0307512_10092674 | 3300030522 | Bacteria | 2095 |
| 283 | Ga0307513_10019869 | 3300031456 | Bacteria | 7982 |
| 284 | Ga0307509_10003130 | 3300031507 | Bacteria | 25663 |
| 285 | Ga0307509_10011263 | 3300031507 | Bacteria | 10850 |
| 286 | Ga0307509_10022296 | 3300031507 | Bacteria | 7145 |
| 287 | Ga0307509_10025648 | 3300031507 | Bacteria | 6580 |
| 288 | Ga0307408_100010694 | 3300031548 | Bacteria | 6053 |
| 289 | Ga0307408_100012672 | 3300031548 | Bacteria | 5591 |
| 290 | Ga0307408_100028576 | 3300031548 | Bacteria | 3855 |
| 291 | Ga0307408_100030404 | 3300031548 | Bacteria | 3750 |
| 292 | Ga0307408_100035266 | 3300031548 | Bacteria | 3509 |
| 293 | Ga0307408_100035311 | 3300031548 | Bacteria | 3507 |
| 294 | Ga0307408_100048800 | 3300031548 | Bacteria | 3038 |
| 295 | Ga0307408_100284833 | 3300031548 | Bacteria | 1377 |
| 296 | Ga0307408_100298891 | 3300031548 | Bacteria | 1347 |
| 297 | Ga0307408_100585246 | 3300031548 | Bacteria | 989 |
| 298 | Ga0307508_10204463 | 3300031616 | Bacteria | 1575 |
| 299 | Ga0307514_10173113 | 3300031649 | Bacteria | 1406 |
| 300 | Ga0316575_10011793 | 3300031665 | Bacteria | 3240 |
| 301 | Ga0316576_10038680 | 3300031727 | Bacteria | 3421 |
| 302 | Ga0316576_10040342 | 3300031727 | Bacteria | 3355 |
| 303 | Ga0316576_10072333 | 3300031727 | Bacteria | 2545 |
| 304 | Ga0316576_10327650 | 3300031727 | Bacteria | 1142 |
| 305 | Ga0316578_10120001 | 3300031728 | Bacteria | 1580 |
| 306 | Ga0307516_10004353 | 3300031730 | Bacteria | 17513 |
| 307 | Ga0307405_10004419 | 3300031731 | Bacteria | 6646 |
| 308 | Ga0307405_10016643 | 3300031731 | Bacteria | 4015 |
| 309 | Ga0307405_10248530 | 3300031731 | Bacteria | 1322 |
| 310 | Ga0307405_10391200 | 3300031731 | Bacteria | 1085 |
| 311 | Ga0307405_10395812 | 3300031731 | Bacteria | 1080 |
| 312 | Ga0307405_10553239 | 3300031731 | Bacteria | 931 |
| 313 | Ga0307405_10612877 | 3300031731 | Bacteria | 890 |
| 314 | Ga0307413_10001980 | 3300031824 | Bacteria | 8131 |
| 315 | Ga0307413_10009030 | 3300031824 | Bacteria | 4746 |
| 316 | Ga0307413_10018695 | 3300031824 | Bacteria | 3643 |
| 317 | Ga0307413_10018758 | 3300031824 | Bacteria | 3638 |
| 318 | Ga0307413_10062999 | 3300031824 | Bacteria | 2297 |
| 319 | Ga0307413_10122379 | 3300031824 | Bacteria | 1765 |
| 320 | Ga0307413_10163763 | 3300031824 | Bacteria | 1565 |
| 321 | Ga0307413_10195471 | 3300031824 | Bacteria | 1456 |
| 322 | Ga0307413_10335668 | 3300031824 | Bacteria | 1160 |
| 323 | Ga0307413_10574935 | 3300031824 | Bacteria | 918 |
| 324 | Ga0307410_10040876 | 3300031852 | Bacteria | 3054 |
| 325 | Ga0307410_10054246 | 3300031852 | Bacteria | 2716 |
| 326 | Ga0307410_10066085 | 3300031852 | Bacteria | 2490 |
| 327 | Ga0307410_10097706 | 3300031852 | Bacteria | 2098 |
| 328 | Ga0307410_10134472 | 3300031852 | Bacteria | 1821 |
| 329 | Ga0307410_10190552 | 3300031852 | Bacteria | 1559 |
| 330 | Ga0307410_10277074 | 3300031852 | Bacteria | 1314 |
| 331 | Ga0307410_10396844 | 3300031852 | Bacteria | 1113 |
| 332 | Ga0307406_10090639 | 3300031901 | Bacteria | 2058 |
| 333 | Ga0307406_10092869 | 3300031901 | Bacteria | 2036 |
| 334 | Ga0307406_10127338 | 3300031901 | Bacteria | 1782 |
| 335 | Ga0307406_10394798 | 3300031901 | Bacteria | 1095 |
| 336 | Ga0307406_10445594 | 3300031901 | Bacteria | 1037 |
| 337 | Ga0307407_10015562 | 3300031903 | Bacteria | 3765 |
| 338 | Ga0307407_10019104 | 3300031903 | Bacteria | 3483 |
| 339 | Ga0307407_10234411 | 3300031903 | Bacteria | 1248 |
| 340 | Ga0307407_10241029 | 3300031903 | Bacteria | 1233 |
| 341 | Ga0307412_10002168 | 3300031911 | Bacteria | 10898 |
| 342 | Ga0307412_10009159 | 3300031911 | Bacteria | 5674 |
| 343 | Ga0307412_10016980 | 3300031911 | Bacteria | 4348 |
| 344 | Ga0307412_10021789 | 3300031911 | Bacteria | 3919 |
| 345 | Ga0307412_10035423 | 3300031911 | Bacteria | 3189 |
| 346 | Ga0307412_10065910 | 3300031911 | Bacteria | 2453 |
| 347 | Ga0307412_10092028 | 3300031911 | Bacteria | 2124 |
| 348 | Ga0307412_10256117 | 3300031911 | Bacteria | 1361 |
| 349 | Ga0307412_10267703 | 3300031911 | Bacteria | 1336 |
| 350 | Ga0307409_100063441 | 3300031995 | Bacteria | 2897 |
| 351 | Ga0307409_100105038 | 3300031995 | Bacteria | 2354 |
| 352 | Ga0307409_100153597 | 3300031995 | Bacteria | 2002 |
| 353 | Ga0307409_100202413 | 3300031995 | Bacteria | 1777 |
| 354 | Ga0307409_100427300 | 3300031995 | Bacteria | 1272 |
| 355 | Ga0307416_100033203 | 3300032002 | Bacteria | 3909 |
| 356 | Ga0307416_100101615 | 3300032002 | Bacteria | 2504 |
| 357 | Ga0307416_100110407 | 3300032002 | Bacteria | 2421 |
| 358 | Ga0307416_100121954 | 3300032002 | Bacteria | 2325 |
| 359 | Ga0307416_100143614 | 3300032002 | Bacteria | 2174 |
| 360 | Ga0307416_100262868 | 3300032002 | Bacteria | 1688 |
| 361 | Ga0307416_100741068 | 3300032002 | Bacteria | 1074 |
| 362 | Ga0307416_101057864 | 3300032002 | Bacteria | 915 |
| 363 | Ga0307414_10002021 | 3300032004 | Bacteria | 10541 |
| 364 | Ga0307414_10049127 | 3300032004 | Bacteria | 2915 |
| 365 | Ga0307414_10090822 | 3300032004 | Bacteria | 2268 |
| 366 | Ga0307414_10293181 | 3300032004 | Bacteria | 1372 |
| 367 | Ga0307414_10305827 | 3300032004 | Bacteria | 1347 |
| 368 | Ga0307414_10502267 | 3300032004 | Bacteria | 1073 |
| 369 | Ga0307411_10006487 | 3300032005 | Bacteria | 5861 |
| 370 | Ga0307411_10733297 | 3300032005 | Bacteria | 864 |
| 371 | Ga0307415_100011710 | 3300032126 | Bacteria | 5035 |
| 372 | Ga0307415_100079701 | 3300032126 | Bacteria | 2334 |
| 373 | Ga0316585_10080090 | 3300032137 | Bacteria | 1064 |
| 374 | Ga0307510_10005740 | 3300033180 | Bacteria | 14791 |
| 375 | Ga0307510_10249959 | 3300033180 | Bacteria | 1261 |
| 376 | Ga0316574_0006917 | 3300035398 | Bacteria | 6175 |
| 377 | Ga0316574_0032437 | 3300035398 | Bacteria | 3174 |
| 378 | Ga0316574_0044941 | 3300035398 | Bacteria | 2733 |
| 379 | Ga0316574_0048231 | 3300035398 | Bacteria | 2644 |
| 380 | Ga0316574_0170441 | 3300035398 | Bacteria | 1402 |
| 381 | Ga0316574_0286349 | 3300035398 | Bacteria | 1049 |
| 382 | Ga0395899_0006752 | 3300037312 | Bacteria | 8889 |
| 383 | Ga0395899_0006965 | 3300037312 | Bacteria | 8758 |
| 384 | Ga0395899_0015045 | 3300037312 | Bacteria | 5898 |
| 385 | Ga0395899_0040126 | 3300037312 | Bacteria | 3501 |
| 386 | Ga0395899_0109651 | 3300037312 | Bacteria | 1985 |
| 387 | Ga0395899_0125320 | 3300037312 | Bacteria | 1837 |
| 388 | Ga0395899_0152367 | 3300037312 | Bacteria | 1637 |
| 389 | Ga0395900_0022120 | 3300037418 | Bacteria | 6505 |
| 390 | Ga0395900_0032108 | 3300037418 | Bacteria | 5398 |
| 391 | Ga0395900_0120432 | 3300037418 | Bacteria | 2693 |
| 392 | Ga0395900_0122009 | 3300037418 | Bacteria | 2673 |
| 393 | Ga0395900_0183870 | 3300037418 | Bacteria | 2122 |
| 394 | Ga0395900_0205546 | 3300037418 | Bacteria | 1990 |
| 395 | Ga0395900_0325828 | 3300037418 | Bacteria | 1515 |
| 396 | Ga0395898_0011125 | 3300037466 | Bacteria | 9368 |
| 397 | Ga0395898_0015445 | 3300037466 | Bacteria | 7830 |
| 398 | Ga0395898_0047998 | 3300037466 | Bacteria | 4188 |
| 399 | Ga0395898_0073111 | 3300037466 | Bacteria | 3311 |
| 400 | Ga0395898_0083391 | 3300037466 | Bacteria | 3081 |
| 401 | Ga0395898_0223338 | 3300037466 | Bacteria | 1797 |
| 402 | Ga0395898_0319772 | 3300037466 | Bacteria | 1480 |
| 403 | Ga0395898_0361270 | 3300037466 | Bacteria | 1384 |
| 404 | Ga0395898_0405738 | 3300037466 | Bacteria | 1299 |
| 405 | Ga0395905_0008483 | 3300037471 | Bacteria | 10131 |
| 406 | Ga0395905_0297483 | 3300037471 | Bacteria | 1501 |
| 407 | Ga0395905_0468542 | 3300037471 | Bacteria | 1158 |
| 408 | Ga0395901_0010870 | 3300038443 | Bacteria | 9224 |
| 409 | Ga0395901_0012060 | 3300038443 | Bacteria | 8768 |
| 410 | Ga0395901_0017119 | 3300038443 | Bacteria | 7390 |
| 411 | Ga0395901_0019338 | 3300038443 | Bacteria | 6962 |
| 412 | Ga0395901_0042420 | 3300038443 | Bacteria | 4716 |
| 413 | Ga0395901_0061266 | 3300038443 | Bacteria | 3915 |
| 414 | Ga0395901_0313253 | 3300038443 | Bacteria | 1625 |
| 415 | Ga0395901_0316219 | 3300038443 | Bacteria | 1616 |
| 416 | Ga0395901_0336293 | 3300038443 | Bacteria | 1560 |
| 417 | Ga0395901_0461056 | 3300038443 | Bacteria | 1298 |
| 418 | Ga0395901_0710324 | 3300038443 | Bacteria | 1002 |
| 419 | Ga0237819_05553 | 3300038705 | Bacteria | 1967 |
| 420 | Ga0439436_0004892 | 3300041404 | Bacteria | 4112 |
| 421 | Ga0439436_0007439 | 3300041404 | Bacteria | 3369 |
| 422 | Ga0439436_0023178 | 3300041404 | Bacteria | 1837 |
| 423 | Ga0439436_0063248 | 3300041404 | Bacteria | 1034 |
| 424 | Ga0439438_030485 | 3300041405 | Bacteria | 1438 |
| 425 | Ga0439438_054448 | 3300041405 | Bacteria | 1011 |
| 426 | Ga0439439_0004700 | 3300041406 | Bacteria | 3086 |
| 427 | Ga0439439_0037080 | 3300041406 | Bacteria | 1256 |
| 428 | Ga0439466_0017726 | 3300041411 | Bacteria | 2562 |
| 429 | Ga0439466_0042261 | 3300041411 | Bacteria | 1518 |
| 430 | Ga0439465_0000040 | 3300041413 | Bacteria | 26319 |
| 431 | Ga0439465_0020201 | 3300041413 | Bacteria | 2085 |
| 432 | Ga0451791_1883876 | 3300041451 | Bacteria | 1342 |
| 433 | Ga0451793_0432375 | 3300041452 | Bacteria | 3475 |
| 434 | Ga0451793_0611243 | 3300041452 | Bacteria | 1665 |
| 435 | Ga0451800_1224437 | 3300041459 | Bacteria | 3605 |
| 436 | Ga0451806_620901 | 3300041462 | Bacteria | 1847 |
| 437 | Ga0451807_1378455 | 3300041486 | Bacteria | 2158 |
| 438 | Ga0451843_1504794 | 3300041509 | Bacteria | 1242 |
| 439 | Ga0451853_0174512 | 3300041512 | Bacteria | 1263 |
| 440 | Ga0439433_0025077 | 3300041999 | Bacteria | 1345 |
| 441 | Ga0439442_000066 | 3300042002 | Bacteria | 24598 |
| 442 | Ga0439442_002302 | 3300042002 | Bacteria | 3748 |
| 443 | Ga0439442_003358 | 3300042002 | Bacteria | 3164 |
| 444 | Ga0439432_005823 | 3300042006 | Bacteria | 4424 |
| 445 | Ga0439449_0000134 | 3300042007 | Bacteria | 25113 |
| 446 | Ga0439449_0003611 | 3300042007 | Bacteria | 6005 |
| 447 | Ga0439449_0008474 | 3300042007 | Bacteria | 3907 |
| 448 | Ga0439449_0026802 | 3300042007 | Bacteria | 2150 |
| 449 | Ga0439449_0029576 | 3300042007 | Bacteria | 2042 |
| 450 | Ga0439449_0042385 | 3300042007 | Bacteria | 1691 |
| 451 | Ga0439452_031797 | 3300042010 | Bacteria | 1293 |
| 452 | Ga0439457_006936 | 3300042014 | Bacteria | 2740 |
| 453 | Ga0439463_013653 | 3300042016 | Bacteria | 2001 |
| 454 | Ga0450920_000130 | 3300042122 | Bacteria | 10289 |
| 455 | Ga0450920_007667 | 3300042122 | Bacteria | 1960 |
| 456 | Ga0450894_010499 | 3300042131 | Bacteria | 1202 |
| 457 | Ga0450907_000127 | 3300042146 | Bacteria | 28670 |
| 458 | Ga0439458_0039149 | 3300042157 | Bacteria | 1146 |
| 459 | Ga0439434_0000033 | 3300042435 | Bacteria | 32845 |
| 460 | Ga0450918_003438 | 3300042531 | Bacteria | 2939 |
| 461 | Ga0451577_0051922 | 3300042876 | Bacteria | 3660 |
| 462 | Ga0466969_0126953 | 3300044656 | Bacteria | 1185 |
| 463 | Ga0466972_0080846 | 3300044658 | Bacteria | 1548 |
| 464 | Ga0466972_0081652 | 3300044658 | Bacteria | 1539 |
| 465 | Ga0466965_0276357 | 3300044683 | Bacteria | 906 |
| 466 | Ga0466966_0010237 | 3300044684 | Bacteria | 6222 |
| 467 | Ga0466961_0030561 | 3300044693 | Bacteria | 3462 |
| 468 | Ga0466968_0022494 | 3300044735 | Bacteria | 2562 |
| 469 | Ga0466970_0026478 | 3300044765 | Bacteria | 3038 |
| 470 | Ga0466970_0289341 | 3300044765 | Bacteria | 922 |
| 471 | Ga0466957_0085023 | 3300044842 | Bacteria | 1975 |
| 472 | Ga0466959_0026949 | 3300045049 | Bacteria | 4262 |
| 473 | Ga0466958_0003576 | 3300045836 | Bacteria | 8095 |
| 474 | Ga0466967_0876924 | 3300045976 | Bacteria | 892 |
| 475 | Ga0495603_0161730 | 3300046455 | Bacteria | 1299 |
| 476 | Ga0495629_0015808 | 3300046459 | Bacteria | 5419 |
| 477 | Ga0495629_0032461 | 3300046459 | Bacteria | 3697 |
| 478 | Ga0495653_0001814 | 3300046463 | Bacteria | 16828 |
| 479 | Ga0495580_0023426 | 3300046472 | Bacteria | 4534 |
| 480 | Ga0495580_0042268 | 3300046472 | Bacteria | 3247 |
| 481 | Ga0495639_0027634 | 3300046475 | Bacteria | 2512 |
| 482 | Ga0495639_0031364 | 3300046475 | Bacteria | 2365 |
| 483 | Ga0495664_0000613 | 3300046477 | Bacteria | 18136 |
| 484 | Ga0495594_0019951 | 3300046499 | Bacteria | 3567 |
| 485 | Ga0495594_0036701 | 3300046499 | Bacteria | 2673 |
| 486 | Ga0495607_0037418 | 3300046501 | Bacteria | 2915 |
| 487 | Ga0495606_0012571 | 3300046507 | Bacteria | 6776 |
| 488 | Ga0495630_0025529 | 3300046517 | Bacteria | 4371 |
| 489 | Ga0495631_0116539 | 3300046518 | Bacteria | 1149 |
| 490 | Ga0495643_0086752 | 3300046522 | Bacteria | 1621 |
| 491 | Ga0495586_0001078 | 3300046535 | Bacteria | 15403 |
| 492 | Ga0495586_0003416 | 3300046535 | Bacteria | 8516 |
| 493 | Ga0495586_0031754 | 3300046535 | Bacteria | 2830 |
| 494 | Ga0495586_0057051 | 3300046535 | Bacteria | 2118 |
| 495 | Ga0495587_0002655 | 3300046536 | Bacteria | 11943 |
| 496 | Ga0495621_0001151 | 3300046539 | Bacteria | 6843 |
| 497 | Ga0495645_0003098 | 3300046543 | Bacteria | 11264 |
| 498 | Ga0495622_0126754 | 3300046557 | Bacteria | 1164 |
| 499 | Ga0495633_0005962 | 3300046558 | Bacteria | 7322 |
| 500 | Ga0495633_0183498 | 3300046558 | Bacteria | 963 |
| 501 | Ga0495656_0003170 | 3300046615 | Bacteria | 5537 |
| 502 | Ga0495656_0033620 | 3300046615 | Bacteria | 2094 |
| 503 | Ga0495656_0049409 | 3300046615 | Bacteria | 1791 |
| 504 | Ga0495656_0056328 | 3300046615 | Bacteria | 1698 |
| 505 | Ga0495668_0000820 | 3300046616 | Bacteria | 35709 |
| 506 | Ga0495668_0101920 | 3300046616 | Bacteria | 1570 |
| 507 | Ga0495625_0002120 | 3300046660 | Bacteria | 22135 |
| 508 | Ga0495588_0001848 | 3300046674 | Bacteria | 9027 |
| 509 | Ga0495588_0009628 | 3300046674 | Bacteria | 4472 |
| 510 | Ga0495588_0054122 | 3300046674 | Bacteria | 2070 |
| 511 | Ga0495623_0007879 | 3300046679 | Bacteria | 6929 |
| 512 | Ga0495670_0046189 | 3300046691 | Bacteria | 2175 |
| 513 | Ga0495671_0019486 | 3300046692 | Bacteria | 3586 |
| 514 | Ga0495600_0058243 | 3300046809 | Bacteria | 2523 |
| 515 | Ga0495600_0059355 | 3300046809 | Bacteria | 2499 |
| 516 | Ga0495581_0000128 | 3300047315 | Bacteria | 32831 |
| 517 | Ga0495581_0019994 | 3300047315 | Bacteria | 3887 |
| 518 | Ga0495581_0041548 | 3300047315 | Bacteria | 2661 |
| 519 | Ga0495581_0122996 | 3300047315 | Bacteria | 1510 |
| 520 | Ga0495604_0261973 | 3300047317 | Bacteria | 1175 |
| 521 | Ga0495636_0000599 | 3300047318 | Bacteria | 13258 |
| 522 | Ga0495636_0111595 | 3300047318 | Bacteria | 1203 |
| 523 | Ga0495680_0015661 | 3300047322 | Bacteria | 6534 |
| 524 | Ga0495687_002744 | 3300047443 | Bacteria | 13646 |
| 525 | Ga0495675_0004789 | 3300047444 | Bacteria | 8224 |
| 526 | Ga0495677_0032038 | 3300047445 | Bacteria | 1914 |
| 527 | Ga0495681_0011450 | 3300047470 | Bacteria | 5282 |
| 528 | Ga0495593_0052049 | 3300047673 | Bacteria | 2165 |
| 529 | Ga0495614_0003756 | 3300048089 | Bacteria | 6822 |
| 530 | Ga0495615_0015710 | 3300048090 | Bacteria | 1622 |
| 531 | Ga0496100_0107150 | 3300048903 | Bacteria | 1935 |
| 532 | Ga0496100_0150221 | 3300048903 | Bacteria | 1660 |
| 533 | Ga0496100_0153783 | 3300048903 | Bacteria | 1643 |
| 534 | Ga0496101_0061938 | 3300048904 | Bacteria | 2719 |
| 535 | Ga0496101_0140312 | 3300048904 | Bacteria | 1841 |
| 536 | Ga0496101_0235305 | 3300048904 | Bacteria | 1424 |
| 537 | Ga0496101_0316272 | 3300048904 | Bacteria | 1224 |
| 538 | Ga0496102_0015677 | 3300048905 | Bacteria | 6603 |
| 539 | Ga0496102_0023629 | 3300048905 | Bacteria | 5462 |
| 540 | Ga0496102_0182007 | 3300048905 | Bacteria | 1980 |
| 541 | Ga0496102_0215983 | 3300048905 | Bacteria | 1807 |
| 542 | Ga0496103_0021998 | 3300048906 | Bacteria | 3838 |
| 543 | Ga0496103_0075902 | 3300048906 | Bacteria | 2108 |
| 544 | Ga0496103_0150771 | 3300048906 | Bacteria | 1489 |
| 545 | Ga0496104_0002342 | 3300048907 | Bacteria | 16376 |
| 546 | Ga0496105_0001990 | 3300048908 | Bacteria | 14730 |
| 547 | Ga0496105_0245855 | 3300048908 | Bacteria | 1451 |
| 548 | Ga0496106_0014269 | 3300048909 | Bacteria | 5869 |
| 549 | Ga0496106_0113007 | 3300048909 | Bacteria | 2116 |
| 550 | Ga0496106_0155166 | 3300048909 | Bacteria | 1807 |
| 551 | Ga0496107_0071071 | 3300048910 | Bacteria | 2528 |
| 552 | Ga0496108_0029297 | 3300048911 | Bacteria | 4557 |
| 553 | Ga0496108_0047240 | 3300048911 | Bacteria | 3598 |
| 554 | Ga0496108_0101964 | 3300048911 | Bacteria | 2448 |
| 555 | Ga0496108_0175385 | 3300048911 | Unclassified | 1856 |
| 556 | Ga0496108_0421658 | 3300048911 | Bacteria | 1165 |
| 557 | Ga0496109_0095228 | 3300048912 | Bacteria | 2756 |
| 558 | Ga0496109_0201937 | 3300048912 | Bacteria | 1869 |
| 559 | Ga0496109_0224372 | 3300048912 | Bacteria | 1767 |
| 560 | Ga0496109_0281058 | 3300048912 | Bacteria | 1569 |
| 561 | Ga0496110_0011013 | 3300048913 | Bacteria | 7380 |
| 562 | Ga0496110_0060420 | 3300048913 | Bacteria | 3342 |
| 563 | Ga0496110_0070083 | 3300048913 | Bacteria | 3105 |
| 564 | Ga0496110_0131824 | 3300048913 | Bacteria | 2257 |
| 565 | Ga0496110_0617577 | 3300048913 | Bacteria | 982 |
| 566 | Ga0496111_0011112 | 3300048914 | Bacteria | 6060 |
| 567 | Ga0496111_0018274 | 3300048914 | Bacteria | 4854 |
| 568 | Ga0496111_0053672 | 3300048914 | Bacteria | 2912 |
| 569 | Ga0496111_0284378 | 3300048914 | Bacteria | 1227 |
| 570 | Ga0496112_0010013 | 3300048915 | Bacteria | 8580 |
| 571 | Ga0496112_0029310 | 3300048915 | Bacteria | 5322 |
| 572 | Ga0496112_0046986 | 3300048915 | Bacteria | 4234 |
| 573 | Ga0496112_0534731 | 3300048915 | Bacteria | 1106 |
| 574 | Ga0496112_0638958 | 3300048915 | Bacteria | 995 |
| 575 | Ga0496113_0088467 | 3300048916 | Bacteria | 2382 |
| 576 | Ga0496113_0120094 | 3300048916 | Bacteria | 2054 |
| 577 | Ga0496113_0302582 | 3300048916 | Bacteria | 1280 |
| 578 | Ga0496113_0430015 | 3300048916 | Bacteria | 1060 |
| 579 | Ga0496114_0032805 | 3300048917 | Bacteria | 4277 |
| 580 | Ga0496114_0135241 | 3300048917 | Bacteria | 2131 |
| 581 | Ga0496114_0198065 | 3300048917 | Bacteria | 1758 |
| 582 | Ga0496114_0305237 | 3300048917 | Bacteria | 1405 |
| 583 | Ga0496118_0009087 | 3300048921 | Bacteria | 10122 |
| 584 | Ga0496118_0066272 | 3300048921 | Bacteria | 2637 |
| 585 | Ga0496122_0012430 | 3300048925 | Bacteria | 8476 |
| 586 | Ga0496123_0004944 | 3300048926 | Bacteria | 13665 |
| 587 | Ga0496124_0000009 | 3300048927 | Bacteria | 734820 |
| 588 | Ga0496124_0159897 | 3300048927 | Bacteria | 1757 |
| 589 | Ga0496124_0436455 | 3300048927 | Bacteria | 897 |
| 590 | Ga0496125_0019360 | 3300048928 | Bacteria | 6423 |
| 591 | Ga0496126_0271546 | 3300048929 | Bacteria | 1407 |
| 592 | Ga0501290_001797 | 3300049513 | Bacteria | 2850 |
| 593 | Ga0501031_0000156 | 3300049568 | Bacteria | 38816 |
| 594 | Ga0501031_0076495 | 3300049568 | Bacteria | 2180 |
| 595 | Ga0501032_0001239 | 3300049569 | Bacteria | 20482 |
| 596 | Ga0501032_0017471 | 3300049569 | Bacteria | 5038 |
| 597 | Ga0501032_0030653 | 3300049569 | Bacteria | 3690 |
| 598 | Ga0501033_0002504 | 3300049570 | Bacteria | 15567 |
| 599 | Ga0501033_0032947 | 3300049570 | Bacteria | 3890 |
| 600 | Ga0501033_0254670 | 3300049570 | Bacteria | 1243 |
| 601 | Ga0501034_0000057 | 3300049571 | Bacteria | 202455 |
| 602 | Ga0501034_0040056 | 3300049571 | Bacteria | 4744 |
| 603 | Ga0501034_0558402 | 3300049571 | Bacteria | 1054 |
| 604 | Ga0501036_0001565 | 3300049572 | Bacteria | 17677 |
| 605 | Ga0501037_0022824 | 3300049573 | Bacteria | 4626 |
| 606 | Ga0501037_0047460 | 3300049573 | Bacteria | 3147 |
| 607 | Ga0501037_0071373 | 3300049573 | Bacteria | 2526 |
| 608 | Ga0501038_0005500 | 3300049574 | Bacteria | 11760 |
| 609 | Ga0501038_0016885 | 3300049574 | Bacteria | 6606 |
| 610 | Ga0501038_0380809 | 3300049574 | Bacteria | 1094 |
| 611 | Ga0501042_0068334 | 3300049578 | Bacteria | 2541 |
| 612 | Ga0501043_0006544 | 3300049579 | Bacteria | 9346 |
| 613 | Ga0501043_0014674 | 3300049579 | Bacteria | 6134 |
| 614 | Ga0501043_0016151 | 3300049579 | Bacteria | 5854 |
| 615 | Ga0501043_0105858 | 3300049579 | Bacteria | 2209 |
| 616 | Ga0501046_0000631 | 3300049580 | Bacteria | 34597 |
| 617 | Ga0501046_0031424 | 3300049580 | Bacteria | 4303 |
| 618 | Ga0501047_0011740 | 3300049581 | Bacteria | 8285 |
| 619 | Ga0501047_0077892 | 3300049581 | Bacteria | 3188 |
| 620 | Ga0501047_0309448 | 3300049581 | Bacteria | 1420 |
| 621 | Ga0501048_0006530 | 3300049582 | Bacteria | 8865 |
| 622 | Ga0501067_0018587 | 3300049583 | Bacteria | 3847 |
| 623 | Ga0501067_0146578 | 3300049583 | Bacteria | 1315 |
| 624 | Ga0501069_0011639 | 3300049585 | Bacteria | 4664 |
| 625 | Ga0501070_0009017 | 3300049586 | Bacteria | 8440 |
| 626 | Ga0501071_0056139 | 3300049587 | Bacteria | 2844 |
| 627 | Ga0501073_0000422 | 3300049589 | Bacteria | 28939 |
| 628 | Ga0501074_0007013 | 3300049590 | Bacteria | 8134 |
| 629 | Ga0501075_0216575 | 3300049591 | Bacteria | 1461 |
| 630 | Ga0501079_0018062 | 3300049741 | Bacteria | 5387 |
| 631 | Ga0501080_0025172 | 3300049742 | Bacteria | 5523 |
| 632 | Ga0501081_0016586 | 3300049743 | Bacteria | 4870 |
| 633 | Ga0501083_0009150 | 3300049744 | Bacteria | 6997 |
| 634 | Ga0501035_0026677 | 3300049822 | Bacteria | 5284 |
| 635 | Ga0501035_0039279 | 3300049822 | Bacteria | 4283 |
| 636 | Ga0501035_0050547 | 3300049822 | Bacteria | 3725 |
| 637 | Ga0501044_0005418 | 3300049823 | Bacteria | 14173 |
| 638 | Ga0501044_0018317 | 3300049823 | Bacteria | 7504 |
| 639 | Ga0501044_0082740 | 3300049823 | Bacteria | 3247 |
| 640 | Ga0501044_0322634 | 3300049823 | Bacteria | 1468 |
| 641 | Ga0501044_0455351 | 3300049823 | Bacteria | 1185 |
| 642 | nmdc:mga00v17_63631_c1 | 3300050491 | Bacteria | 2272 |
| 643 | nmdc:mga00v17_6748_c1 | 3300050491 | Bacteria | 6099 |
| 644 | nmdc:mga05p37_545699_c1 | 3300050507 | Bacteria | 1321 |
| 645 | nmdc:mga06r32_86259_c1 | 3300050510 | Bacteria | 3061 |
| 646 | nmdc:mga0n895_75665_c1 | 3300050512 | Bacteria | 3347 |
| 647 | nmdc:mga0rr50_15964_c1 | 3300050513 | Bacteria | 4973 |
| 648 | nmdc:mga08x19_6305_c1 | 3300050514 | Bacteria | 7023 |
| 649 | Ga0495655_0004111 | 3300053083 | Bacteria | 2465 |
| 650 | Ga0500644_0082720 | 3300053088 | Bacteria | 1184 |
| 651 | Ga0500560_002972 | 3300053107 | Bacteria | 3347 |
| 652 | Ga0500573_0000031 | 3300053140 | Bacteria | 134098 |
| 653 | Ga0500573_0213382 | 3300053140 | Bacteria | 1017 |
| 654 | Ga0500634_0000098 | 3300053161 | Bacteria | 34065 |
| 655 | Ga0501084_0002400 | 3300054114 | Bacteria | 15070 |
| 656 | Ga0501084_0373777 | 3300054114 | Bacteria | 1204 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047443 | Ga0495687_002744 | Ga0495687_002744_4477_5142 | 208 |
| 2 | 3300053088 | Ga0500644_0082720 | Ga0500644_0082720_482_1147 | 208 |
| 3 | 3300009098 | Ga0105245_10181652 | Ga0105245_101816522 | 210 |
| 4 | 3300048911 | Ga0496108_0175385 | Ga0496108_0175385_925_1593 | 210 |
| 5 | 3300031665 | Ga0316575_10011793 | Ga0316575_100117932 | 213 |
| 6 | 3300031727 | Ga0316576_10038680 | Ga0316576_100386803 | 213 |
| 7 | 3300031728 | Ga0316578_10120001 | Ga0316578_101200012 | 213 |
| 8 | 3300032137 | Ga0316585_10080090 | Ga0316585_100800901 | 213 |
| 9 | 3300035398 | Ga0316574_0032437 | Ga0316574_0032437_1954_2715 | 213 |
| 10 | 3300005338 | Ga0068868_100423604 | Ga0068868_1004236042 | 214 |
| 11 | 3300031507 | Ga0307509_10025648 | Ga0307509_100256484 | 214 |
| 12 | 3300048911 | Ga0496108_0029297 | Ga0496108_0029297_3279_4043 | 214 |
| 13 | 3300048913 | Ga0496110_0011013 | Ga0496110_0011013_1620_2384 | 214 |
| 14 | 3300031731 | Ga0307405_10612877 | Ga0307405_106128771 | 215 |
| 15 | 3300032004 | Ga0307414_10293181 | Ga0307414_102931812 | 215 |
| 16 | 3300048912 | Ga0496109_0281058 | Ga0496109_0281058_338_1156 | 217 |
| 17 | 3300041413 | Ga0439465_0020201 | Ga0439465_0020201_28_780 | 218 |
| 18 | 3300005337 | Ga0070682_100196204 | Ga0070682_1001962042 | 219 |
| 19 | 3300005535 | Ga0070684_100602151 | Ga0070684_1006021512 | 219 |
| 20 | 3300009148 | Ga0105243_10569870 | Ga0105243_105698702 | 219 |
| 21 | 3300048917 | Ga0496114_0032805 | Ga0496114_0032805_15_779 | 219 |
| 22 | 3300048927 | Ga0496124_0000009 | Ga0496124_0000009_425523_426293 | 220 |
| 23 | 3300042876 | Ga0451577_0051922 | Ga0451577_0051922_1700_2467 | 221 |
| 24 | 3300041413 | Ga0439465_0000040 | Ga0439465_0000040_16767_17537 | 223 |
| 25 | 3300042007 | Ga0439449_0000134 | Ga0439449_0000134_3395_4165 | 223 |
| 26 | 3300048914 | Ga0496111_0284378 | Ga0496111_0284378_22_783 | 224 |
| 27 | 3300053140 | Ga0500573_0000031 | Ga0500573_0000031_90746_91456 | 224 |
| 28 | 3300005354 | Ga0070675_100283792 | Ga0070675_1002837921 | 225 |
| 29 | 3300005355 | Ga0070671_100081121 | Ga0070671_1000811213 | 225 |
| 30 | 3300005841 | Ga0068863_100252755 | Ga0068863_1002527552 | 225 |
| 31 | 3300012512 | Ga0157327_1004598 | Ga0157327_10045982 | 225 |
| 32 | 3300013308 | Ga0157375_10427572 | Ga0157375_104275721 | 225 |
| 33 | 3300014326 | Ga0157380_10883152 | Ga0157380_108831521 | 225 |
| 34 | 3300025940 | Ga0207691_10752285 | Ga0207691_107522851 | 225 |
| 35 | 3300046615 | Ga0495656_0003170 | Ga0495656_0003170_4709_5479 | 225 |
| 36 | 3300048911 | Ga0496108_0421658 | Ga0496108_0421658_201_971 | 225 |
| 37 | 3300048912 | Ga0496109_0224372 | Ga0496109_0224372_961_1731 | 225 |
| 38 | 3300048913 | Ga0496110_0131824 | Ga0496110_0131824_601_1371 | 225 |
| 39 | 3300048914 | Ga0496111_0018274 | Ga0496111_0018274_779_1549 | 225 |
| 40 | 3300048917 | Ga0496114_0135241 | Ga0496114_0135241_715_1485 | 225 |
| 41 | 3300048927 | Ga0496124_0159897 | Ga0496124_0159897_592_1362 | 225 |
| 42 | 3300049573 | Ga0501037_0047460 | Ga0501037_0047460_1432_2226 | 225 |
| 43 | 3300049823 | Ga0501044_0082740 | Ga0501044_0082740_375_1169 | 225 |
| 44 | 3300053140 | Ga0500573_0213382 | Ga0500573_0213382_72_827 | 225 |
| 45 | 3300005329 | Ga0070683_100183528 | Ga0070683_1001835283 | 226 |
| 46 | 3300037418 | Ga0395900_0120432 | Ga0395900_0120432_707_1501 | 226 |
| 47 | 3300037466 | Ga0395898_0319772 | Ga0395898_0319772_246_1040 | 226 |
| 48 | 3300038443 | Ga0395901_0336293 | Ga0395901_0336293_137_931 | 226 |
| 49 | 3300037466 | Ga0395898_0223338 | Ga0395898_0223338_833_1582 | 227 |
| 50 | 3300042131 | Ga0450894_010499 | Ga0450894_010499_123_893 | 230 |
| 51 | 3300013105 | Ga0157369_10012353 | Ga0157369_100123534 | 231 |
| 52 | 3300003203 | JGI25406J46586_10019261 | JGI25406J46586_100192613 | 232 |
| 53 | 3300005563 | Ga0068855_100376828 | Ga0068855_1003768282 | 232 |
| 54 | 3300005985 | Ga0081539_10001488 | Ga0081539_1000148840 | 232 |
| 55 | 3300031903 | Ga0307407_10019104 | Ga0307407_100191042 | 232 |
| 56 | 3300031911 | Ga0307412_10267703 | Ga0307412_102677031 | 232 |
| 57 | 3300031995 | Ga0307409_100427300 | Ga0307409_1004273002 | 232 |
| 58 | 3300041452 | Ga0451793_0611243 | Ga0451793_0611243_835_1569 | 232 |
| 59 | 3300005331 | Ga0070670_100197699 | Ga0070670_1001976992 | 233 |
| 60 | 3300011119 | Ga0105246_10201187 | Ga0105246_102011872 | 233 |
| 61 | 3300048905 | Ga0496102_0182007 | Ga0496102_0182007_816_1634 | 233 |
| 62 | 3300048906 | Ga0496103_0021998 | Ga0496103_0021998_2779_3597 | 233 |
| 63 | 3300049571 | Ga0501034_0558402 | Ga0501034_0558402_266_1036 | 233 |
| 64 | 3300045976 | Ga0466967_0876924 | Ga0466967_0876924_133_879 | 234 |
| 65 | 3300045836 | Ga0466958_0003576 | Ga0466958_0003576_1680_2441 | 235 |
| 66 | 3300049513 | Ga0501290_001797 | Ga0501290_001797_269_1054 | 235 |
| 67 | 3300032002 | Ga0307416_100143614 | Ga0307416_1001436141 | 236 |
| 68 | 3300048903 | Ga0496100_0153783 | Ga0496100_0153783_201_1055 | 236 |
| 69 | 3300048904 | Ga0496101_0140312 | Ga0496101_0140312_70_924 | 236 |
| 70 | 3300048906 | Ga0496103_0075902 | Ga0496103_0075902_573_1427 | 236 |
| 71 | iso_pu_bacteria | 2537561592 | 2537900606 | 236 |
| 72 | iso_pu_bacteria | 2571042365 | 2572253699 | 236 |
| 73 | iso_pu_bacteria | 2643221559 | 2643818882 | 236 |
| 74 | iso_pu_bacteria | 2643221573 | 2643878541 | 236 |
| 75 | iso_pu_bacteria | 2643221586 | 2643941458 | 236 |
| 76 | iso_pu_bacteria | 2643221612 | 2644080302 | 236 |
| 77 | iso_pu_bacteria | 2643221616 | 2644094962 | 236 |
| 78 | iso_pu_bacteria | 2643221632 | 2644181051 | 236 |
| 79 | iso_pu_bacteria | 2643221695 | 2644529005 | 236 |
| 80 | iso_pu_bacteria | 2643221720 | 2644659852 | 236 |
| 81 | iso_pu_bacteria | 2643221727 | 2644696916 | 236 |
| 82 | iso_pu_bacteria | 2643221728 | 2644700407 | 236 |
| 83 | iso_pu_bacteria | 2747842428 | 2747949482 | 236 |
| 84 | iso_pu_bacteria | 2747842501 | 2748019772 | 236 |
| 85 | iso_pu_bacteria | 2765235840 | 2765578886 | 236 |
| 86 | iso_pu_bacteria | 2816332141 | 2816516961 | 236 |
| 87 | iso_pu_bacteria | 2818991457 | 2819659670 | 236 |
| 88 | iso_pu_bacteria | 2842391507 | 2842393056 | 236 |
| 89 | iso_pu_bacteria | 2842780639 | 2842780903 | 236 |
| 90 | iso_pu_bacteria | 2852684882 | 2852685527 | 236 |
| 91 | iso_pu_bacteria | 2874220319 | 2874221538 | 236 |
| 92 | iso_pu_bacteria | 2884763398 | 2884764341 | 236 |
| 93 | iso_pu_bacteria | 2895498888 | 2895500763 | 236 |
| 94 | iso_pu_bacteria | 2895511927 | 2895516367 | 236 |
| 95 | iso_pu_bacteria | 2895522137 | 2895523714 | 236 |
| 96 | iso_pu_bacteria | 2895525241 | 2895526705 | 236 |
| 97 | iso_pu_bacteria | 2919089067 | 2919089795 | 236 |
| 98 | iso_pu_bacteria | 2919130084 | 2919131682 | 236 |
| 99 | iso_pu_bacteria | 2919134579 | 2919137733 | 236 |
| 100 | iso_pu_bacteria | 2919395869 | 2919398841 | 236 |
| 101 | iso_pu_bacteria | 2928496128 | 2928500255 | 236 |
| 102 | iso_pu_bacteria | 2929195423 | 2929197948 | 236 |
| 103 | iso_pu_bacteria | 2931380184 | 2931380838 | 236 |
| 104 | iso_pu_bacteria | 2937610967 | 2937612355 | 236 |
| 105 | iso_pu_bacteria | 2939626828 | 2939630902 | 236 |
| 106 | iso_pu_bacteria | 2941489479 | 2941492950 | 236 |
| 107 | iso_pu_bacteria | 2961047084 | 2961048305 | 236 |
| 108 | iso_pu_bacteria | 2961064222 | 2961065302 | 236 |
| 109 | iso_pu_bacteria | 2995948881 | 2995952269 | 236 |
| 110 | iso_pu_bacteria | 8021622325 | 8021624258 | 236 |
| 111 | iso_pu_bacteria | 8021648035 | 8021649093 | 236 |
| 112 | 3300031901 | Ga0307406_10394798 | Ga0307406_103947981 | 237 |
| 113 | iso_pu_bacteria | 2868088558 | 2868093791 | 237 |
| 114 | iso_pu_bacteria | 2883821847 | 2883822344 | 237 |
| 115 | iso_pu_bacteria | 2919051321 | 2919053750 | 237 |
| 116 | 3300003659 | JGI25404J52841_10003860 | JGI25404J52841_100038602 | 238 |
| 117 | 3300005983 | Ga0081540_1010321 | Ga0081540_10103217 | 238 |
| 118 | 3300005983 | Ga0081540_1021999 | Ga0081540_10219994 | 238 |
| 119 | 3300009553 | Ga0105249_10522775 | Ga0105249_105227752 | 238 |
| 120 | 3300031456 | Ga0307513_10019869 | Ga0307513_100198697 | 238 |
| 121 | 3300031727 | Ga0316576_10040342 | Ga0316576_100403422 | 238 |
| 122 | 3300031727 | Ga0316576_10327650 | Ga0316576_103276502 | 238 |
| 123 | 3300035398 | Ga0316574_0006917 | Ga0316574_0006917_1188_1949 | 238 |
| 124 | 3300035398 | Ga0316574_0044941 | Ga0316574_0044941_983_1744 | 238 |
| 125 | 3300035398 | Ga0316574_0048231 | Ga0316574_0048231_1205_1966 | 238 |
| 126 | 3300035398 | Ga0316574_0170441 | Ga0316574_0170441_631_1392 | 238 |
| 127 | 3300035398 | Ga0316574_0286349 | Ga0316574_0286349_22_783 | 238 |
| 128 | 3300046475 | Ga0495639_0027634 | Ga0495639_0027634_548_1309 | 238 |
| 129 | 3300048903 | Ga0496100_0150221 | Ga0496100_0150221_149_970 | 238 |
| 130 | 3300048909 | Ga0496106_0014269 | Ga0496106_0014269_1934_2788 | 238 |
| 131 | 3300048910 | Ga0496107_0071071 | Ga0496107_0071071_667_1521 | 238 |
| 132 | 3300048913 | Ga0496110_0617577 | Ga0496110_0617577_55_909 | 238 |
| 133 | 3300048914 | Ga0496111_0053672 | Ga0496111_0053672_2017_2871 | 238 |
| 134 | 3300049578 | Ga0501042_0068334 | Ga0501042_0068334_753_1535 | 238 |
| 135 | 3300049583 | Ga0501067_0146578 | Ga0501067_0146578_352_1113 | 238 |
| 136 | 3300005328 | Ga0070676_10034053 | Ga0070676_100340533 | 239 |
| 137 | 3300005331 | Ga0070670_100064788 | Ga0070670_1000647883 | 239 |
| 138 | 3300005353 | Ga0070669_100014843 | Ga0070669_1000148432 | 239 |
| 139 | 3300005354 | Ga0070675_100031498 | Ga0070675_1000314982 | 239 |
| 140 | 3300005355 | Ga0070671_100006111 | Ga0070671_1000061115 | 239 |
| 141 | 3300005356 | Ga0070674_100069872 | Ga0070674_1000698722 | 239 |
| 142 | 3300005364 | Ga0070673_100019569 | Ga0070673_1000195696 | 239 |
| 143 | 3300005456 | Ga0070678_100034742 | Ga0070678_1000347422 | 239 |
| 144 | 3300005543 | Ga0070672_100536790 | Ga0070672_1005367901 | 239 |
| 145 | 3300009011 | Ga0105251_10005393 | Ga0105251_100053938 | 239 |
| 146 | 3300009148 | Ga0105243_10671502 | Ga0105243_106715021 | 239 |
| 147 | 3300009177 | Ga0105248_10060903 | Ga0105248_100609032 | 239 |
| 148 | 3300011119 | Ga0105246_10228581 | Ga0105246_102285812 | 239 |
| 149 | 3300013102 | Ga0157371_10079159 | Ga0157371_100791592 | 239 |
| 150 | 3300025901 | Ga0207688_10096039 | Ga0207688_100960392 | 239 |
| 151 | 3300025903 | Ga0207680_10039388 | Ga0207680_100393881 | 239 |
| 152 | 3300025925 | Ga0207650_10003161 | Ga0207650_100031618 | 239 |
| 153 | 3300025935 | Ga0207709_10184352 | Ga0207709_101843522 | 239 |
| 154 | 3300025940 | Ga0207691_10002149 | Ga0207691_1000214911 | 239 |
| 155 | 3300025960 | Ga0207651_10072652 | Ga0207651_100726523 | 239 |
| 156 | 3300026121 | Ga0207683_10008663 | Ga0207683_100086633 | 239 |
| 157 | 3300031548 | Ga0307408_100298891 | Ga0307408_1002988911 | 239 |
| 158 | 3300031901 | Ga0307406_10445594 | Ga0307406_104455942 | 239 |
| 159 | 3300032002 | Ga0307416_100262868 | Ga0307416_1002628682 | 239 |
| 160 | 3300046522 | Ga0495643_0086752 | Ga0495643_0086752_47_868 | 239 |
| 161 | 3300046557 | Ga0495622_0126754 | Ga0495622_0126754_198_1019 | 239 |
| 162 | 3300046616 | Ga0495668_0101920 | Ga0495668_0101920_196_1017 | 239 |
| 163 | 3300047315 | Ga0495581_0122996 | Ga0495581_0122996_306_1127 | 239 |
| 164 | 3300048904 | Ga0496101_0316272 | Ga0496101_0316272_145_966 | 239 |
| 165 | 3300048905 | Ga0496102_0215983 | Ga0496102_0215983_664_1485 | 239 |
| 166 | 3300048909 | Ga0496106_0155166 | Ga0496106_0155166_664_1485 | 239 |
| 167 | 3300048912 | Ga0496109_0095228 | Ga0496109_0095228_1395_2249 | 239 |
| 168 | 3300048916 | Ga0496113_0088467 | Ga0496113_0088467_149_970 | 239 |
| 169 | 3300048917 | Ga0496114_0198065 | Ga0496114_0198065_920_1741 | 239 |
| 170 | 3300048927 | Ga0496124_0436455 | Ga0496124_0436455_47_868 | 239 |
| 171 | 3300048928 | Ga0496125_0019360 | Ga0496125_0019360_3277_4098 | 239 |
| 172 | iso_pu_bacteria | 2808606700 | 2810363021 | 239 |
| 173 | iso_pu_bacteria | 2905926851 | 2905930732 | 239 |
| 174 | iso_pu_bacteria | 2946003308 | 2946006860 | 239 |
| 175 | 3300002067 | JGI24735J21928_10078630 | JGI24735J21928_100786301 | 240 |
| 176 | 3300002737 | JGI25162J39368_1010474 | JGI25162J39368_10104742 | 240 |
| 177 | 3300002772 | JGI25164J39214_1000399 | JGI25164J39214_100039917 | 240 |
| 178 | 3300003187 | JGI25151J46595_10000059 | JGI25151J46595_100000596 | 240 |
| 179 | 3300003203 | JGI25406J46586_10033712 | JGI25406J46586_100337122 | 240 |
| 180 | 3300003214 | JGI25165J46597_1000148 | JGI25165J46597_1000148117 | 240 |
| 181 | 3300003752 | Ga0055539_1000103 | Ga0055539_100010316 | 240 |
| 182 | 3300003756 | Ga0055533_1000020 | Ga0055533_1000020262 | 240 |
| 183 | 3300003759 | Ga0055525_1000312 | Ga0055525_100031217 | 240 |
| 184 | 3300003771 | Ga0055526_1000617 | Ga0055526_10006171 | 240 |
| 185 | 3300003773 | Ga0055537_1000450 | Ga0055537_100045034 | 240 |
| 186 | 3300003775 | Ga0055524_1000568 | Ga0055524_100056833 | 240 |
| 187 | 3300003781 | Ga0055536_1003611 | Ga0055536_10036117 | 240 |
| 188 | 3300003784 | Ga0055534_1000385 | Ga0055534_100038533 | 240 |
| 189 | 3300003790 | Ga0055528_1000580 | Ga0055528_100058033 | 240 |
| 190 | 3300003794 | Ga0055531_10022879 | Ga0055531_100228792 | 240 |
| 191 | 3300003841 | Ga0055541_1005026 | Ga0055541_10050262 | 240 |
| 192 | 3300003856 | Ga0058692_1000031 | Ga0058692_1000031124 | 240 |
| 193 | 3300003856 | Ga0058692_1000060 | Ga0058692_100006043 | 240 |
| 194 | 3300005288 | Ga0065714_10016134 | Ga0065714_100161342 | 240 |
| 195 | 3300005289 | Ga0065704_10070531 | Ga0065704_100705312 | 240 |
| 196 | 3300005293 | Ga0065715_10001250 | Ga0065715_100012507 | 240 |
| 197 | 3300005327 | Ga0070658_10291421 | Ga0070658_102914212 | 240 |
| 198 | 3300005328 | Ga0070676_10137939 | Ga0070676_101379391 | 240 |
| 199 | 3300005331 | Ga0070670_100029702 | Ga0070670_1000297022 | 240 |
| 200 | 3300005334 | Ga0068869_100013607 | Ga0068869_1000136072 | 240 |
| 201 | 3300005335 | Ga0070666_10059807 | Ga0070666_100598073 | 240 |
| 202 | 3300005336 | Ga0070680_100134724 | Ga0070680_1001347243 | 240 |
| 203 | 3300005336 | Ga0070680_100341851 | Ga0070680_1003418512 | 240 |
| 204 | 3300005337 | Ga0070682_100001726 | Ga0070682_1000017266 | 240 |
| 205 | 3300005338 | Ga0068868_100031924 | Ga0068868_1000319243 | 240 |
| 206 | 3300005339 | Ga0070660_100133048 | Ga0070660_1001330482 | 240 |
| 207 | 3300005340 | Ga0070689_100337940 | Ga0070689_1003379402 | 240 |
| 208 | 3300005343 | Ga0070687_100011905 | Ga0070687_1000119053 | 240 |
| 209 | 3300005344 | Ga0070661_100667782 | Ga0070661_1006677821 | 240 |
| 210 | 3300005353 | Ga0070669_100031578 | Ga0070669_1000315781 | 240 |
| 211 | 3300005353 | Ga0070669_100336529 | Ga0070669_1003365292 | 240 |
| 212 | 3300005354 | Ga0070675_100031963 | Ga0070675_1000319632 | 240 |
| 213 | 3300005355 | Ga0070671_100039581 | Ga0070671_1000395812 | 240 |
| 214 | 3300005355 | Ga0070671_100132600 | Ga0070671_1001326002 | 240 |
| 215 | 3300005364 | Ga0070673_100194811 | Ga0070673_1001948112 | 240 |
| 216 | 3300005366 | Ga0070659_100099320 | Ga0070659_1000993202 | 240 |
| 217 | 3300005367 | Ga0070667_100731224 | Ga0070667_1007312241 | 240 |
| 218 | 3300005434 | Ga0070709_10069210 | Ga0070709_100692102 | 240 |
| 219 | 3300005436 | Ga0070713_100001424 | Ga0070713_10000142412 | 240 |
| 220 | 3300005438 | Ga0070701_10007294 | Ga0070701_100072945 | 240 |
| 221 | 3300005456 | Ga0070678_100033250 | Ga0070678_1000332502 | 240 |
| 222 | 3300005458 | Ga0070681_10121318 | Ga0070681_101213182 | 240 |
| 223 | 3300005458 | Ga0070681_10138837 | Ga0070681_101388372 | 240 |
| 224 | 3300005458 | Ga0070681_10168667 | Ga0070681_101686673 | 240 |
| 225 | 3300005530 | Ga0070679_100089383 | Ga0070679_1000893832 | 240 |
| 226 | 3300005530 | Ga0070679_100476289 | Ga0070679_1004762892 | 240 |
| 227 | 3300005530 | Ga0070679_100713618 | Ga0070679_1007136181 | 240 |
| 228 | 3300005543 | Ga0070672_100159620 | Ga0070672_1001596202 | 240 |
| 229 | 3300005547 | Ga0070693_100004599 | Ga0070693_1000045996 | 240 |
| 230 | 3300005548 | Ga0070665_100406961 | Ga0070665_1004069612 | 240 |
| 231 | 3300005563 | Ga0068855_100138824 | Ga0068855_1001388242 | 240 |
| 232 | 3300005564 | Ga0070664_100152562 | Ga0070664_1001525623 | 240 |
| 233 | 3300005578 | Ga0068854_100025286 | Ga0068854_1000252864 | 240 |
| 234 | 3300005615 | Ga0070702_100000212 | Ga0070702_1000002122 | 240 |
| 235 | 3300005616 | Ga0068852_100134527 | Ga0068852_1001345272 | 240 |
| 236 | 3300005616 | Ga0068852_100282821 | Ga0068852_1002828213 | 240 |
| 237 | 3300005617 | Ga0068859_100140908 | Ga0068859_1001409082 | 240 |
| 238 | 3300005618 | Ga0068864_100088914 | Ga0068864_1000889142 | 240 |
| 239 | 3300005834 | Ga0068851_10017690 | Ga0068851_100176903 | 240 |
| 240 | 3300005840 | Ga0068870_10000198 | Ga0068870_100001984 | 240 |
| 241 | 3300005841 | Ga0068863_100035364 | Ga0068863_1000353643 | 240 |
| 242 | 3300005841 | Ga0068863_100109289 | Ga0068863_1001092893 | 240 |
| 243 | 3300005842 | Ga0068858_100041877 | Ga0068858_1000418774 | 240 |
| 244 | 3300005983 | Ga0081540_1027543 | Ga0081540_10275431 | 240 |
| 245 | 3300005985 | Ga0081539_10003292 | Ga0081539_1000329216 | 240 |
| 246 | 3300006051 | Ga0075364_10000075 | Ga0075364_1000007529 | 240 |
| 247 | 3300006051 | Ga0075364_10014729 | Ga0075364_100147298 | 240 |
| 248 | 3300006175 | Ga0070712_100052353 | Ga0070712_1000523532 | 240 |
| 249 | 3300006186 | Ga0075369_10056644 | Ga0075369_100566442 | 240 |
| 250 | 3300006358 | Ga0068871_100002932 | Ga0068871_10000293213 | 240 |
| 251 | 3300006844 | Ga0075428_100141407 | Ga0075428_1001414071 | 240 |
| 252 | 3300006846 | Ga0075430_100170040 | Ga0075430_1001700402 | 240 |
| 253 | 3300006871 | Ga0075434_100020271 | Ga0075434_1000202713 | 240 |
| 254 | 3300006914 | Ga0075436_100005883 | Ga0075436_1000058838 | 240 |
| 255 | 3300006931 | Ga0097620_100140916 | Ga0097620_1001409162 | 240 |
| 256 | 3300007076 | Ga0075435_100002423 | Ga0075435_1000024238 | 240 |
| 257 | 3300009011 | Ga0105251_10069511 | Ga0105251_100695112 | 240 |
| 258 | 3300009093 | Ga0105240_10152849 | Ga0105240_101528493 | 240 |
| 259 | 3300009093 | Ga0105240_10208895 | Ga0105240_102088952 | 240 |
| 260 | 3300009094 | Ga0111539_10007824 | Ga0111539_1000782416 | 240 |
| 261 | 3300009098 | Ga0105245_10068211 | Ga0105245_100682112 | 240 |
| 262 | 3300009098 | Ga0105245_10467159 | Ga0105245_104671592 | 240 |
| 263 | 3300009101 | Ga0105247_10062869 | Ga0105247_100628693 | 240 |
| 264 | 3300009101 | Ga0105247_10293305 | Ga0105247_102933051 | 240 |
| 265 | 3300009147 | Ga0114129_10169938 | Ga0114129_101699382 | 240 |
| 266 | 3300009148 | Ga0105243_10012792 | Ga0105243_100127927 | 240 |
| 267 | 3300009148 | Ga0105243_10385471 | Ga0105243_103854711 | 240 |
| 268 | 3300009174 | Ga0105241_10093692 | Ga0105241_100936922 | 240 |
| 269 | 3300009177 | Ga0105248_10202027 | Ga0105248_102020273 | 240 |
| 270 | 3300009545 | Ga0105237_10080772 | Ga0105237_100807722 | 240 |
| 271 | 3300009551 | Ga0105238_10007400 | Ga0105238_100074002 | 240 |
| 272 | 3300010375 | Ga0105239_10104594 | Ga0105239_101045944 | 240 |
| 273 | 3300011119 | Ga0105246_10037618 | Ga0105246_100376182 | 240 |
| 274 | 3300013100 | Ga0157373_10091699 | Ga0157373_100916993 | 240 |
| 275 | 3300013100 | Ga0157373_10127794 | Ga0157373_101277942 | 240 |
| 276 | 3300013102 | Ga0157371_10006531 | Ga0157371_1000653110 | 240 |
| 277 | 3300013102 | Ga0157371_10117872 | Ga0157371_101178722 | 240 |
| 278 | 3300013102 | Ga0157371_10410365 | Ga0157371_104103651 | 240 |
| 279 | 3300013104 | Ga0157370_10112173 | Ga0157370_101121733 | 240 |
| 280 | 3300013104 | Ga0157370_10249793 | Ga0157370_102497932 | 240 |
| 281 | 3300013105 | Ga0157369_10042335 | Ga0157369_100423354 | 240 |
| 282 | 3300013105 | Ga0157369_10093022 | Ga0157369_100930222 | 240 |
| 283 | 3300013105 | Ga0157369_10472479 | Ga0157369_104724791 | 240 |
| 284 | 3300013296 | Ga0157374_10034297 | Ga0157374_100342973 | 240 |
| 285 | 3300013307 | Ga0157372_10182398 | Ga0157372_101823983 | 240 |
| 286 | 3300013307 | Ga0157372_10310262 | Ga0157372_103102622 | 240 |
| 287 | 3300013307 | Ga0157372_10545996 | Ga0157372_105459962 | 240 |
| 288 | 3300014325 | Ga0163163_10056369 | Ga0163163_100563693 | 240 |
| 289 | 3300014325 | Ga0163163_10732460 | Ga0163163_107324602 | 240 |
| 290 | 3300014326 | Ga0157380_10200341 | Ga0157380_102003411 | 240 |
| 291 | 3300014745 | Ga0157377_10108172 | Ga0157377_101081722 | 240 |
| 292 | 3300014968 | Ga0157379_10099465 | Ga0157379_100994652 | 240 |
| 293 | 3300014969 | Ga0157376_10082183 | Ga0157376_100821832 | 240 |
| 294 | 3300015261 | Ga0182006_1052226 | Ga0182006_10522261 | 240 |
| 295 | 3300015265 | Ga0182005_1011353 | Ga0182005_10113532 | 240 |
| 296 | 3300020069 | Ga0197907_10025204 | Ga0197907_100252042 | 240 |
| 297 | 3300020069 | Ga0197907_10275978 | Ga0197907_102759783 | 240 |
| 298 | 3300020070 | Ga0206356_10524634 | Ga0206356_105246342 | 240 |
| 299 | 3300020080 | Ga0206350_11092398 | Ga0206350_110923982 | 240 |
| 300 | 3300020081 | Ga0206354_11559491 | Ga0206354_115594913 | 240 |
| 301 | 3300020082 | Ga0206353_10091682 | Ga0206353_100916822 | 240 |
| 302 | 3300020082 | Ga0206353_11305176 | Ga0206353_113051764 | 240 |
| 303 | 3300025225 | Ga0209566_100043 | Ga0209566_100043173 | 240 |
| 304 | 3300025226 | Ga0209674_100001 | Ga0209674_1000013637 | 240 |
| 305 | 3300025230 | Ga0209563_100001 | Ga0209563_1000013637 | 240 |
| 306 | 3300025230 | Ga0209563_100183 | Ga0209563_10018318 | 240 |
| 307 | 3300025231 | Ga0207427_100407 | Ga0207427_10040717 | 240 |
| 308 | 3300025233 | Ga0209437_100315 | Ga0209437_10031554 | 240 |
| 309 | 3300025245 | Ga0207425_1005261 | Ga0207425_10052614 | 240 |
| 310 | 3300025253 | Ga0209677_100001 | Ga0209677_1000013637 | 240 |
| 311 | 3300025253 | Ga0209677_100407 | Ga0209677_10040712 | 240 |
| 312 | 3300025261 | Ga0209233_1000014 | Ga0209233_1000014242 | 240 |
| 313 | 3300025263 | Ga0209565_1000005 | Ga0209565_1000005162 | 240 |
| 314 | 3300025273 | Ga0209673_1000027 | Ga0209673_1000027163 | 240 |
| 315 | 3300025291 | Ga0209675_1000004 | Ga0209675_1000004162 | 240 |
| 316 | 3300025292 | Ga0209676_1000068 | Ga0209676_1000068161 | 240 |
| 317 | 3300025294 | Ga0209025_1000005 | Ga0209025_1000005213 | 240 |
| 318 | 3300025295 | Ga0209564_1000050 | Ga0209564_1000050163 | 240 |
| 319 | 3300025297 | Ga0209758_1004731 | Ga0209758_10047315 | 240 |
| 320 | 3300025298 | Ga0209050_1006127 | Ga0209050_10061274 | 240 |
| 321 | 3300025299 | Ga0209256_1000031 | Ga0209256_1000031163 | 240 |
| 322 | 3300025304 | Ga0209257_1000645 | Ga0209257_100064510 | 240 |
| 323 | 3300025321 | Ga0207656_10163503 | Ga0207656_101635031 | 240 |
| 324 | 3300025900 | Ga0207710_10013970 | Ga0207710_100139702 | 240 |
| 325 | 3300025901 | Ga0207688_10031636 | Ga0207688_100316362 | 240 |
| 326 | 3300025903 | Ga0207680_10068500 | Ga0207680_100685002 | 240 |
| 327 | 3300025907 | Ga0207645_10023729 | Ga0207645_100237293 | 240 |
| 328 | 3300025908 | Ga0207643_10000202 | Ga0207643_100002025 | 240 |
| 329 | 3300025909 | Ga0207705_10010432 | Ga0207705_100104322 | 240 |
| 330 | 3300025909 | Ga0207705_10102236 | Ga0207705_101022362 | 240 |
| 331 | 3300025909 | Ga0207705_10229616 | Ga0207705_102296162 | 240 |
| 332 | 3300025912 | Ga0207707_10072709 | Ga0207707_100727092 | 240 |
| 333 | 3300025913 | Ga0207695_10045863 | Ga0207695_100458635 | 240 |
| 334 | 3300025913 | Ga0207695_10124286 | Ga0207695_101242861 | 240 |
| 335 | 3300025915 | Ga0207693_10212410 | Ga0207693_102124102 | 240 |
| 336 | 3300025917 | Ga0207660_10393572 | Ga0207660_103935721 | 240 |
| 337 | 3300025919 | Ga0207657_10011873 | Ga0207657_100118737 | 240 |
| 338 | 3300025919 | Ga0207657_10035234 | Ga0207657_100352343 | 240 |
| 339 | 3300025923 | Ga0207681_10033056 | Ga0207681_100330564 | 240 |
| 340 | 3300025924 | Ga0207694_10100706 | Ga0207694_101007062 | 240 |
| 341 | 3300025928 | Ga0207700_10031192 | Ga0207700_100311921 | 240 |
| 342 | 3300025929 | Ga0207664_10024041 | Ga0207664_100240414 | 240 |
| 343 | 3300025931 | Ga0207644_10041703 | Ga0207644_100417033 | 240 |
| 344 | 3300025932 | Ga0207690_10038933 | Ga0207690_100389334 | 240 |
| 345 | 3300025933 | Ga0207706_10421784 | Ga0207706_104217842 | 240 |
| 346 | 3300025935 | Ga0207709_10000632 | Ga0207709_100006326 | 240 |
| 347 | 3300025935 | Ga0207709_10595464 | Ga0207709_105954641 | 240 |
| 348 | 3300025936 | Ga0207670_10321697 | Ga0207670_103216972 | 240 |
| 349 | 3300025940 | Ga0207691_10009924 | Ga0207691_1000992410 | 240 |
| 350 | 3300025942 | Ga0207689_10004258 | Ga0207689_100042587 | 240 |
| 351 | 3300025944 | Ga0207661_10005333 | Ga0207661_100053338 | 240 |
| 352 | 3300025944 | Ga0207661_10309604 | Ga0207661_103096042 | 240 |
| 353 | 3300025945 | Ga0207679_10008214 | Ga0207679_100082144 | 240 |
| 354 | 3300025945 | Ga0207679_10349168 | Ga0207679_103491682 | 240 |
| 355 | 3300025949 | Ga0207667_10694481 | Ga0207667_106944812 | 240 |
| 356 | 3300025960 | Ga0207651_10026046 | Ga0207651_100260462 | 240 |
| 357 | 3300025981 | Ga0207640_10318566 | Ga0207640_103185661 | 240 |
| 358 | 3300026023 | Ga0207677_10006429 | Ga0207677_100064296 | 240 |
| 359 | 3300026035 | Ga0207703_10074827 | Ga0207703_100748272 | 240 |
| 360 | 3300026067 | Ga0207678_10001765 | Ga0207678_1000176514 | 240 |
| 361 | 3300026075 | Ga0207708_10038908 | Ga0207708_100389082 | 240 |
| 362 | 3300026078 | Ga0207702_10001104 | Ga0207702_1000110418 | 240 |
| 363 | 3300026078 | Ga0207702_10007880 | Ga0207702_100078806 | 240 |
| 364 | 3300026088 | Ga0207641_10029111 | Ga0207641_100291113 | 240 |
| 365 | 3300026088 | Ga0207641_10218608 | Ga0207641_102186082 | 240 |
| 366 | 3300026095 | Ga0207676_10001801 | Ga0207676_1000180115 | 240 |
| 367 | 3300026116 | Ga0207674_10065152 | Ga0207674_100651523 | 240 |
| 368 | 3300026121 | Ga0207683_10028397 | Ga0207683_100283974 | 240 |
| 369 | 3300027312 | Ga0209371_1000004 | Ga0209371_100000454 | 240 |
| 370 | 3300027312 | Ga0209371_1000139 | Ga0209371_100013943 | 240 |
| 371 | 3300027360 | Ga0209969_1011375 | Ga0209969_10113751 | 240 |
| 372 | 3300027364 | Ga0209967_1023242 | Ga0209967_10232421 | 240 |
| 373 | 3300027424 | Ga0209984_1021647 | Ga0209984_10216471 | 240 |
| 374 | 3300027665 | Ga0209983_1007204 | Ga0209983_10072042 | 240 |
| 375 | 3300027876 | Ga0209974_10010966 | Ga0209974_100109663 | 240 |
| 376 | 3300028379 | Ga0268266_10037476 | Ga0268266_100374765 | 240 |
| 377 | 3300028379 | Ga0268266_10084548 | Ga0268266_100845482 | 240 |
| 378 | 3300028786 | Ga0307517_10025256 | Ga0307517_100252565 | 240 |
| 379 | 3300028794 | Ga0307515_10000050 | Ga0307515_10000050125 | 240 |
| 380 | 3300030500 | Ga0268256_1000005 | Ga0268256_1000005991 | 240 |
| 381 | 3300030500 | Ga0268256_1000109 | Ga0268256_100010959 | 240 |
| 382 | 3300030521 | Ga0307511_10002943 | Ga0307511_100029436 | 240 |
| 383 | 3300030522 | Ga0307512_10092674 | Ga0307512_100926741 | 240 |
| 384 | 3300031507 | Ga0307509_10003130 | Ga0307509_1000313012 | 240 |
| 385 | 3300031507 | Ga0307509_10011263 | Ga0307509_100112634 | 240 |
| 386 | 3300031507 | Ga0307509_10022296 | Ga0307509_100222962 | 240 |
| 387 | 3300031548 | Ga0307408_100010694 | Ga0307408_1000106943 | 240 |
| 388 | 3300031548 | Ga0307408_100028576 | Ga0307408_1000285762 | 240 |
| 389 | 3300031616 | Ga0307508_10204463 | Ga0307508_102044632 | 240 |
| 390 | 3300031649 | Ga0307514_10173113 | Ga0307514_101731132 | 240 |
| 391 | 3300031727 | Ga0316576_10072333 | Ga0316576_100723333 | 240 |
| 392 | 3300031730 | Ga0307516_10004353 | Ga0307516_1000435313 | 240 |
| 393 | 3300031731 | Ga0307405_10395812 | Ga0307405_103958122 | 240 |
| 394 | 3300031824 | Ga0307413_10001980 | Ga0307413_100019804 | 240 |
| 395 | 3300031824 | Ga0307413_10163763 | Ga0307413_101637631 | 240 |
| 396 | 3300031824 | Ga0307413_10574935 | Ga0307413_105749351 | 240 |
| 397 | 3300031852 | Ga0307410_10134472 | Ga0307410_101344722 | 240 |
| 398 | 3300031901 | Ga0307406_10092869 | Ga0307406_100928693 | 240 |
| 399 | 3300031911 | Ga0307412_10002168 | Ga0307412_1000216812 | 240 |
| 400 | 3300031911 | Ga0307412_10035423 | Ga0307412_100354233 | 240 |
| 401 | 3300031911 | Ga0307412_10065910 | Ga0307412_100659103 | 240 |
| 402 | 3300031995 | Ga0307409_100063441 | Ga0307409_1000634413 | 240 |
| 403 | 3300031995 | Ga0307409_100105038 | Ga0307409_1001050382 | 240 |
| 404 | 3300032002 | Ga0307416_100110407 | Ga0307416_1001104072 | 240 |
| 405 | 3300032004 | Ga0307414_10049127 | Ga0307414_100491273 | 240 |
| 406 | 3300032004 | Ga0307414_10305827 | Ga0307414_103058272 | 240 |
| 407 | 3300032004 | Ga0307414_10502267 | Ga0307414_105022672 | 240 |
| 408 | 3300032126 | Ga0307415_100079701 | Ga0307415_1000797011 | 240 |
| 409 | 3300033180 | Ga0307510_10005740 | Ga0307510_100057408 | 240 |
| 410 | 3300033180 | Ga0307510_10249959 | Ga0307510_102499592 | 240 |
| 411 | 3300037312 | Ga0395899_0040126 | Ga0395899_0040126_1110_1904 | 240 |
| 412 | 3300037312 | Ga0395899_0109651 | Ga0395899_0109651_66_833 | 240 |
| 413 | 3300037312 | Ga0395899_0125320 | Ga0395899_0125320_1011_1778 | 240 |
| 414 | 3300037312 | Ga0395899_0152367 | Ga0395899_0152367_564_1331 | 240 |
| 415 | 3300037418 | Ga0395900_0022120 | Ga0395900_0022120_4920_5690 | 240 |
| 416 | 3300037418 | Ga0395900_0122009 | Ga0395900_0122009_225_992 | 240 |
| 417 | 3300037418 | Ga0395900_0325828 | Ga0395900_0325828_444_1214 | 240 |
| 418 | 3300037466 | Ga0395898_0015445 | Ga0395898_0015445_3507_4274 | 240 |
| 419 | 3300037466 | Ga0395898_0073111 | Ga0395898_0073111_1077_1844 | 240 |
| 420 | 3300037466 | Ga0395898_0083391 | Ga0395898_0083391_1186_1956 | 240 |
| 421 | 3300037466 | Ga0395898_0361270 | Ga0395898_0361270_393_1160 | 240 |
| 422 | 3300037466 | Ga0395898_0405738 | Ga0395898_0405738_88_849 | 240 |
| 423 | 3300037471 | Ga0395905_0008483 | Ga0395905_0008483_340_1110 | 240 |
| 424 | 3300037471 | Ga0395905_0468542 | Ga0395905_0468542_49_819 | 240 |
| 425 | 3300038443 | Ga0395901_0012060 | Ga0395901_0012060_7785_8552 | 240 |
| 426 | 3300038443 | Ga0395901_0061266 | Ga0395901_0061266_49_819 | 240 |
| 427 | 3300038443 | Ga0395901_0316219 | Ga0395901_0316219_694_1461 | 240 |
| 428 | 3300038443 | Ga0395901_0461056 | Ga0395901_0461056_307_1074 | 240 |
| 429 | 3300038705 | Ga0237819_05553 | Ga0237819_05553_777_1547 | 240 |
| 430 | 3300041406 | Ga0439439_0037080 | Ga0439439_0037080_61_831 | 240 |
| 431 | 3300041451 | Ga0451791_1883876 | Ga0451791_1883876_274_1035 | 240 |
| 432 | 3300041452 | Ga0451793_0432375 | Ga0451793_0432375_2573_3343 | 240 |
| 433 | 3300041459 | Ga0451800_1224437 | Ga0451800_1224437_1875_2645 | 240 |
| 434 | 3300041462 | Ga0451806_620901 | Ga0451806_620901_961_1731 | 240 |
| 435 | 3300041486 | Ga0451807_1378455 | Ga0451807_1378455_381_1151 | 240 |
| 436 | 3300041509 | Ga0451843_1504794 | Ga0451843_1504794_412_1173 | 240 |
| 437 | 3300041512 | Ga0451853_0174512 | Ga0451853_0174512_44_814 | 240 |
| 438 | 3300042006 | Ga0439432_005823 | Ga0439432_005823_1276_2046 | 240 |
| 439 | 3300042007 | Ga0439449_0008474 | Ga0439449_0008474_1714_2484 | 240 |
| 440 | 3300042007 | Ga0439449_0042385 | Ga0439449_0042385_412_1182 | 240 |
| 441 | 3300042016 | Ga0439463_013653 | Ga0439463_013653_574_1338 | 240 |
| 442 | 3300042157 | Ga0439458_0039149 | Ga0439458_0039149_299_1063 | 240 |
| 443 | 3300044658 | Ga0466972_0080846 | Ga0466972_0080846_231_992 | 240 |
| 444 | 3300044683 | Ga0466965_0276357 | Ga0466965_0276357_32_808 | 240 |
| 445 | 3300044684 | Ga0466966_0010237 | Ga0466966_0010237_1361_2122 | 240 |
| 446 | 3300044735 | Ga0466968_0022494 | Ga0466968_0022494_1505_2266 | 240 |
| 447 | 3300044765 | Ga0466970_0026478 | Ga0466970_0026478_373_1134 | 240 |
| 448 | 3300044765 | Ga0466970_0289341 | Ga0466970_0289341_96_857 | 240 |
| 449 | 3300044842 | Ga0466957_0085023 | Ga0466957_0085023_1184_1945 | 240 |
| 450 | 3300045049 | Ga0466959_0026949 | Ga0466959_0026949_41_802 | 240 |
| 451 | 3300046459 | Ga0495629_0015808 | Ga0495629_0015808_3085_3846 | 240 |
| 452 | 3300046499 | Ga0495594_0019951 | Ga0495594_0019951_2698_3477 | 240 |
| 453 | 3300046501 | Ga0495607_0037418 | Ga0495607_0037418_1645_2415 | 240 |
| 454 | 3300046507 | Ga0495606_0012571 | Ga0495606_0012571_785_1555 | 240 |
| 455 | 3300046518 | Ga0495631_0116539 | Ga0495631_0116539_18_788 | 240 |
| 456 | 3300046539 | Ga0495621_0001151 | Ga0495621_0001151_2267_3037 | 240 |
| 457 | 3300046558 | Ga0495633_0005962 | Ga0495633_0005962_4084_4854 | 240 |
| 458 | 3300046615 | Ga0495656_0033620 | Ga0495656_0033620_1166_1936 | 240 |
| 459 | 3300046615 | Ga0495656_0049409 | Ga0495656_0049409_149_919 | 240 |
| 460 | 3300046615 | Ga0495656_0056328 | Ga0495656_0056328_231_1001 | 240 |
| 461 | 3300046616 | Ga0495668_0000820 | Ga0495668_0000820_13222_13992 | 240 |
| 462 | 3300046660 | Ga0495625_0002120 | Ga0495625_0002120_19701_20462 | 240 |
| 463 | 3300046674 | Ga0495588_0009628 | Ga0495588_0009628_3227_3988 | 240 |
| 464 | 3300046692 | Ga0495671_0019486 | Ga0495671_0019486_1825_2586 | 240 |
| 465 | 3300047318 | Ga0495636_0000599 | Ga0495636_0000599_8600_9370 | 240 |
| 466 | 3300047318 | Ga0495636_0111595 | Ga0495636_0111595_336_1106 | 240 |
| 467 | 3300047470 | Ga0495681_0011450 | Ga0495681_0011450_3697_4458 | 240 |
| 468 | 3300048089 | Ga0495614_0003756 | Ga0495614_0003756_3134_3895 | 240 |
| 469 | 3300048904 | Ga0496101_0061938 | Ga0496101_0061938_352_1116 | 240 |
| 470 | 3300048905 | Ga0496102_0015677 | Ga0496102_0015677_1521_2285 | 240 |
| 471 | 3300048907 | Ga0496104_0002342 | Ga0496104_0002342_12283_13047 | 240 |
| 472 | 3300048908 | Ga0496105_0001990 | Ga0496105_0001990_2019_2783 | 240 |
| 473 | 3300048908 | Ga0496105_0245855 | Ga0496105_0245855_661_1437 | 240 |
| 474 | 3300048909 | Ga0496106_0113007 | Ga0496106_0113007_1305_2069 | 240 |
| 475 | 3300048911 | Ga0496108_0047240 | Ga0496108_0047240_310_1074 | 240 |
| 476 | 3300048912 | Ga0496109_0201937 | Ga0496109_0201937_652_1452 | 240 |
| 477 | 3300048913 | Ga0496110_0060420 | Ga0496110_0060420_1899_2663 | 240 |
| 478 | 3300048914 | Ga0496111_0011112 | Ga0496111_0011112_2790_3554 | 240 |
| 479 | 3300048915 | Ga0496112_0010013 | Ga0496112_0010013_6825_7601 | 240 |
| 480 | 3300048915 | Ga0496112_0029310 | Ga0496112_0029310_2084_2860 | 240 |
| 481 | 3300048915 | Ga0496112_0046986 | Ga0496112_0046986_2617_3417 | 240 |
| 482 | 3300048916 | Ga0496113_0430015 | Ga0496113_0430015_282_1046 | 240 |
| 483 | 3300048921 | Ga0496118_0009087 | Ga0496118_0009087_67_840 | 240 |
| 484 | 3300048921 | Ga0496118_0066272 | Ga0496118_0066272_1159_1929 | 240 |
| 485 | 3300048925 | Ga0496122_0012430 | Ga0496122_0012430_4297_5067 | 240 |
| 486 | 3300048926 | Ga0496123_0004944 | Ga0496123_0004944_7670_8440 | 240 |
| 487 | 3300048929 | Ga0496126_0271546 | Ga0496126_0271546_219_989 | 240 |
| 488 | 3300049568 | Ga0501031_0000156 | Ga0501031_0000156_16095_16862 | 240 |
| 489 | 3300049568 | Ga0501031_0076495 | Ga0501031_0076495_959_1729 | 240 |
| 490 | 3300049569 | Ga0501032_0001239 | Ga0501032_0001239_13543_14310 | 240 |
| 491 | 3300049570 | Ga0501033_0002504 | Ga0501033_0002504_1926_2693 | 240 |
| 492 | 3300049570 | Ga0501033_0032947 | Ga0501033_0032947_1312_2079 | 240 |
| 493 | 3300049570 | Ga0501033_0254670 | Ga0501033_0254670_436_1218 | 240 |
| 494 | 3300049571 | Ga0501034_0040056 | Ga0501034_0040056_2772_3539 | 240 |
| 495 | 3300049572 | Ga0501036_0001565 | Ga0501036_0001565_14679_15446 | 240 |
| 496 | 3300049573 | Ga0501037_0022824 | Ga0501037_0022824_3339_4106 | 240 |
| 497 | 3300049574 | Ga0501038_0005500 | Ga0501038_0005500_3450_4217 | 240 |
| 498 | 3300049579 | Ga0501043_0006544 | Ga0501043_0006544_6571_7338 | 240 |
| 499 | 3300049579 | Ga0501043_0016151 | Ga0501043_0016151_4010_4777 | 240 |
| 500 | 3300049580 | Ga0501046_0000631 | Ga0501046_0000631_19752_20519 | 240 |
| 501 | 3300049580 | Ga0501046_0031424 | Ga0501046_0031424_3470_4252 | 240 |
| 502 | 3300049581 | Ga0501047_0011740 | Ga0501047_0011740_4454_5221 | 240 |
| 503 | 3300049581 | Ga0501047_0077892 | Ga0501047_0077892_1113_1895 | 240 |
| 504 | 3300049581 | Ga0501047_0309448 | Ga0501047_0309448_133_900 | 240 |
| 505 | 3300049582 | Ga0501048_0006530 | Ga0501048_0006530_1798_2565 | 240 |
| 506 | 3300049583 | Ga0501067_0018587 | Ga0501067_0018587_2414_3181 | 240 |
| 507 | 3300049585 | Ga0501069_0011639 | Ga0501069_0011639_2031_2798 | 240 |
| 508 | 3300049586 | Ga0501070_0009017 | Ga0501070_0009017_6792_7559 | 240 |
| 509 | 3300049587 | Ga0501071_0056139 | Ga0501071_0056139_409_1176 | 240 |
| 510 | 3300049589 | Ga0501073_0000422 | Ga0501073_0000422_27653_28420 | 240 |
| 511 | 3300049590 | Ga0501074_0007013 | Ga0501074_0007013_952_1719 | 240 |
| 512 | 3300049591 | Ga0501075_0216575 | Ga0501075_0216575_650_1417 | 240 |
| 513 | 3300049741 | Ga0501079_0018062 | Ga0501079_0018062_1148_1915 | 240 |
| 514 | 3300049742 | Ga0501080_0025172 | Ga0501080_0025172_1486_2253 | 240 |
| 515 | 3300049743 | Ga0501081_0016586 | Ga0501081_0016586_558_1325 | 240 |
| 516 | 3300049744 | Ga0501083_0009150 | Ga0501083_0009150_5613_6380 | 240 |
| 517 | 3300049822 | Ga0501035_0026677 | Ga0501035_0026677_1376_2143 | 240 |
| 518 | 3300049822 | Ga0501035_0039279 | Ga0501035_0039279_1316_2083 | 240 |
| 519 | 3300049822 | Ga0501035_0050547 | Ga0501035_0050547_692_1459 | 240 |
| 520 | 3300049823 | Ga0501044_0005418 | Ga0501044_0005418_8873_9640 | 240 |
| 521 | 3300049823 | Ga0501044_0018317 | Ga0501044_0018317_4729_5496 | 240 |
| 522 | 3300049823 | Ga0501044_0322634 | Ga0501044_0322634_37_819 | 240 |
| 523 | 3300049823 | Ga0501044_0455351 | Ga0501044_0455351_26_793 | 240 |
| 524 | 3300050491 | nmdc:mga00v17_63631_c1 | nmdc:mga00v17_63631_c1_1216_1980 | 240 |
| 525 | 3300050491 | nmdc:mga00v17_6748_c1 | nmdc:mga00v17_6748_c1_4010_4780 | 240 |
| 526 | 3300050507 | nmdc:mga05p37_545699_c1 | nmdc:mga05p37_545699_c1_485_1249 | 240 |
| 527 | 3300050510 | nmdc:mga06r32_86259_c1 | nmdc:mga06r32_86259_c1_1526_2290 | 240 |
| 528 | 3300050512 | nmdc:mga0n895_75665_c1 | nmdc:mga0n895_75665_c1_310_1074 | 240 |
| 529 | 3300050513 | nmdc:mga0rr50_15964_c1 | nmdc:mga0rr50_15964_c1_2096_2860 | 240 |
| 530 | 3300050514 | nmdc:mga08x19_6305_c1 | nmdc:mga08x19_6305_c1_151_915 | 240 |
| 531 | 3300053083 | Ga0495655_0004111 | Ga0495655_0004111_1238_2014 | 240 |
| 532 | 3300053107 | Ga0500560_002972 | Ga0500560_002972_995_1756 | 240 |
| 533 | 3300053161 | Ga0500634_0000098 | Ga0500634_0000098_5161_5931 | 240 |
| 534 | 3300054114 | Ga0501084_0002400 | Ga0501084_0002400_398_1165 | 240 |
| 535 | 3300054114 | Ga0501084_0373777 | Ga0501084_0373777_318_1085 | 240 |
| 536 | iso_pu_bacteria | 2547132130 | 2547502964 | 240 |
| 537 | 3300027907 | Ga0207428_10034428 | Ga0207428_100344282 | 241 |
| 538 | 3300037312 | Ga0395899_0006752 | Ga0395899_0006752_5451_6227 | 241 |
| 539 | 3300037418 | Ga0395900_0032108 | Ga0395900_0032108_2560_3336 | 241 |
| 540 | 3300038443 | Ga0395901_0017119 | Ga0395901_0017119_844_1620 | 241 |
| 541 | 3300048090 | Ga0495615_0015710 | Ga0495615_0015710_65_910 | 241 |
| 542 | 3300048905 | Ga0496102_0023629 | Ga0496102_0023629_2304_3158 | 241 |
| 543 | iso_pu_bacteria | 2904776348 | 2904778807 | 241 |
| 544 | iso_pu_bacteria | 2919034639 | 2919038101 | 241 |
| 545 | 3300005548 | Ga0070665_100495072 | Ga0070665_1004950721 | 242 |
| 546 | 3300025893 | Ga0207682_10002817 | Ga0207682_100028172 | 242 |
| 547 | 3300031824 | Ga0307413_10062999 | Ga0307413_100629992 | 242 |
| 548 | 3300048903 | Ga0496100_0107150 | Ga0496100_0107150_20_841 | 242 |
| 549 | 3300048904 | Ga0496101_0235305 | Ga0496101_0235305_74_895 | 242 |
| 550 | 3300048911 | Ga0496108_0101964 | Ga0496108_0101964_398_1219 | 242 |
| 551 | 3300048913 | Ga0496110_0070083 | Ga0496110_0070083_1414_2235 | 242 |
| 552 | 3300048915 | Ga0496112_0534731 | Ga0496112_0534731_160_981 | 242 |
| 553 | 3300048916 | Ga0496113_0302582 | Ga0496113_0302582_306_1127 | 242 |
| 554 | 3300048917 | Ga0496114_0305237 | Ga0496114_0305237_154_975 | 242 |
| 555 | iso_pu_bacteria | 2690315906 | 2691512610 | 242 |
| 556 | iso_pu_bacteria | 2775506735 | 2775657625 | 242 |
| 557 | iso_pu_bacteria | 2808606357 | 2808829856 | 242 |
| 558 | iso_pu_bacteria | 2808606360 | 2808851036 | 242 |
| 559 | iso_pu_bacteria | 2808606366 | 2808876448 | 242 |
| 560 | iso_pu_bacteria | 2808606371 | 2808897964 | 242 |
| 561 | iso_pu_bacteria | 2811994871 | 2812318443 | 242 |
| 562 | iso_pu_bacteria | 2945916053 | 2945916197 | 242 |
| 563 | iso_pu_bacteria | 2946059875 | 2946060001 | 242 |
| 564 | 3300011119 | Ga0105246_10219096 | Ga0105246_102190962 | 243 |
| 565 | 3300031731 | Ga0307405_10553239 | Ga0307405_105532391 | 243 |
| 566 | 3300031911 | Ga0307412_10256117 | Ga0307412_102561172 | 243 |
| 567 | 3300037312 | Ga0395899_0015045 | Ga0395899_0015045_373_1170 | 243 |
| 568 | 3300037466 | Ga0395898_0011125 | Ga0395898_0011125_7195_7992 | 243 |
| 569 | 3300038443 | Ga0395901_0042420 | Ga0395901_0042420_2536_3333 | 243 |
| 570 | 3300038443 | Ga0395901_0313253 | Ga0395901_0313253_399_1196 | 243 |
| 571 | 3300038443 | Ga0395901_0710324 | Ga0395901_0710324_102_899 | 243 |
| 572 | 3300044656 | Ga0466969_0126953 | Ga0466969_0126953_192_989 | 243 |
| 573 | 3300044658 | Ga0466972_0081652 | Ga0466972_0081652_64_861 | 243 |
| 574 | 3300044693 | Ga0466961_0030561 | Ga0466961_0030561_413_1210 | 243 |
| 575 | 3300046535 | Ga0495586_0031754 | Ga0495586_0031754_102_935 | 243 |
| 576 | iso_pu_bacteria | 2844849076 | 2844851535 | 243 |
| 577 | iso_pu_bacteria | 2910809715 | 2910811944 | 243 |
| 578 | iso_pu_bacteria | 2919538618 | 2919539525 | 243 |
| 579 | iso_pu_bacteria | 2932426870 | 2932430231 | 243 |
| 580 | iso_pu_bacteria | 2939674588 | 2939676658 | 243 |
| 581 | iso_pu_bacteria | 2953998280 | 2954001841 | 243 |
| 582 | 3300006058 | Ga0075432_10019085 | Ga0075432_100190852 | 244 |
| 583 | 3300046455 | Ga0495603_0161730 | Ga0495603_0161730_450_1253 | 244 |
| 584 | 3300002773 | JGI25152J39213_1000486 | JGI25152J39213_100048623 | 245 |
| 585 | 3300003187 | JGI25151J46595_10002903 | JGI25151J46595_100029035 | 245 |
| 586 | 3300003792 | Ga0055540_1034926 | Ga0055540_10349261 | 245 |
| 587 | 3300005333 | Ga0070677_10086973 | Ga0070677_100869732 | 245 |
| 588 | 3300006058 | Ga0075432_10002528 | Ga0075432_100025283 | 245 |
| 589 | 3300009036 | Ga0105244_10026337 | Ga0105244_100263372 | 245 |
| 590 | 3300009036 | Ga0105244_10060818 | Ga0105244_100608182 | 245 |
| 591 | 3300009148 | Ga0105243_10005982 | Ga0105243_100059824 | 245 |
| 592 | 3300011119 | Ga0105246_10066996 | Ga0105246_100669962 | 245 |
| 593 | 3300025256 | Ga0209759_1011595 | Ga0209759_10115952 | 245 |
| 594 | 3300025258 | Ga0209129_1000159 | Ga0209129_100015931 | 245 |
| 595 | 3300025294 | Ga0209025_1000211 | Ga0209025_100021179 | 245 |
| 596 | 3300025303 | Ga0209051_1019000 | Ga0209051_10190003 | 245 |
| 597 | 3300025303 | Ga0209051_1021914 | Ga0209051_10219142 | 245 |
| 598 | 3300025728 | Ga0207655_1019888 | Ga0207655_10198882 | 245 |
| 599 | 3300042002 | Ga0439442_002302 | Ga0439442_002302_1099_1890 | 245 |
| 600 | 3300046472 | Ga0495580_0042268 | Ga0495580_0042268_780_1571 | 245 |
| 601 | 3300048906 | Ga0496103_0150771 | Ga0496103_0150771_648_1439 | 245 |
| 602 | 3300049569 | Ga0501032_0017471 | Ga0501032_0017471_2341_3132 | 245 |
| 603 | 3300049571 | Ga0501034_0000057 | Ga0501034_0000057_63666_64457 | 245 |
| 604 | 3300049574 | Ga0501038_0380809 | Ga0501038_0380809_142_933 | 245 |
| 605 | 3300049579 | Ga0501043_0014674 | Ga0501043_0014674_5216_6007 | 245 |
| 606 | iso_pu_bacteria | 2974302888 | 2974304142 | 245 |
| 607 | 3300003762 | Ga0055542_1006884 | Ga0055542_10068842 | 246 |
| 608 | 3300025254 | Ga0209148_1001608 | Ga0209148_10016082 | 246 |
| 609 | 3300031548 | Ga0307408_100035311 | Ga0307408_1000353113 | 246 |
| 610 | 3300031731 | Ga0307405_10004419 | Ga0307405_100044192 | 246 |
| 611 | 3300031731 | Ga0307405_10016643 | Ga0307405_100166432 | 246 |
| 612 | 3300031824 | Ga0307413_10018695 | Ga0307413_100186952 | 246 |
| 613 | 3300031852 | Ga0307410_10040876 | Ga0307410_100408763 | 246 |
| 614 | 3300031852 | Ga0307410_10277074 | Ga0307410_102770742 | 246 |
| 615 | 3300031903 | Ga0307407_10234411 | Ga0307407_102344112 | 246 |
| 616 | 3300031911 | Ga0307412_10016980 | Ga0307412_100169804 | 246 |
| 617 | 3300031911 | Ga0307412_10021789 | Ga0307412_100217892 | 246 |
| 618 | 3300031995 | Ga0307409_100153597 | Ga0307409_1001535972 | 246 |
| 619 | 3300032002 | Ga0307416_100101615 | Ga0307416_1001016152 | 246 |
| 620 | 3300032002 | Ga0307416_100741068 | Ga0307416_1007410682 | 246 |
| 621 | 3300032126 | Ga0307415_100011710 | Ga0307415_1000117102 | 246 |
| 622 | 3300037418 | Ga0395900_0205546 | Ga0395900_0205546_722_1555 | 246 |
| 623 | 3300038443 | Ga0395901_0019338 | Ga0395901_0019338_3176_4009 | 246 |
| 624 | 3300042010 | Ga0439452_031797 | Ga0439452_031797_61_855 | 246 |
| 625 | 3300046459 | Ga0495629_0032461 | Ga0495629_0032461_2522_3313 | 246 |
| 626 | 3300046463 | Ga0495653_0001814 | Ga0495653_0001814_8181_8972 | 246 |
| 627 | 3300046477 | Ga0495664_0000613 | Ga0495664_0000613_16272_17063 | 246 |
| 628 | 3300046499 | Ga0495594_0036701 | Ga0495594_0036701_1145_1936 | 246 |
| 629 | 3300046517 | Ga0495630_0025529 | Ga0495630_0025529_1722_2513 | 246 |
| 630 | 3300046535 | Ga0495586_0001078 | Ga0495586_0001078_13036_13827 | 246 |
| 631 | 3300046535 | Ga0495586_0057051 | Ga0495586_0057051_347_1141 | 246 |
| 632 | 3300046536 | Ga0495587_0002655 | Ga0495587_0002655_1070_1861 | 246 |
| 633 | 3300046543 | Ga0495645_0003098 | Ga0495645_0003098_4914_5705 | 246 |
| 634 | 3300046679 | Ga0495623_0007879 | Ga0495623_0007879_5749_6540 | 246 |
| 635 | 3300046809 | Ga0495600_0058243 | Ga0495600_0058243_156_947 | 246 |
| 636 | 3300047315 | Ga0495581_0019994 | Ga0495581_0019994_876_1667 | 246 |
| 637 | 3300047317 | Ga0495604_0261973 | Ga0495604_0261973_56_847 | 246 |
| 638 | 3300047322 | Ga0495680_0015661 | Ga0495680_0015661_1608_2399 | 246 |
| 639 | 3300047444 | Ga0495675_0004789 | Ga0495675_0004789_6794_7585 | 246 |
| 640 | 3300048915 | Ga0496112_0638958 | Ga0496112_0638958_119_913 | 246 |
| 641 | 3300048916 | Ga0496113_0120094 | Ga0496113_0120094_741_1535 | 246 |
| 642 | 3300049569 | Ga0501032_0030653 | Ga0501032_0030653_2752_3546 | 246 |
| 643 | 3300049573 | Ga0501037_0071373 | Ga0501037_0071373_502_1296 | 246 |
| 644 | 3300049574 | Ga0501038_0016885 | Ga0501038_0016885_2731_3525 | 246 |
| 645 | 3300049579 | Ga0501043_0105858 | Ga0501043_0105858_991_1785 | 246 |
| 646 | 3300031824 | Ga0307413_10122379 | Ga0307413_101223792 | 247 |
| 647 | 3300031852 | Ga0307410_10066085 | Ga0307410_100660851 | 247 |
| 648 | 3300031852 | Ga0307410_10190552 | Ga0307410_101905522 | 247 |
| 649 | 3300031901 | Ga0307406_10127338 | Ga0307406_101273382 | 247 |
| 650 | 3300032002 | Ga0307416_100121954 | Ga0307416_1001219542 | 247 |
| 651 | 3300032005 | Ga0307411_10733297 | Ga0307411_107332971 | 247 |
| 652 | 3300041404 | Ga0439436_0063248 | Ga0439436_0063248_121_918 | 247 |
| 653 | 3300042007 | Ga0439449_0026802 | Ga0439449_0026802_943_1740 | 247 |
| 654 | 3300046558 | Ga0495633_0183498 | Ga0495633_0183498_30_827 | 247 |
| 655 | 3300046691 | Ga0495670_0046189 | Ga0495670_0046189_427_1224 | 247 |
| 656 | 3300047445 | Ga0495677_0032038 | Ga0495677_0032038_60_857 | 247 |
| 657 | iso_pu_bacteria | 2945920336 | 2945923677 | 247 |
| 658 | iso_pu_bacteria | 2946037020 | 2946040596 | 247 |
| 659 | 3300041404 | Ga0439436_0023178 | Ga0439436_0023178_238_1035 | 248 |
| 660 | 3300041405 | Ga0439438_054448 | Ga0439438_054448_14_811 | 248 |
| 661 | 3300041411 | Ga0439466_0042261 | Ga0439466_0042261_588_1385 | 248 |
| 662 | 3300046674 | Ga0495588_0054122 | Ga0495588_0054122_680_1483 | 248 |
| 663 | 3300031903 | Ga0307407_10241029 | Ga0307407_102410292 | 249 |
| 664 | 3300032004 | Ga0307414_10002021 | Ga0307414_100020216 | 249 |
| 665 | 3300041404 | Ga0439436_0004892 | Ga0439436_0004892_2437_3282 | 249 |
| 666 | 3300041405 | Ga0439438_030485 | Ga0439438_030485_522_1367 | 249 |
| 667 | 3300041406 | Ga0439439_0004700 | Ga0439439_0004700_1325_2170 | 249 |
| 668 | 3300041411 | Ga0439466_0017726 | Ga0439466_0017726_490_1335 | 249 |
| 669 | 3300041999 | Ga0439433_0025077 | Ga0439433_0025077_167_1012 | 249 |
| 670 | 3300042002 | Ga0439442_003358 | Ga0439442_003358_1220_2065 | 249 |
| 671 | 3300042007 | Ga0439449_0003611 | Ga0439449_0003611_1704_2549 | 249 |
| 672 | 3300042014 | Ga0439457_006936 | Ga0439457_006936_507_1352 | 249 |
| 673 | 3300047315 | Ga0495581_0041548 | Ga0495581_0041548_618_1454 | 249 |
| 674 | iso_pu_bacteria | 2904497146 | 2904497793 | 249 |
| 675 | 3300009036 | Ga0105244_10087593 | Ga0105244_100875931 | 250 |
| 676 | 3300025315 | Ga0207697_10003551 | Ga0207697_100035512 | 250 |
| 677 | 3300025728 | Ga0207655_1028626 | Ga0207655_10286262 | 250 |
| 678 | 3300031548 | Ga0307408_100012672 | Ga0307408_1000126724 | 250 |
| 679 | 3300031824 | Ga0307413_10018758 | Ga0307413_100187583 | 250 |
| 680 | 3300031852 | Ga0307410_10054246 | Ga0307410_100542463 | 250 |
| 681 | 3300031911 | Ga0307412_10092028 | Ga0307412_100920282 | 250 |
| 682 | 3300031995 | Ga0307409_100202413 | Ga0307409_1002024132 | 250 |
| 683 | 3300032002 | Ga0307416_100033203 | Ga0307416_1000332032 | 250 |
| 684 | 3300032004 | Ga0307414_10090822 | Ga0307414_100908222 | 250 |
| 685 | 3300041404 | Ga0439436_0007439 | Ga0439436_0007439_1580_2386 | 250 |
| 686 | 3300042002 | Ga0439442_000066 | Ga0439442_000066_9433_10239 | 250 |
| 687 | 3300042007 | Ga0439449_0029576 | Ga0439449_0029576_727_1533 | 250 |
| 688 | 3300042122 | Ga0450920_000130 | Ga0450920_000130_4022_4828 | 250 |
| 689 | 3300042122 | Ga0450920_007667 | Ga0450920_007667_950_1756 | 250 |
| 690 | 3300042146 | Ga0450907_000127 | Ga0450907_000127_4161_4967 | 250 |
| 691 | 3300042435 | Ga0439434_0000033 | Ga0439434_0000033_24402_25208 | 250 |
| 692 | 3300042531 | Ga0450918_003438 | Ga0450918_003438_537_1343 | 250 |
| 693 | 3300046472 | Ga0495580_0023426 | Ga0495580_0023426_2203_3036 | 250 |
| 694 | 3300046475 | Ga0495639_0031364 | Ga0495639_0031364_1185_2018 | 250 |
| 695 | 3300046535 | Ga0495586_0003416 | Ga0495586_0003416_7209_8042 | 250 |
| 696 | 3300046674 | Ga0495588_0001848 | Ga0495588_0001848_716_1549 | 250 |
| 697 | 3300046809 | Ga0495600_0059355 | Ga0495600_0059355_358_1191 | 250 |
| 698 | 3300047315 | Ga0495581_0000128 | Ga0495581_0000128_21775_22608 | 250 |
| 699 | 3300047673 | Ga0495593_0052049 | Ga0495593_0052049_858_1691 | 250 |
| 700 | iso_pu_bacteria | 2919059106 | 2919063214 | 250 |
| 701 | iso_pu_bacteria | 2919391150 | 2919391766 | 250 |
| 702 | iso_pu_bacteria | 2939647034 | 2939647242 | 250 |
| 703 | iso_pu_bacteria | 2945956166 | 2945957146 | 250 |
| 704 | 3300009148 | Ga0105243_10354667 | Ga0105243_103546671 | 251 |
| 705 | 3300031548 | Ga0307408_100030404 | Ga0307408_1000304042 | 251 |
| 706 | 3300031548 | Ga0307408_100284833 | Ga0307408_1002848332 | 251 |
| 707 | 3300031731 | Ga0307405_10391200 | Ga0307405_103912002 | 251 |
| 708 | 3300031824 | Ga0307413_10009030 | Ga0307413_100090302 | 251 |
| 709 | 3300031824 | Ga0307413_10335668 | Ga0307413_103356681 | 251 |
| 710 | 3300031852 | Ga0307410_10097706 | Ga0307410_100977062 | 251 |
| 711 | 3300031852 | Ga0307410_10396844 | Ga0307410_103968441 | 251 |
| 712 | 3300031903 | Ga0307407_10015562 | Ga0307407_100155623 | 251 |
| 713 | 3300032002 | Ga0307416_101057864 | Ga0307416_1010578641 | 251 |
| 714 | 3300032005 | Ga0307411_10006487 | Ga0307411_100064872 | 251 |
| 715 | iso_pu_bacteria | 8054107350 | 8054108176 | 251 |
| 716 | 3300031548 | Ga0307408_100048800 | Ga0307408_1000488001 | 252 |
| 717 | 3300031548 | Ga0307408_100585246 | Ga0307408_1005852462 | 252 |
| 718 | 3300031731 | Ga0307405_10248530 | Ga0307405_102485302 | 252 |
| 719 | 3300037312 | Ga0395899_0006965 | Ga0395899_0006965_3011_3829 | 252 |
| 720 | 3300037418 | Ga0395900_0183870 | Ga0395900_0183870_485_1303 | 252 |
| 721 | 3300037466 | Ga0395898_0047998 | Ga0395898_0047998_2355_3173 | 252 |
| 722 | 3300037471 | Ga0395905_0297483 | Ga0395905_0297483_548_1366 | 252 |
| 723 | 3300038443 | Ga0395901_0010870 | Ga0395901_0010870_3127_3945 | 252 |
| 724 | 3300031548 | Ga0307408_100035266 | Ga0307408_1000352663 | 253 |
| 725 | 3300031824 | Ga0307413_10195471 | Ga0307413_101954712 | 253 |
| 726 | 3300031911 | Ga0307412_10009159 | Ga0307412_100091595 | 253 |
| 727 | iso_pu_bacteria | 2939598168 | 2939600716 | 255 |
| 728 | 3300013100 | Ga0157373_10033055 | Ga0157373_100330552 | 256 |
| 729 | 3300031901 | Ga0307406_10090639 | Ga0307406_100906392 | 256 |
| 730 | iso_pu_bacteria | 2808606370 | 2808894123 | 256 |
| 731 | iso_pu_bacteria | 2964326757 | 2964328746 | 258 |
| 732 | 3300000549 | LJQas_1001056 | LJQas_10010563 | 259 |
| 733 | 3300000549 | LJQas_1000689 | LJQas_10006895 | 265 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4xgn-assembly2.cif.gz_E | crystal structure of 3-hydroxyacyl-coa dehydrogenase in complex with nad from burkholderia thailandensis | 0.9151 | 1 | 265 |
| 4o5o-assembly1.cif.gz_B-2 | x-ray crystal structure of a 3-hydroxyacyl-coa dehydrogenase from brucella suis | 0.9143 | 1 | 265 |
| 6ujk-assembly1.cif.gz_B | crystal structure of a probable short-chain type dehydrogenase/reductase (rv1144) from mycobacterium tuberculosis with bound nad | 0.9142 | 4 | 265 |
| 7tzp-assembly3.cif.gz_G | crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. pneumoniae ntuh-k2044 in complex with nadh | 0.9122 | 1 | 261 |
| 4pn3-assembly1.cif.gz_A | crystal structure of 3-hydroxyacyl-coa-dehydrogenase from brucella melitensis | 0.9113 | 1 | 265 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGR9_1_247_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9084 | 2 | 260 | 3.40.50.720 |
| af_Q99714_1_261_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9054 | 1 | 264 | 3.40.50.720 |
| af_Q0JDU3_1_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9027 | 104 | 260 | 3.40.50.720 |
| 4cqmK00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8991 | 6 | 261 | 3.40.50.720 |
| af_C6T421_12_106_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8978 | 3 | 106 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8LQR0-F1-model_v4 | deleted | 0.9869 | 174 | 261 |
|
| AF-A0A0F9B0H9-F1-model_v4 | Uncharacterized protein | 0.9837 | 171 | 262 |
GO:0016491
|
| AF-A0A2P9AMG2-F1-model_v4 | Putative oxidoreductase, short-chain dehydrogenase/reductase family | 0.9764 | 181 | 265 |
GO:0016491
|
| AF-A0A3D5NBV7-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9743 | 181 | 265 |
GO:0016491
|
| AF-A0A537RAG7-F1-model_v4 | SDR family oxidoreductase | 0.9707 | 173 | 265 |
GO:0016491
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar