F478122

General Info

Members Datasets Scaffolds Average Seq Length
734 337 726 79

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_11237876|Ga0070701_112378761
Length 92
Sequence LSRRRCGRWTLRAPVADFVIRIPRVSVAVSEAELTEILVNAGEHVEEGTPIYVIATEKVEQEIEAGASGTVQWTGQVGTTYDIGAEIGVITS

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
3 2687453737 Frankia sp. BMG5.36 Isolate Nodule
4 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
5 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
6 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
7 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
50 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
51 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
52 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
58 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
104 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
133 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
134 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
135 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
136 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
137 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
208 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
209 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
212 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
220 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
224 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
227 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
228 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
229 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
232 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
233 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
234 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
235 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
242 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
243 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
244 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
245 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
248 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
249 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
250 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
251 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
252 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
262 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
269 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
272 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
273 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
311 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
312 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
313 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
319 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
323 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
324 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
325 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
331 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
334 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
335 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
336 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
337 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.49
Nodule 0.54
Rhizoplane 9.81
Rhizosphere 76.84
Stem 0
Stem Tuber 0
Unclassified 5.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1003844 3300001977 Bacteria 2372
2 JGI24747J21853_1040525 3300001978 Bacteria 551
3 JGI24739J22299_10142746 3300001989 Bacteria 709
4 JGI24739J22299_10167850 3300001989 Bacteria 647
5 JGI24737J22298_10067153 3300001990 Bacteria 1073
6 JGI24743J22301_10069859 3300001991 Bacteria 732
7 JGI24750J21931_1010568 3300002070 Bacteria 1204
8 JGI24750J21931_1014002 3300002070 Bacteria 1076
9 JGI24745J21846_1003575 3300002073 Bacteria 1634
10 JGI24738J21930_10102929 3300002075 Bacteria 610
11 JGI24749J21850_1006529 3300002076 Bacteria 1625
12 JGI24744J21845_10004148 3300002077 Bacteria 2987
13 JGI24034J26672_10005717 3300002239 Bacteria 1787
14 JGI24742J22300_10000982 3300002244 Bacteria 4370
15 JGI24751J29686_10022339 3300002459 Bacteria 1313
16 Ga0070676_10003809 3300005328 Bacteria 7914
17 Ga0070676_10111686 3300005328 Bacteria 1703
18 Ga0070683_100949319 3300005329 Bacteria 825
19 Ga0070690_100143236 3300005330 Bacteria 1624
20 Ga0070677_10293857 3300005333 Bacteria 823
21 Ga0068869_100352668 3300005334 Bacteria 1200
22 Ga0068869_101691055 3300005334 Bacteria 565
23 Ga0070666_10027962 3300005335 Bacteria 3698
24 Ga0070666_10138787 3300005335 Bacteria 1693
25 Ga0070680_101358935 3300005336 Bacteria 615
26 Ga0070682_100004846 3300005337 Bacteria 7474
27 Ga0070682_100008532 3300005337 Bacteria 5787
28 Ga0070682_100114231 3300005337 Bacteria 1804
29 Ga0070682_100202482 3300005337 Bacteria 1401
30 Ga0070682_102003385 3300005337 Bacteria 509
31 Ga0068868_100006571 3300005338 Bacteria 8238
32 Ga0068868_100050862 3300005338 Bacteria 3256
33 Ga0068868_100225213 3300005338 Bacteria 1571
34 Ga0070660_100308245 3300005339 Bacteria 1299
35 Ga0070689_100017358 3300005340 Bacteria 5284
36 Ga0070689_100695098 3300005340 Bacteria 888
37 Ga0070689_102047397 3300005340 Bacteria 524
38 Ga0070691_10011557 3300005341 Bacteria 4033
39 Ga0070691_11014694 3300005341 Bacteria 518
40 Ga0070687_100053109 3300005343 Bacteria 2106
41 Ga0070687_100553947 3300005343 Bacteria 783
42 Ga0070661_100944430 3300005344 Bacteria 713
43 Ga0070668_100017633 3300005347 Bacteria 5353
44 Ga0070668_100461139 3300005347 Bacteria 1094
45 Ga0070668_100755082 3300005347 Bacteria 861
46 Ga0070669_100121698 3300005353 Bacteria 1992
47 Ga0070669_100803285 3300005353 Bacteria 800
48 Ga0070669_101106707 3300005353 Bacteria 682
49 Ga0070675_100050003 3300005354 Bacteria 3432
50 Ga0070675_100215175 3300005354 Bacteria 1672
51 Ga0070671_100007747 3300005355 Bacteria 8580
52 Ga0070671_100817756 3300005355 Bacteria 812
53 Ga0070674_100000125 3300005356 Bacteria 35199
54 Ga0070674_100618146 3300005356 Bacteria 918
55 Ga0070674_101103215 3300005356 Bacteria 701
56 Ga0070673_100462271 3300005364 Bacteria 1143
57 Ga0070688_100015022 3300005365 Bacteria 4396
58 Ga0070688_100017298 3300005365 Bacteria 4136
59 Ga0070688_100383610 3300005365 Bacteria 1036
60 Ga0070659_100491028 3300005366 Bacteria 1046
61 Ga0070659_101600805 3300005366 Bacteria 581
62 Ga0070667_100000056 3300005367 Bacteria 150952
63 Ga0070667_100001317 3300005367 Bacteria 22315
64 Ga0070667_100008096 3300005367 Bacteria 8717
65 Ga0070667_100516773 3300005367 Bacteria 1096
66 Ga0070667_101841691 3300005367 Bacteria 570
67 Ga0070703_10618581 3300005406 Bacteria 502
68 Ga0070709_10038393 3300005434 Bacteria 2932
69 Ga0070709_10131988 3300005434 Bacteria 1706
70 Ga0070714_100033072 3300005435 Bacteria 4321
71 Ga0070714_100417176 3300005435 Bacteria 1271
72 Ga0070713_100021734 3300005436 Bacteria 4943
73 Ga0070710_10000890 3300005437 Bacteria 14275
74 Ga0070710_10360544 3300005437 Bacteria 965
75 Ga0070701_10002203 3300005438 Bacteria 7440
76 Ga0070701_10079012 3300005438 Bacteria 1777
77 Ga0070701_11237876 3300005438 Bacteria 531
78 Ga0070711_100000244 3300005439 Bacteria 27954
79 Ga0070711_100002056 3300005439 Bacteria 11342
80 Ga0070711_101140039 3300005439 Bacteria 673
81 Ga0070705_100003441 3300005440 Bacteria 7762
82 Ga0070705_100803031 3300005440 Bacteria 749
83 Ga0070700_100038052 3300005441 Bacteria 2930
84 Ga0070700_100042260 3300005441 Bacteria 2798
85 Ga0070694_100012110 3300005444 Bacteria 5357
86 Ga0070694_101882304 3300005444 Bacteria 511
87 Ga0070708_100474824 3300005445 Bacteria 1180
88 Ga0070663_100006113 3300005455 Bacteria 7204
89 Ga0070663_100038377 3300005455 Bacteria 3341
90 Ga0070678_100001944 3300005456 Bacteria 11148
91 Ga0070678_100087424 3300005456 Bacteria 2380
92 Ga0070662_100004850 3300005457 Bacteria 8530
93 Ga0070662_100732064 3300005457 Bacteria 838
94 Ga0070681_11110476 3300005458 Bacteria 712
95 Ga0068867_100002467 3300005459 Bacteria 13007
96 Ga0068867_100222207 3300005459 Bacteria 1523
97 Ga0070685_10027360 3300005466 Bacteria 3151
98 Ga0070685_10156666 3300005466 Bacteria 1448
99 Ga0070679_100254143 3300005530 Bacteria 1713
100 Ga0070684_100899269 3300005535 Bacteria 829
101 Ga0068853_100998417 3300005539 Bacteria 806
102 Ga0070672_100171461 3300005543 Bacteria 1805
103 Ga0070672_100597421 3300005543 Bacteria 961
104 Ga0070686_100119173 3300005544 Bacteria 1810
105 Ga0070695_100046005 3300005545 Bacteria 2784
106 Ga0070695_100237823 3300005545 Bacteria 1320
107 Ga0070696_100004673 3300005546 Bacteria 9147
108 Ga0070693_100044051 3300005547 Bacteria 2523
109 Ga0070693_100051890 3300005547 Bacteria 2350
110 Ga0070693_100356719 3300005547 Bacteria 1002
111 Ga0070665_100002065 3300005548 Bacteria 22532
112 Ga0070665_100018546 3300005548 Bacteria 6973
113 Ga0070665_100125228 3300005548 Bacteria 2572
114 Ga0070665_100132369 3300005548 Bacteria 2496
115 Ga0070704_100044657 3300005549 Bacteria 3081
116 Ga0068855_100202858 3300005563 Bacteria 2232
117 Ga0068855_101754197 3300005563 Bacteria 632
118 Ga0068854_100000659 3300005578 Bacteria 20556
119 Ga0068854_100059346 3300005578 Bacteria 2764
120 Ga0068854_100168774 3300005578 Bacteria 1701
121 Ga0068856_100821730 3300005614 Bacteria 949
122 Ga0070702_100091209 3300005615 Bacteria 1848
123 Ga0068852_100029304 3300005616 Bacteria 4520
124 Ga0068852_100636864 3300005616 Bacteria 1073
125 Ga0068852_100808859 3300005616 Bacteria 952
126 Ga0068859_100000801 3300005617 Bacteria 31888
127 Ga0068859_100001161 3300005617 Bacteria 26914
128 Ga0068859_103058062 3300005617 Bacteria 510
129 Ga0068864_100058296 3300005618 Bacteria 3337
130 Ga0068864_101413687 3300005618 Bacteria 698
131 Ga0068866_10003532 3300005718 Bacteria 6402
132 Ga0068866_10009379 3300005718 Bacteria 4153
133 Ga0068861_100002743 3300005719 Bacteria 11538
134 Ga0068861_100802914 3300005719 Bacteria 883
135 Ga0068861_101001818 3300005719 Bacteria 797
136 Ga0068861_101870850 3300005719 Bacteria 596
137 Ga0068861_102321736 3300005719 Bacteria 538
138 Ga0068870_11356155 3300005840 Bacteria 520
139 Ga0068863_100001477 3300005841 Bacteria 23298
140 Ga0068863_100008103 3300005841 Bacteria 10254
141 Ga0068858_100005735 3300005842 Bacteria 12134
142 Ga0068858_100065066 3300005842 Bacteria 3374
143 Ga0068860_100000092 3300005843 Bacteria 150190
144 Ga0068860_100000743 3300005843 Bacteria 37175
145 Ga0068860_100127206 3300005843 Bacteria 2442
146 Ga0068860_100432761 3300005843 Bacteria 1306
147 Ga0068862_100000035 3300005844 Bacteria 174953
148 Ga0068862_100001026 3300005844 Bacteria 26891
149 Ga0068862_100270806 3300005844 Bacteria 1553
150 Ga0068862_100580203 3300005844 Bacteria 1074
151 Ga0068862_102291687 3300005844 Bacteria 552
152 Ga0081455_10057421 3300005937 Bacteria 3298
153 Ga0081455_10345322 3300005937 Bacteria 1052
154 Ga0081538_10093999 3300005981 Bacteria 1537
155 Ga0075365_10018897 3300006038 Bacteria 4244
156 Ga0075368_10168052 3300006042 Bacteria 921
157 Ga0075368_10528402 3300006042 Bacteria 528
158 Ga0075363_100001319 3300006048 Bacteria 9277
159 Ga0075363_100003961 3300006048 Bacteria 6399
160 Ga0075363_100005296 3300006048 Bacteria 5725
161 Ga0075363_100017527 3300006048 Bacteria 3553
162 Ga0075363_100060736 3300006048 Bacteria 2036
163 Ga0075363_100464694 3300006048 Bacteria 749
164 Ga0075363_100514708 3300006048 Bacteria 712
165 Ga0075364_10002016 3300006051 Bacteria 11320
166 Ga0075364_10164966 3300006051 Bacteria 1496
167 Ga0070715_10007687 3300006163 Bacteria 3723
168 Ga0070715_10039854 3300006163 Bacteria 1960
169 Ga0070715_10200384 3300006163 Bacteria 1014
170 Ga0070716_100001677 3300006173 Bacteria 9996
171 Ga0070716_100014528 3300006173 Bacteria 4034
172 Ga0070716_100021378 3300006173 Bacteria 3409
173 Ga0070712_100002977 3300006175 Bacteria 10484
174 Ga0070712_100135898 3300006175 Bacteria 1869
175 Ga0075367_10112952 3300006178 Bacteria 1669
176 Ga0075369_10011236 3300006186 Bacteria 3520
177 Ga0075369_10026716 3300006186 Bacteria 2408
178 Ga0075369_10031671 3300006186 Bacteria 2234
179 Ga0075369_10454059 3300006186 Bacteria 607
180 Ga0097621_100039034 3300006237 Bacteria 3812
181 Ga0097621_100852837 3300006237 Bacteria 846
182 Ga0075370_10007593 3300006353 Bacteria 5530
183 Ga0075370_10129248 3300006353 Bacteria 1473
184 Ga0075370_10520229 3300006353 Bacteria 719
185 Ga0068871_100049221 3300006358 Bacteria 3406
186 Ga0075428_100017974 3300006844 Bacteria 7813
187 Ga0075430_100018968 3300006846 Bacteria 5852
188 Ga0075430_100063237 3300006846 Bacteria 3109
189 Ga0075431_100026875 3300006847 Bacteria 5904
190 Ga0068865_100003557 3300006881 Bacteria 9354
191 Ga0068865_100946340 3300006881 Bacteria 751
192 Ga0075436_100773281 3300006914 Bacteria 714
193 Ga0097620_100000801 3300006931 Bacteria 31888
194 Ga0097620_100001161 3300006931 Bacteria 26914
195 Ga0097620_103058010 3300006931 Bacteria 510
196 Ga0099795_10227932 3300007788 Bacteria 795
197 Ga0099795_10293691 3300007788 Bacteria 713
198 Ga0105250_10062397 3300009092 Bacteria 1499
199 Ga0105240_10209469 3300009093 Bacteria 2279
200 Ga0105240_10701408 3300009093 Bacteria 1105
201 Ga0111539_10665372 3300009094 Bacteria 1212
202 Ga0111539_13363862 3300009094 Bacteria 514
203 Ga0105245_10004088 3300009098 Bacteria 12951
204 Ga0105245_10266341 3300009098 Bacteria 1669
205 Ga0105245_10477959 3300009098 Bacteria 1259
206 Ga0105247_10000062 3300009101 Bacteria 126437
207 Ga0105247_10000806 3300009101 Bacteria 23917
208 Ga0105247_10107295 3300009101 Bacteria 1793
209 Ga0114129_10046799 3300009147 Bacteria 6078
210 Ga0114129_10691953 3300009147 Bacteria 1311
211 Ga0105243_10003563 3300009148 Bacteria 12569
212 Ga0105243_10018727 3300009148 Bacteria 5245
213 Ga0105241_10057026 3300009174 Bacteria 2995
214 Ga0105241_11621191 3300009174 Bacteria 626
215 Ga0105241_12045680 3300009174 Bacteria 565
216 Ga0105241_12233381 3300009174 Bacteria 543
217 Ga0105242_10007246 3300009176 Bacteria 8550
218 Ga0105242_10099489 3300009176 Bacteria 2461
219 Ga0105242_11233799 3300009176 Bacteria 768
220 Ga0105248_10000036 3300009177 Bacteria 187421
221 Ga0105248_10000634 3300009177 Bacteria 39924
222 Ga0105248_10553936 3300009177 Bacteria 1297
223 Ga0105248_10754286 3300009177 Bacteria 1098
224 Ga0105248_10767147 3300009177 Bacteria 1088
225 Ga0105237_10111323 3300009545 Bacteria 2730
226 Ga0105237_10129714 3300009545 Bacteria 2516
227 Ga0105237_10701180 3300009545 Bacteria 1019
228 Ga0105238_10222721 3300009551 Bacteria 1863
229 Ga0105238_11123542 3300009551 Bacteria 809
230 Ga0105249_10000046 3300009553 Bacteria 176363
231 Ga0105249_10001173 3300009553 Bacteria 23210
232 Ga0105249_10049221 3300009553 Bacteria 3843
233 Ga0105249_11959758 3300009553 Bacteria 658
234 Ga0099796_10085731 3300010159 Bacteria 1163
235 Ga0099796_10127969 3300010159 Bacteria 982
236 Ga0105239_10003767 3300010375 Bacteria 18446
237 Ga0105239_10111843 3300010375 Bacteria 3028
238 Ga0105239_10591824 3300010375 Bacteria 1265
239 Ga0105239_12893421 3300010375 Bacteria 560
240 Ga0105246_10058357 3300011119 Bacteria 2673
241 Ga0105246_10963103 3300011119 Bacteria 770
242 Ga0105246_11025176 3300011119 Bacteria 749
243 Ga0105246_12254920 3300011119 Bacteria 531
244 Ga0157373_10522362 3300013100 Bacteria 859
245 Ga0157369_10497233 3300013105 Bacteria 1262
246 Ga0157374_10059129 3300013296 Bacteria 3583
247 Ga0157378_10004246 3300013297 Bacteria 12635
248 Ga0157378_10271142 3300013297 Bacteria 1632
249 Ga0163162_10024496 3300013306 Bacteria 5956
250 Ga0163162_10154319 3300013306 Bacteria 2415
251 Ga0163162_10419971 3300013306 Bacteria 1470
252 Ga0163162_10529598 3300013306 Bacteria 1307
253 Ga0163162_10678895 3300013306 Bacteria 1153
254 Ga0163162_10819523 3300013306 Bacteria 1047
255 Ga0163162_11571371 3300013306 Bacteria 750
256 Ga0163162_13154370 3300013306 Bacteria 529
257 Ga0157372_10001604 3300013307 Bacteria 24551
258 Ga0157372_10473707 3300013307 Bacteria 1460
259 Ga0157372_10519610 3300013307 Bacteria 1388
260 Ga0157375_10000618 3300013308 Bacteria 31552
261 Ga0157375_10780559 3300013308 Bacteria 1105
262 Ga0157375_13141042 3300013308 Bacteria 551
263 Ga0157375_13165848 3300013308 Bacteria 549
264 Ga0163163_10010547 3300014325 Bacteria 8316
265 Ga0163163_10012529 3300014325 Bacteria 7732
266 Ga0163163_10694615 3300014325 Bacteria 1081
267 Ga0163163_10719066 3300014325 Bacteria 1062
268 Ga0157380_10000392 3300014326 Bacteria 26452
269 Ga0157380_10144014 3300014326 Bacteria 2051
270 Ga0157377_10001431 3300014745 Bacteria 10293
271 Ga0157379_10028061 3300014968 Bacteria 5010
272 Ga0157379_10075352 3300014968 Bacteria 3021
273 Ga0157376_10117550 3300014969 Bacteria 2351
274 Ga0157376_10723711 3300014969 Bacteria 1002
275 Ga0163161_10016460 3300017792 Bacteria 5162
276 Ga0163161_10070881 3300017792 Bacteria 2549
277 Ga0163161_10218509 3300017792 Bacteria 1475
278 Ga0163161_10379412 3300017792 Bacteria 1130
279 Ga0213872_10333460 3300021361 Bacteria 625
280 Ga0213874_10155723 3300021377 Bacteria 800
281 Ga0213874_10378954 3300021377 Bacteria 547
282 Ga0213876_10002020 3300021384 Bacteria 12119
283 Ga0213876_10201969 3300021384 Bacteria 1057
284 Ga0213875_10011877 3300021388 Bacteria 4318
285 Ga0213875_10621076 3300021388 Bacteria 523
286 Ga0207672_1003246 3300025223 Bacteria 934
287 Ga0207696_1047401 3300025711 Bacteria 1238
288 Ga0207653_10028251 3300025885 Bacteria 1804
289 Ga0207682_10201039 3300025893 Bacteria 916
290 Ga0207692_10009413 3300025898 Bacteria 4081
291 Ga0207692_10024317 3300025898 Bacteria 2815
292 Ga0207692_11096842 3300025898 Bacteria 527
293 Ga0207642_10000167 3300025899 Bacteria 18730
294 Ga0207642_10011950 3300025899 Bacteria 3117
295 Ga0207710_10000060 3300025900 Bacteria 168230
296 Ga0207710_10002164 3300025900 Bacteria 9233
297 Ga0207688_10002083 3300025901 Bacteria 10748
298 Ga0207688_10002935 3300025901 Bacteria 9273
299 Ga0207688_10308502 3300025901 Bacteria 969
300 Ga0207688_10464274 3300025901 Bacteria 790
301 Ga0207680_10227594 3300025903 Bacteria 1281
302 Ga0207680_10356304 3300025903 Bacteria 1028
303 Ga0207647_10110703 3300025904 Bacteria 1624
304 Ga0207647_10123121 3300025904 Bacteria 1528
305 Ga0207685_10001566 3300025905 Bacteria 4871
306 Ga0207685_10011806 3300025905 Bacteria 2642
307 Ga0207699_10043101 3300025906 Bacteria 2620
308 Ga0207699_10324815 3300025906 Bacteria 1080
309 Ga0207645_10006460 3300025907 Bacteria 8410
310 Ga0207654_10105711 3300025911 Bacteria 1742
311 Ga0207707_11039206 3300025912 Bacteria 670
312 Ga0207671_10460298 3300025914 Bacteria 1013
313 Ga0207693_10001382 3300025915 Bacteria 21519
314 Ga0207693_10001847 3300025915 Bacteria 18553
315 Ga0207693_10429275 3300025915 Bacteria 1033
316 Ga0207663_10002032 3300025916 Bacteria 9618
317 Ga0207663_10011241 3300025916 Bacteria 4801
318 Ga0207662_10057183 3300025918 Bacteria 2330
319 Ga0207662_10455245 3300025918 Bacteria 875
320 Ga0207657_10053439 3300025919 Bacteria 3499
321 Ga0207657_10297913 3300025919 Bacteria 1278
322 Ga0207652_10550576 3300025921 Bacteria 1037
323 Ga0207681_10014914 3300025923 Bacteria 4840
324 Ga0207681_10048026 3300025923 Bacteria 2879
325 Ga0207694_11042688 3300025924 Bacteria 692
326 Ga0207650_11906520 3300025925 Bacteria 502
327 Ga0207659_10216495 3300025926 Bacteria 1537
328 Ga0207687_10006868 3300025927 Bacteria 7497
329 Ga0207687_10055429 3300025927 Bacteria 2778
330 Ga0207687_10520984 3300025927 Bacteria 994
331 Ga0207687_11082534 3300025927 Bacteria 688
332 Ga0207700_10934600 3300025928 Bacteria 776
333 Ga0207664_10170042 3300025929 Bacteria 1865
334 Ga0207664_10273554 3300025929 Bacteria 1480
335 Ga0207664_11607051 3300025929 Bacteria 572
336 Ga0207644_10013536 3300025931 Bacteria 5441
337 Ga0207690_10013779 3300025932 Bacteria 4868
338 Ga0207690_11112989 3300025932 Bacteria 658
339 Ga0207706_10007224 3300025933 Bacteria 10270
340 Ga0207686_10001374 3300025934 Bacteria 13815
341 Ga0207686_10864728 3300025934 Bacteria 728
342 Ga0207686_11295226 3300025934 Bacteria 598
343 Ga0207709_10004392 3300025935 Bacteria 8164
344 Ga0207709_10060986 3300025935 Bacteria 2355
345 Ga0207670_10166891 3300025936 Bacteria 1648
346 Ga0207670_11612016 3300025936 Bacteria 552
347 Ga0207669_10002459 3300025937 Bacteria 7909
348 Ga0207669_10850045 3300025937 Bacteria 759
349 Ga0207704_10000782 3300025938 Bacteria 14026
350 Ga0207704_10255994 3300025938 Bacteria 1317
351 Ga0207665_10002538 3300025939 Bacteria 12277
352 Ga0207665_10009183 3300025939 Bacteria 6493
353 Ga0207665_10238527 3300025939 Bacteria 1339
354 Ga0207665_10464640 3300025939 Bacteria 973
355 Ga0207711_10000202 3300025941 Bacteria 63414
356 Ga0207711_10034656 3300025941 Bacteria 4275
357 Ga0207711_10196945 3300025941 Bacteria 1838
358 Ga0207689_10026005 3300025942 Bacteria 4901
359 Ga0207689_11229313 3300025942 Bacteria 630
360 Ga0207661_10534907 3300025944 Bacteria 1073
361 Ga0207667_10438704 3300025949 Bacteria 1328
362 Ga0207667_10748967 3300025949 Bacteria 976
363 Ga0207651_10336513 3300025960 Bacteria 1267
364 Ga0207651_10377840 3300025960 Bacteria 1200
365 Ga0207712_10000042 3300025961 Bacteria 176338
366 Ga0207712_10008647 3300025961 Bacteria 6438
367 Ga0207712_10065648 3300025961 Bacteria 2591
368 Ga0207712_10370364 3300025961 Bacteria 1196
369 Ga0207712_11190356 3300025961 Bacteria 680
370 Ga0207668_10011924 3300025972 Bacteria 5302
371 Ga0207668_10111900 3300025972 Bacteria 2050
372 Ga0207668_11357484 3300025972 Bacteria 640
373 Ga0207640_10004834 3300025981 Bacteria 7314
374 Ga0207640_10182979 3300025981 Bacteria 1573
375 Ga0207640_10522786 3300025981 Bacteria 992
376 Ga0207658_10000409 3300025986 Bacteria 40927
377 Ga0207658_10010952 3300025986 Bacteria 6174
378 Ga0207658_10161563 3300025986 Bacteria 1836
379 Ga0207658_10263243 3300025986 Bacteria 1470
380 Ga0207658_11474042 3300025986 Bacteria 622
381 Ga0207677_10004948 3300026023 Bacteria 7194
382 Ga0207677_10031317 3300026023 Bacteria 3406
383 Ga0207677_10437664 3300026023 Bacteria 1117
384 Ga0207703_10010438 3300026035 Bacteria 7263
385 Ga0207703_10210689 3300026035 Bacteria 1732
386 Ga0207703_10335301 3300026035 Bacteria 1388
387 Ga0207703_11463870 3300026035 Bacteria 657
388 Ga0207639_10039781 3300026041 Bacteria 3506
389 Ga0207639_10497629 3300026041 Bacteria 1113
390 Ga0207678_10006686 3300026067 Bacteria 10223
391 Ga0207678_10015033 3300026067 Bacteria 6810
392 Ga0207708_10004516 3300026075 Bacteria 10238
393 Ga0207708_10052632 3300026075 Bacteria 3101
394 Ga0207708_10268385 3300026075 Bacteria 1379
395 Ga0207708_10623401 3300026075 Bacteria 916
396 Ga0207702_10386599 3300026078 Bacteria 1346
397 Ga0207641_10007933 3300026088 Bacteria 8805
398 Ga0207641_10009388 3300026088 Bacteria 8061
399 Ga0207641_10093421 3300026088 Bacteria 2637
400 Ga0207648_10004400 3300026089 Bacteria 14473
401 Ga0207648_10122222 3300026089 Bacteria 2289
402 Ga0207676_10207378 3300026095 Bacteria 1736
403 Ga0207676_10696378 3300026095 Bacteria 984
404 Ga0207676_11563999 3300026095 Bacteria 657
405 Ga0207675_100000419 3300026118 Bacteria 41020
406 Ga0207675_100085853 3300026118 Bacteria 2954
407 Ga0207675_101726178 3300026118 Bacteria 646
408 Ga0207683_10000386 3300026121 Bacteria 40766
409 Ga0207683_10096016 3300026121 Bacteria 2643
410 Ga0207698_10187837 3300026142 Bacteria 1837
411 Ga0207698_10344979 3300026142 Bacteria 1404
412 Ga0209813_10133789 3300027866 Bacteria 874
413 Ga0268266_10015538 3300028379 Bacteria 6528
414 Ga0268266_10020057 3300028379 Bacteria 5698
415 Ga0268266_10033092 3300028379 Bacteria 4396
416 Ga0268265_10000051 3300028380 Bacteria 174968
417 Ga0268265_10006561 3300028380 Bacteria 7874
418 Ga0268265_10188270 3300028380 Bacteria 1780
419 Ga0268265_10197437 3300028380 Bacteria 1742
420 Ga0268265_10524320 3300028380 Bacteria 1120
421 Ga0268265_11726196 3300028380 Bacteria 632
422 Ga0268264_10000108 3300028381 Bacteria 208791
423 Ga0268264_10019336 3300028381 Bacteria 5566
424 Ga0268264_10181326 3300028381 Bacteria 1913
425 Ga0268264_10258218 3300028381 Bacteria 1622
426 Ga0268264_11229131 3300028381 Bacteria 759
427 Ga0268264_11319055 3300028381 Bacteria 732
428 Ga0307410_10002941 3300031852 Bacteria 8400
429 Ga0307410_10160464 3300031852 Bacteria 1684
430 Ga0307410_11374609 3300031852 Bacteria 619
431 Ga0307406_10037252 3300031901 Bacteria 3003
432 Ga0307407_10169413 3300031903 Bacteria 1437
433 Ga0307407_10706202 3300031903 Bacteria 760
434 Ga0307409_100117999 3300031995 Bacteria 2240
435 Ga0307409_100516895 3300031995 Bacteria 1166
436 Ga0307409_101360740 3300031995 Bacteria 736
437 Ga0307416_100239307 3300032002 Bacteria 1757
438 Ga0307416_101046657 3300032002 Bacteria 920
439 Ga0307414_10329339 3300032004 Bacteria 1303
440 Ga0307411_10010708 3300032005 Bacteria 4904
441 Ga0307411_10844074 3300032005 Bacteria 810
442 Ga0307415_100191992 3300032126 Bacteria 1612
443 Ga0373958_0075028 3300034819 Bacteria 757
444 Ga0373938_0161466 3300034957 Bacteria 602
445 Ga0373951_0108321 3300035091 Bacteria 745
446 Ga0373939_0126951 3300035114 Bacteria 906
447 Ga0373941_0068426 3300035115 Bacteria 1173
448 Ga0373960_0032858 3300035121 Bacteria 1459
449 Ga0373931_0007355 3300035691 Bacteria 5184
450 Ga0373931_0172817 3300035691 Bacteria 1274
451 Ga0373947_0413402 3300035725 Bacteria 911
452 Ga0373925_0720096 3300037068 Bacteria 823
453 Ga0395898_1044394 3300037466 Bacteria 752
454 Ga0395905_0656641 3300037471 Bacteria 951
455 Ga0436364_0210802 3300037853 Bacteria 2295
456 Ga0436364_0665239 3300037853 Bacteria 42065
457 Ga0436364_0740200 3300037853 Bacteria 725
458 Ga0436364_1035203 3300037853 Bacteria 776
459 Ga0436365_0085052 3300039437 Bacteria 14182
460 Ga0436365_0411865 3300039437 Bacteria 16194
461 Ga0436365_0922410 3300039437 Bacteria 2846
462 Ga0436365_1355905 3300039437 Bacteria 26021
463 Ga0436360_0892117 3300039438 Bacteria 2189
464 Ga0436361_0217454 3300039447 Bacteria 785
465 Ga0436361_0492283 3300039447 Bacteria 848
466 Ga0436363_0141792 3300039450 Bacteria 555
467 Ga0436363_0669183 3300039450 Bacteria 797
468 Ga0436363_0829327 3300039450 Bacteria 840
469 Ga0436363_0861738 3300039450 Bacteria 669
470 Ga0436363_1362967 3300039450 Bacteria 1680
471 Ga0436363_1519424 3300039450 Bacteria 2600
472 Ga0436363_1702584 3300039450 Bacteria 1416
473 Ga0436362_1160607 3300039453 Bacteria 500
474 Ga0439461_0012051 3300041410 Bacteria 1614
475 Ga0439466_0001413 3300041411 Bacteria 9363
476 Ga0439466_0052592 3300041411 Bacteria 1331
477 Ga0439465_0002196 3300041413 Bacteria 6397
478 Ga0439465_0002908 3300041413 Bacteria 5614
479 Ga0439465_0209662 3300041413 Bacteria 712
480 Ga0451833_1334059 3300041491 Bacteria 605
481 Ga0451845_0290541 3300041501 Bacteria 927
482 Ga0451851_1366376 3300041507 Bacteria 513
483 Ga0451853_0827965 3300041512 Bacteria 1263
484 Ga0439431_0085283 3300041997 Bacteria 855
485 Ga0439431_0155130 3300041997 Bacteria 652
486 Ga0439442_004331 3300042002 Bacteria 2818
487 Ga0439445_0012586 3300042004 Bacteria 2036
488 Ga0439445_0026649 3300042004 Bacteria 1481
489 Ga0439434_0010245 3300042435 Bacteria 2763
490 Ga0439459_0071878 3300042438 Bacteria 802
491 Ga0466969_0041698 3300044656 Bacteria 2295
492 Ga0466969_0117849 3300044656 Bacteria 1238
493 Ga0466972_0048372 3300044658 Bacteria 2055
494 Ga0466972_0089285 3300044658 Bacteria 1462
495 Ga0466972_0138215 3300044658 Bacteria 1147
496 Ga0466965_0300226 3300044683 Bacteria 871
497 Ga0466966_0003513 3300044684 Bacteria 10340
498 Ga0466966_0010506 3300044684 Bacteria 6152
499 Ga0466966_0136596 3300044684 Bacteria 1499
500 Ga0466961_0011041 3300044693 Bacteria 5774
501 Ga0466961_0137673 3300044693 Bacteria 1529
502 Ga0466961_0985250 3300044693 Bacteria 501
503 Ga0466963_0065877 3300044694 Bacteria 2429
504 Ga0466963_0088987 3300044694 Bacteria 2100
505 Ga0466963_0186490 3300044694 Bacteria 1449
506 Ga0466963_0190247 3300044694 Bacteria 1434
507 Ga0466963_0190617 3300044694 Bacteria 1432
508 Ga0466963_0552132 3300044694 Bacteria 813
509 Ga0466964_0096277 3300044706 Bacteria 1297
510 Ga0466964_0162813 3300044706 Bacteria 1044
511 Ga0466964_0324821 3300044706 Bacteria 783
512 Ga0466971_0030802 3300044719 Bacteria 2401
513 Ga0466971_0077300 3300044719 Bacteria 1515
514 Ga0466971_0177058 3300044719 Bacteria 1002
515 Ga0466971_0378190 3300044719 Bacteria 688
516 Ga0466968_0004782 3300044735 Bacteria 5069
517 Ga0466968_0266771 3300044735 Bacteria 816
518 Ga0466970_0046356 3300044765 Bacteria 2315
519 Ga0466957_0003608 3300044842 Bacteria 8532
520 Ga0466957_0156352 3300044842 Bacteria 1478
521 Ga0466957_0200628 3300044842 Bacteria 1310
522 Ga0466957_0217607 3300044842 Bacteria 1260
523 Ga0466957_0452894 3300044842 Bacteria 884
524 Ga0466960_0002343 3300044901 Bacteria 7118
525 Ga0466960_0020412 3300044901 Bacteria 2934
526 Ga0466960_0564862 3300044901 Bacteria 672
527 Ga0466960_0985694 3300044901 Bacteria 517
528 Ga0466959_0068362 3300045049 Bacteria 2574
529 Ga0466959_0582925 3300045049 Bacteria 753
530 Ga0466958_0002894 3300045836 Bacteria 8760
531 Ga0466958_0042317 3300045836 Bacteria 2743
532 Ga0466958_0063326 3300045836 Bacteria 2255
533 Ga0466958_0105310 3300045836 Bacteria 1757
534 Ga0466967_0007417 3300045976 Bacteria 7910
535 Ga0466967_0128451 3300045976 Bacteria 2350
536 Ga0466967_0354590 3300045976 Bacteria 1420
537 Ga0466967_0507133 3300045976 Bacteria 1184
538 Ga0466967_0679503 3300045976 Bacteria 1019
539 Ga0466967_0754954 3300045976 Bacteria 965
540 Ga0466967_2169028 3300045976 Bacteria 552
541 Ga0466967_2434759 3300045976 Bacteria 519
542 Ga0495629_0144134 3300046459 Bacteria 1657
543 Ga0495641_0016281 3300046461 Bacteria 3922
544 Ga0495582_0008239 3300046473 Bacteria 5751
545 Ga0495639_0137128 3300046475 Bacteria 1174
546 Ga0495584_0376903 3300046491 Bacteria 721
547 Ga0495606_0617058 3300046507 Bacteria 530
548 Ga0495630_0055810 3300046517 Bacteria 2960
549 Ga0495640_0049163 3300046533 Bacteria 2909
550 Ga0495622_0394675 3300046557 Bacteria 596
551 Ga0495634_0883627 3300046642 Bacteria 506
552 Ga0495611_0315501 3300046648 Bacteria 720
553 Ga0495658_0037158 3300046683 Bacteria 2691
554 Ga0495613_0492805 3300046689 Bacteria 826
555 Ga0495624_0562225 3300046690 Bacteria 681
556 Ga0495649_0243805 3300046694 Bacteria 925
557 Ga0495589_0440009 3300046794 Bacteria 597
558 Ga0495581_0259194 3300047315 Bacteria 1017
559 Ga0495674_0130317 3300047319 Bacteria 2119
560 Ga0495672_0109666 3300047320 Bacteria 1483
561 Ga0495676_0236647 3300047321 Bacteria 1252
562 Ga0495684_0672487 3300047471 Bacteria 690
563 Ga0495593_0170572 3300047673 Bacteria 1097
564 Ga0495626_0408599 3300048091 Bacteria 524
565 Ga0496100_0020033 3300048903 Bacteria 4004
566 Ga0496100_0120217 3300048903 Bacteria 1836
567 Ga0496100_0121195 3300048903 Bacteria 1830
568 Ga0496100_0445024 3300048903 Bacteria 993
569 Ga0496100_1434927 3300048903 Bacteria 545
570 Ga0496101_0002255 3300048904 Bacteria 11786
571 Ga0496101_0006735 3300048904 Bacteria 7412
572 Ga0496101_0032011 3300048904 Bacteria 3700
573 Ga0496101_0040574 3300048904 Bacteria 3315
574 Ga0496101_0582327 3300048904 Bacteria 885
575 Ga0496101_0728461 3300048904 Bacteria 783
576 Ga0496101_1362230 3300048904 Bacteria 554
577 Ga0496102_0001066 3300048905 Bacteria 25405
578 Ga0496102_0014356 3300048905 Bacteria 6880
579 Ga0496102_0052105 3300048905 Bacteria 3728
580 Ga0496102_0082538 3300048905 Bacteria 2964
581 Ga0496102_0085035 3300048905 Bacteria 2920
582 Ga0496102_0156613 3300048905 Bacteria 2141
583 Ga0496102_0201134 3300048905 Bacteria 1878
584 Ga0496103_0001226 3300048906 Bacteria 17581
585 Ga0496103_0002026 3300048906 Bacteria 13017
586 Ga0496103_0055611 3300048906 Bacteria 2455
587 Ga0496103_0146630 3300048906 Bacteria 1511
588 Ga0496103_0769103 3300048906 Bacteria 608
589 Ga0496103_0802779 3300048906 Bacteria 593
590 Ga0496104_0198656 3300048907 Bacteria 1917
591 Ga0496104_1780180 3300048907 Bacteria 518
592 Ga0496105_0063979 3300048908 Bacteria 3035
593 Ga0496105_0394129 3300048908 Bacteria 1100
594 Ga0496105_0533487 3300048908 Bacteria 918
595 Ga0496105_0606666 3300048908 Bacteria 849
596 Ga0496105_0648962 3300048908 Bacteria 815
597 Ga0496106_0001406 3300048909 Bacteria 18048
598 Ga0496106_0188350 3300048909 Bacteria 1640
599 Ga0496106_0197064 3300048909 Bacteria 1602
600 Ga0496106_0702616 3300048909 Bacteria 806
601 Ga0496107_0001641 3300048910 Bacteria 13951
602 Ga0496107_0209830 3300048910 Bacteria 1448
603 Ga0496107_0849672 3300048910 Bacteria 667
604 Ga0496108_0012478 3300048911 Bacteria 6919
605 Ga0496108_0147864 3300048911 Bacteria 2026
606 Ga0496108_0183240 3300048911 Bacteria 1814
607 Ga0496109_0005854 3300048912 Bacteria 10307
608 Ga0496109_0009168 3300048912 Bacteria 8427
609 Ga0496109_0562674 3300048912 Bacteria 1075
610 Ga0496109_0720040 3300048912 Bacteria 935
611 Ga0496109_0969161 3300048912 Bacteria 788
612 Ga0496110_0051203 3300048913 Bacteria 3629
613 Ga0496110_0143004 3300048913 Bacteria 2163
614 Ga0496110_0414374 3300048913 Bacteria 1228
615 Ga0496110_0485996 3300048913 Bacteria 1125
616 Ga0496110_1046413 3300048913 Bacteria 724
617 Ga0496111_0226749 3300048914 Bacteria 1388
618 Ga0496111_0381433 3300048914 Bacteria 1042
619 Ga0496111_1062026 3300048914 Bacteria 578
620 Ga0496112_0014391 3300048915 Bacteria 7336
621 Ga0496112_0038501 3300048915 Bacteria 4669
622 Ga0496112_0045521 3300048915 Bacteria 4301
623 Ga0496112_0085695 3300048915 Bacteria 3117
624 Ga0496112_0322217 3300048915 Bacteria 1490
625 Ga0496112_0796494 3300048915 Bacteria 870
626 Ga0496112_1044831 3300048915 Bacteria 736
627 Ga0496113_0034812 3300048916 Bacteria 3678
628 Ga0496113_0267046 3300048916 Bacteria 1367
629 Ga0496113_0668779 3300048916 Bacteria 830
630 Ga0496114_0000486 3300048917 Bacteria 29134
631 Ga0496114_0445083 3300048917 Bacteria 1147
632 Ga0496114_0799519 3300048917 Bacteria 822
633 Ga0496114_1541820 3300048917 Bacteria 552
634 Ga0496115_0002673 3300048918 Bacteria 12785
635 Ga0496115_0362645 3300048918 Bacteria 1181
636 Ga0496115_0625441 3300048918 Bacteria 854
637 Ga0496116_0181686 3300048919 Bacteria 1125
638 Ga0496117_0000430 3300048920 Bacteria 70406
639 Ga0496118_0000165 3300048921 Bacteria 119376
640 Ga0496118_0002530 3300048921 Bacteria 24503
641 Ga0496119_0005297 3300048922 Bacteria 12422
642 Ga0496120_0020219 3300048923 Bacteria 4238
643 Ga0496121_0007201 3300048924 Bacteria 13473
644 Ga0496122_0362701 3300048925 Bacteria 751
645 Ga0496124_0203883 3300048927 Bacteria 1501
646 Ga0496125_0006092 3300048928 Bacteria 13162
647 Ga0496126_0003255 3300048929 Bacteria 20757
648 Ga0496126_0010065 3300048929 Bacteria 9976
649 Ga0501032_0006334 3300049569 Bacteria 8723
650 Ga0501033_0008828 3300049570 Bacteria 7787
651 Ga0501033_0614765 3300049570 Bacteria 744
652 Ga0501034_0005259 3300049571 Bacteria 14207
653 Ga0501034_0075196 3300049571 Bacteria 3386
654 Ga0501034_0530082 3300049571 Bacteria 1089
655 Ga0501036_0076998 3300049572 Bacteria 2822
656 Ga0501037_0003402 3300049573 Bacteria 11568
657 Ga0501039_0772504 3300049575 Bacteria 750
658 Ga0501043_0461422 3300049579 Bacteria 953
659 Ga0501046_0003379 3300049580 Bacteria 14646
660 Ga0501046_0683761 3300049580 Bacteria 724
661 Ga0501046_1079268 3300049580 Bacteria 555
662 Ga0501047_0004498 3300049581 Bacteria 13115
663 Ga0501047_0019957 3300049581 Bacteria 6435
664 Ga0501047_0425496 3300049581 Bacteria 1159
665 Ga0501047_1357948 3300049581 Bacteria 525
666 Ga0501048_0000667 3300049582 Bacteria 24833
667 Ga0501068_0742350 3300049584 Bacteria 643
668 Ga0501069_0034450 3300049585 Bacteria 2789
669 Ga0501070_0000669 3300049586 Bacteria 31597
670 Ga0501070_0026142 3300049586 Bacteria 4899
671 Ga0501073_0296647 3300049589 Bacteria 1115
672 Ga0501073_0379916 3300049589 Bacteria 976
673 Ga0501075_0504579 3300049591 Bacteria 923
674 Ga0501080_0061436 3300049742 Bacteria 3498
675 Ga0501080_0162495 3300049742 Bacteria 2062
676 Ga0501035_0001642 3300049822 Bacteria 22591
677 Ga0501035_0005600 3300049822 Bacteria 11861
678 Ga0501044_0002795 3300049823 Bacteria 19887
679 Ga0501044_0080500 3300049823 Bacteria 3299
680 Ga0501044_0759775 3300049823 Bacteria 851
681 nmdc:mga03683_391651_c1 3300050489 Bacteria 662
682 nmdc:mga03n38_10754_c1 3300050490 Bacteria 3382
683 nmdc:mga03n38_1784_c1 3300050490 Bacteria 6377
684 nmdc:mga03n38_24001_c1 3300050490 Bacteria 2489
685 nmdc:mga03n38_646847_c1 3300050490 Bacteria 605
686 nmdc:mga03n38_7109_c1 3300050490 Bacteria 3939
687 nmdc:mga03n38_7316_c1 3300050490 Bacteria 3901
688 nmdc:mga00v17_19256_c1 3300050491 Bacteria 3894
689 nmdc:mga00v17_3944_c1 3300050491 Bacteria 7656
690 nmdc:mga00v17_940870_c1 3300050491 Bacteria 546
691 nmdc:mga0yw44_1004714_c1 3300050492 Bacteria 565
692 nmdc:mga0yw44_143534_c1 3300050492 Bacteria 1553
693 nmdc:mga0yw44_198331_c1 3300050492 Bacteria 1325
694 nmdc:mga0yw44_5528_c1 3300050492 Bacteria 5989
695 nmdc:mga06z11_224830_c1 3300050494 Bacteria 1098
696 nmdc:mga06z11_73724_c1 3300050494 Bacteria 1813
697 nmdc:mga06z11_78535_c1 3300050494 Bacteria 1764
698 nmdc:mga04h51_127934_c1 3300050495 Bacteria 952
699 nmdc:mga04h51_143312_c1 3300050495 Bacteria 908
700 nmdc:mga04h51_253272_c1 3300050495 Bacteria 706
701 nmdc:mga07m45_110684_c1 3300050496 Bacteria 1581
702 nmdc:mga07m45_12019_c2 3300050496 Bacteria 2913
703 nmdc:mga07m45_189061_c1 3300050496 Bacteria 1197
704 nmdc:mga07m45_44078_c1 3300050496 Bacteria 1980
705 nmdc:mga07m45_47558_c1 3300050496 Bacteria 2412
706 nmdc:mga07m45_97324_c1 3300050496 Bacteria 1689
707 nmdc:mga05p37_95168_c1 3300050507 Bacteria 3669
708 nmdc:mga0qj67_28389_c1 3300050509 Bacteria 4343
709 nmdc:mga0qj67_60357_c1 3300050509 Bacteria 3009
710 nmdc:mga06r32_21217_c1 3300050510 Bacteria 5995
711 nmdc:mga08y16_384990_c1 3300050511 Bacteria 1437
712 nmdc:mga08y16_760618_c1 3300050511 Bacteria 964
713 nmdc:mga0n895_794066_c1 3300050512 Bacteria 937
714 nmdc:mga0sz30_14487_c1 3300050516 Bacteria 3105
715 nmdc:mga0sz30_14605_c1 3300050516 Bacteria 3094
716 nmdc:mga0sz30_5539_c1 3300050516 Bacteria 4638
717 nmdc:mga0sz30_63749_c1 3300050516 Bacteria 1578
718 Ga0495655_0152644 3300053083 Bacteria 727
719 Ga0495619_1066477 3300053085 Bacteria 538
720 Ga0500578_0093282 3300053086 Bacteria 1910
721 Ga0500642_0049190 3300053130 Bacteria 1855
722 Ga0500604_0228985 3300053151 Bacteria 642
723 Ga0500620_106883 3300053155 Bacteria 979
724 Ga0466962_0149282 3300061719 Bacteria 1134
725 Ga0466962_0183455 3300061719 Bacteria 1020
726 Ga0466962_0368541 3300061719 Bacteria 717

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2508501039 2508672945 74
2 iso_pu_bacteria 2508501039 2508675341 74
3 iso_pu_bacteria 2684623035 2686534866 74
4 iso_pu_bacteria 2684623035 2686539147 74
5 iso_pu_bacteria 2687453737 2689955756 74
6 iso_pu_bacteria 2687453743 2689991030 74
7 iso_pu_bacteria 2895880812 2895881981 74
8 iso_pu_bacteria 2895880812 2895887673 74
9 3300010375 Ga0105239_10591824 Ga0105239_105918242 77
10 3300048903 Ga0496100_0445024 Ga0496100_0445024_57_308 77
11 3300001977 JGI24746J21847_1003844 JGI24746J21847_10038443 78
12 3300001978 JGI24747J21853_1040525 JGI24747J21853_10405252 78
13 3300001989 JGI24739J22299_10142746 JGI24739J22299_101427462 78
14 3300001989 JGI24739J22299_10167850 JGI24739J22299_101678502 78
15 3300001990 JGI24737J22298_10067153 JGI24737J22298_100671532 78
16 3300001991 JGI24743J22301_10069859 JGI24743J22301_100698592 78
17 3300002070 JGI24750J21931_1010568 JGI24750J21931_10105681 78
18 3300002070 JGI24750J21931_1014002 JGI24750J21931_10140022 78
19 3300002073 JGI24745J21846_1003575 JGI24745J21846_10035753 78
20 3300002075 JGI24738J21930_10102929 JGI24738J21930_101029291 78
21 3300002076 JGI24749J21850_1006529 JGI24749J21850_10065293 78
22 3300002077 JGI24744J21845_10004148 JGI24744J21845_100041483 78
23 3300002239 JGI24034J26672_10005717 JGI24034J26672_100057173 78
24 3300002244 JGI24742J22300_10000982 JGI24742J22300_100009825 78
25 3300002459 JGI24751J29686_10022339 JGI24751J29686_100223392 78
26 3300005328 Ga0070676_10003809 Ga0070676_100038098 78
27 3300005328 Ga0070676_10111686 Ga0070676_101116863 78
28 3300005329 Ga0070683_100949319 Ga0070683_1009493192 78
29 3300005330 Ga0070690_100143236 Ga0070690_1001432362 78
30 3300005333 Ga0070677_10293857 Ga0070677_102938572 78
31 3300005334 Ga0068869_100352668 Ga0068869_1003526682 78
32 3300005334 Ga0068869_101691055 Ga0068869_1016910551 78
33 3300005335 Ga0070666_10027962 Ga0070666_100279622 78
34 3300005335 Ga0070666_10138787 Ga0070666_101387872 78
35 3300005336 Ga0070680_101358935 Ga0070680_1013589352 78
36 3300005337 Ga0070682_100004846 Ga0070682_1000048463 78
37 3300005337 Ga0070682_100008532 Ga0070682_1000085322 78
38 3300005337 Ga0070682_100114231 Ga0070682_1001142312 78
39 3300005337 Ga0070682_100202482 Ga0070682_1002024822 78
40 3300005337 Ga0070682_102003385 Ga0070682_1020033851 78
41 3300005338 Ga0068868_100006571 Ga0068868_1000065717 78
42 3300005338 Ga0068868_100050862 Ga0068868_1000508622 78
43 3300005338 Ga0068868_100225213 Ga0068868_1002252132 78
44 3300005339 Ga0070660_100308245 Ga0070660_1003082452 78
45 3300005340 Ga0070689_100017358 Ga0070689_1000173582 78
46 3300005340 Ga0070689_100695098 Ga0070689_1006950982 78
47 3300005340 Ga0070689_102047397 Ga0070689_1020473972 78
48 3300005341 Ga0070691_10011557 Ga0070691_100115572 78
49 3300005341 Ga0070691_11014694 Ga0070691_110146942 78
50 3300005343 Ga0070687_100053109 Ga0070687_1000531093 78
51 3300005343 Ga0070687_100553947 Ga0070687_1005539472 78
52 3300005344 Ga0070661_100944430 Ga0070661_1009444302 78
53 3300005347 Ga0070668_100017633 Ga0070668_1000176335 78
54 3300005347 Ga0070668_100461139 Ga0070668_1004611392 78
55 3300005347 Ga0070668_100755082 Ga0070668_1007550822 78
56 3300005353 Ga0070669_100121698 Ga0070669_1001216982 78
57 3300005353 Ga0070669_100803285 Ga0070669_1008032851 78
58 3300005353 Ga0070669_101106707 Ga0070669_1011067071 78
59 3300005354 Ga0070675_100050003 Ga0070675_1000500032 78
60 3300005354 Ga0070675_100215175 Ga0070675_1002151752 78
61 3300005355 Ga0070671_100007747 Ga0070671_1000077473 78
62 3300005355 Ga0070671_100817756 Ga0070671_1008177562 78
63 3300005356 Ga0070674_100000125 Ga0070674_10000012534 78
64 3300005356 Ga0070674_100618146 Ga0070674_1006181462 78
65 3300005356 Ga0070674_101103215 Ga0070674_1011032152 78
66 3300005364 Ga0070673_100462271 Ga0070673_1004622712 78
67 3300005365 Ga0070688_100015022 Ga0070688_1000150225 78
68 3300005365 Ga0070688_100017298 Ga0070688_1000172987 78
69 3300005365 Ga0070688_100383610 Ga0070688_1003836102 78
70 3300005366 Ga0070659_100491028 Ga0070659_1004910282 78
71 3300005366 Ga0070659_101600805 Ga0070659_1016008051 78
72 3300005367 Ga0070667_100000056 Ga0070667_100000056151 78
73 3300005367 Ga0070667_100001317 Ga0070667_1000013178 78
74 3300005367 Ga0070667_100008096 Ga0070667_1000080962 78
75 3300005367 Ga0070667_100516773 Ga0070667_1005167732 78
76 3300005367 Ga0070667_101841691 Ga0070667_1018416911 78
77 3300005406 Ga0070703_10618581 Ga0070703_106185811 78
78 3300005434 Ga0070709_10038393 Ga0070709_100383933 78
79 3300005434 Ga0070709_10131988 Ga0070709_101319881 78
80 3300005435 Ga0070714_100033072 Ga0070714_1000330725 78
81 3300005435 Ga0070714_100417176 Ga0070714_1004171762 78
82 3300005436 Ga0070713_100021734 Ga0070713_1000217343 78
83 3300005437 Ga0070710_10000890 Ga0070710_100008904 78
84 3300005437 Ga0070710_10360544 Ga0070710_103605442 78
85 3300005438 Ga0070701_10002203 Ga0070701_100022032 78
86 3300005438 Ga0070701_10079012 Ga0070701_100790122 78
87 3300005438 Ga0070701_11237876 Ga0070701_112378761 78
88 3300005439 Ga0070711_100000244 Ga0070711_1000002446 78
89 3300005439 Ga0070711_100002056 Ga0070711_1000020563 78
90 3300005439 Ga0070711_101140039 Ga0070711_1011400392 78
91 3300005440 Ga0070705_100003441 Ga0070705_1000034416 78
92 3300005440 Ga0070705_100803031 Ga0070705_1008030312 78
93 3300005441 Ga0070700_100038052 Ga0070700_1000380524 78
94 3300005441 Ga0070700_100042260 Ga0070700_1000422601 78
95 3300005444 Ga0070694_100012110 Ga0070694_1000121106 78
96 3300005444 Ga0070694_101882304 Ga0070694_1018823041 78
97 3300005445 Ga0070708_100474824 Ga0070708_1004748242 78
98 3300005455 Ga0070663_100006113 Ga0070663_1000061135 78
99 3300005455 Ga0070663_100038377 Ga0070663_1000383772 78
100 3300005456 Ga0070678_100001944 Ga0070678_1000019444 78
101 3300005456 Ga0070678_100087424 Ga0070678_1000874242 78
102 3300005457 Ga0070662_100004850 Ga0070662_1000048503 78
103 3300005457 Ga0070662_100732064 Ga0070662_1007320642 78
104 3300005458 Ga0070681_11110476 Ga0070681_111104762 78
105 3300005459 Ga0068867_100002467 Ga0068867_10000246713 78
106 3300005459 Ga0068867_100222207 Ga0068867_1002222071 78
107 3300005466 Ga0070685_10027360 Ga0070685_100273603 78
108 3300005466 Ga0070685_10156666 Ga0070685_101566662 78
109 3300005530 Ga0070679_100254143 Ga0070679_1002541432 78
110 3300005535 Ga0070684_100899269 Ga0070684_1008992692 78
111 3300005539 Ga0068853_100998417 Ga0068853_1009984172 78
112 3300005543 Ga0070672_100171461 Ga0070672_1001714612 78
113 3300005543 Ga0070672_100597421 Ga0070672_1005974212 78
114 3300005544 Ga0070686_100119173 Ga0070686_1001191732 78
115 3300005545 Ga0070695_100046005 Ga0070695_1000460052 78
116 3300005545 Ga0070695_100237823 Ga0070695_1002378232 78
117 3300005546 Ga0070696_100004673 Ga0070696_1000046735 78
118 3300005547 Ga0070693_100044051 Ga0070693_1000440513 78
119 3300005547 Ga0070693_100051890 Ga0070693_1000518901 78
120 3300005547 Ga0070693_100356719 Ga0070693_1003567191 78
121 3300005548 Ga0070665_100002065 Ga0070665_10000206516 78
122 3300005548 Ga0070665_100018546 Ga0070665_1000185465 78
123 3300005548 Ga0070665_100125228 Ga0070665_1001252282 78
124 3300005548 Ga0070665_100132369 Ga0070665_1001323691 78
125 3300005549 Ga0070704_100044657 Ga0070704_1000446573 78
126 3300005563 Ga0068855_100202858 Ga0068855_1002028582 78
127 3300005563 Ga0068855_101754197 Ga0068855_1017541971 78
128 3300005578 Ga0068854_100000659 Ga0068854_1000006593 78
129 3300005578 Ga0068854_100059346 Ga0068854_1000593463 78
130 3300005578 Ga0068854_100168774 Ga0068854_1001687743 78
131 3300005614 Ga0068856_100821730 Ga0068856_1008217301 78
132 3300005615 Ga0070702_100091209 Ga0070702_1000912093 78
133 3300005616 Ga0068852_100029304 Ga0068852_1000293042 78
134 3300005616 Ga0068852_100636864 Ga0068852_1006368642 78
135 3300005616 Ga0068852_100808859 Ga0068852_1008088592 78
136 3300005617 Ga0068859_100000801 Ga0068859_10000080129 78
137 3300005617 Ga0068859_100001161 Ga0068859_10000116119 78
138 3300005617 Ga0068859_103058062 Ga0068859_1030580622 78
139 3300005618 Ga0068864_100058296 Ga0068864_1000582964 78
140 3300005618 Ga0068864_101413687 Ga0068864_1014136872 78
141 3300005718 Ga0068866_10003532 Ga0068866_100035327 78
142 3300005718 Ga0068866_10009379 Ga0068866_100093791 78
143 3300005719 Ga0068861_100002743 Ga0068861_1000027431 78
144 3300005719 Ga0068861_100802914 Ga0068861_1008029142 78
145 3300005719 Ga0068861_101001818 Ga0068861_1010018182 78
146 3300005719 Ga0068861_101870850 Ga0068861_1018708502 78
147 3300005719 Ga0068861_102321736 Ga0068861_1023217361 78
148 3300005840 Ga0068870_11356155 Ga0068870_113561552 78
149 3300005841 Ga0068863_100001477 Ga0068863_1000014779 78
150 3300005841 Ga0068863_100008103 Ga0068863_1000081033 78
151 3300005842 Ga0068858_100005735 Ga0068858_1000057354 78
152 3300005842 Ga0068858_100065066 Ga0068858_1000650663 78
153 3300005843 Ga0068860_100000092 Ga0068860_1000000924 78
154 3300005843 Ga0068860_100000743 Ga0068860_10000074334 78
155 3300005843 Ga0068860_100127206 Ga0068860_1001272064 78
156 3300005843 Ga0068860_100432761 Ga0068860_1004327612 78
157 3300005844 Ga0068862_100000035 Ga0068862_1000000359 78
158 3300005844 Ga0068862_100001026 Ga0068862_1000010265 78
159 3300005844 Ga0068862_100270806 Ga0068862_1002708062 78
160 3300005844 Ga0068862_100580203 Ga0068862_1005802032 78
161 3300005844 Ga0068862_102291687 Ga0068862_1022916872 78
162 3300005937 Ga0081455_10057421 Ga0081455_100574213 78
163 3300005937 Ga0081455_10345322 Ga0081455_103453222 78
164 3300005981 Ga0081538_10093999 Ga0081538_100939993 78
165 3300006038 Ga0075365_10018897 Ga0075365_100188975 78
166 3300006042 Ga0075368_10168052 Ga0075368_101680522 78
167 3300006042 Ga0075368_10528402 Ga0075368_105284021 78
168 3300006048 Ga0075363_100001319 Ga0075363_1000013198 78
169 3300006048 Ga0075363_100003961 Ga0075363_1000039614 78
170 3300006048 Ga0075363_100005296 Ga0075363_1000052963 78
171 3300006048 Ga0075363_100017527 Ga0075363_1000175273 78
172 3300006048 Ga0075363_100060736 Ga0075363_1000607362 78
173 3300006048 Ga0075363_100464694 Ga0075363_1004646942 78
174 3300006048 Ga0075363_100514708 Ga0075363_1005147082 78
175 3300006051 Ga0075364_10002016 Ga0075364_100020162 78
176 3300006051 Ga0075364_10164966 Ga0075364_101649662 78
177 3300006163 Ga0070715_10007687 Ga0070715_100076874 78
178 3300006163 Ga0070715_10039854 Ga0070715_100398542 78
179 3300006163 Ga0070715_10200384 Ga0070715_102003842 78
180 3300006173 Ga0070716_100001677 Ga0070716_1000016778 78
181 3300006173 Ga0070716_100014528 Ga0070716_1000145283 78
182 3300006173 Ga0070716_100021378 Ga0070716_1000213782 78
183 3300006175 Ga0070712_100002977 Ga0070712_1000029778 78
184 3300006175 Ga0070712_100135898 Ga0070712_1001358982 78
185 3300006178 Ga0075367_10112952 Ga0075367_101129522 78
186 3300006186 Ga0075369_10011236 Ga0075369_100112362 78
187 3300006186 Ga0075369_10026716 Ga0075369_100267163 78
188 3300006186 Ga0075369_10031671 Ga0075369_100316712 78
189 3300006186 Ga0075369_10454059 Ga0075369_104540592 78
190 3300006237 Ga0097621_100039034 Ga0097621_1000390344 78
191 3300006237 Ga0097621_100852837 Ga0097621_1008528372 78
192 3300006353 Ga0075370_10007593 Ga0075370_100075933 78
193 3300006353 Ga0075370_10129248 Ga0075370_101292482 78
194 3300006353 Ga0075370_10520229 Ga0075370_105202292 78
195 3300006358 Ga0068871_100049221 Ga0068871_1000492215 78
196 3300006844 Ga0075428_100017974 Ga0075428_1000179746 78
197 3300006846 Ga0075430_100018968 Ga0075430_1000189685 78
198 3300006846 Ga0075430_100063237 Ga0075430_1000632373 78
199 3300006847 Ga0075431_100026875 Ga0075431_1000268755 78
200 3300006881 Ga0068865_100003557 Ga0068865_1000035574 78
201 3300006881 Ga0068865_100946340 Ga0068865_1009463402 78
202 3300006914 Ga0075436_100773281 Ga0075436_1007732812 78
203 3300006931 Ga0097620_100000801 Ga0097620_10000080129 78
204 3300006931 Ga0097620_100001161 Ga0097620_1000011618 78
205 3300006931 Ga0097620_103058010 Ga0097620_1030580102 78
206 3300007788 Ga0099795_10227932 Ga0099795_102279322 78
207 3300007788 Ga0099795_10293691 Ga0099795_102936912 78
208 3300009092 Ga0105250_10062397 Ga0105250_100623972 78
209 3300009093 Ga0105240_10209469 Ga0105240_102094693 78
210 3300009093 Ga0105240_10701408 Ga0105240_107014082 78
211 3300009094 Ga0111539_10665372 Ga0111539_106653722 78
212 3300009094 Ga0111539_13363862 Ga0111539_133638622 78
213 3300009098 Ga0105245_10004088 Ga0105245_1000408810 78
214 3300009098 Ga0105245_10266341 Ga0105245_102663412 78
215 3300009098 Ga0105245_10477959 Ga0105245_104779592 78
216 3300009101 Ga0105247_10000062 Ga0105247_1000006259 78
217 3300009101 Ga0105247_10000806 Ga0105247_1000080622 78
218 3300009101 Ga0105247_10107295 Ga0105247_101072954 78
219 3300009147 Ga0114129_10046799 Ga0114129_100467993 78
220 3300009147 Ga0114129_10691953 Ga0114129_106919532 78
221 3300009148 Ga0105243_10003563 Ga0105243_100035632 78
222 3300009148 Ga0105243_10018727 Ga0105243_100187275 78
223 3300009174 Ga0105241_10057026 Ga0105241_100570263 78
224 3300009174 Ga0105241_11621191 Ga0105241_116211911 78
225 3300009174 Ga0105241_12045680 Ga0105241_120456801 78
226 3300009174 Ga0105241_12233381 Ga0105241_122333812 78
227 3300009176 Ga0105242_10007246 Ga0105242_100072461 78
228 3300009176 Ga0105242_10099489 Ga0105242_100994893 78
229 3300009176 Ga0105242_11233799 Ga0105242_112337992 78
230 3300009177 Ga0105248_10000036 Ga0105248_10000036150 78
231 3300009177 Ga0105248_10000634 Ga0105248_1000063410 78
232 3300009177 Ga0105248_10553936 Ga0105248_105539362 78
233 3300009177 Ga0105248_10754286 Ga0105248_107542862 78
234 3300009177 Ga0105248_10767147 Ga0105248_107671472 78
235 3300009545 Ga0105237_10111323 Ga0105237_101113232 78
236 3300009545 Ga0105237_10129714 Ga0105237_101297143 78
237 3300009545 Ga0105237_10701180 Ga0105237_107011802 78
238 3300009551 Ga0105238_10222721 Ga0105238_102227212 78
239 3300009551 Ga0105238_11123542 Ga0105238_111235422 78
240 3300009553 Ga0105249_10000046 Ga0105249_10000046173 78
241 3300009553 Ga0105249_10001173 Ga0105249_100011738 78
242 3300009553 Ga0105249_10049221 Ga0105249_100492212 78
243 3300009553 Ga0105249_11959758 Ga0105249_119597582 78
244 3300010159 Ga0099796_10085731 Ga0099796_100857312 78
245 3300010159 Ga0099796_10127969 Ga0099796_101279692 78
246 3300010375 Ga0105239_10003767 Ga0105239_1000376719 78
247 3300010375 Ga0105239_10111843 Ga0105239_101118432 78
248 3300010375 Ga0105239_12893421 Ga0105239_128934212 78
249 3300011119 Ga0105246_10058357 Ga0105246_100583573 78
250 3300011119 Ga0105246_10963103 Ga0105246_109631031 78
251 3300011119 Ga0105246_11025176 Ga0105246_110251762 78
252 3300011119 Ga0105246_12254920 Ga0105246_122549201 78
253 3300013100 Ga0157373_10522362 Ga0157373_105223622 78
254 3300013105 Ga0157369_10497233 Ga0157369_104972332 78
255 3300013296 Ga0157374_10059129 Ga0157374_100591292 78
256 3300013297 Ga0157378_10004246 Ga0157378_100042463 78
257 3300013297 Ga0157378_10271142 Ga0157378_102711422 78
258 3300013306 Ga0163162_10024496 Ga0163162_100244965 78
259 3300013306 Ga0163162_10154319 Ga0163162_101543193 78
260 3300013306 Ga0163162_10419971 Ga0163162_104199712 78
261 3300013306 Ga0163162_10529598 Ga0163162_105295982 78
262 3300013306 Ga0163162_10678895 Ga0163162_106788952 78
263 3300013306 Ga0163162_10819523 Ga0163162_108195232 78
264 3300013306 Ga0163162_11571371 Ga0163162_115713712 78
265 3300013306 Ga0163162_13154370 Ga0163162_131543702 78
266 3300013307 Ga0157372_10001604 Ga0157372_1000160415 78
267 3300013307 Ga0157372_10473707 Ga0157372_104737072 78
268 3300013307 Ga0157372_10519610 Ga0157372_105196103 78
269 3300013308 Ga0157375_10000618 Ga0157375_100006189 78
270 3300013308 Ga0157375_10780559 Ga0157375_107805592 78
271 3300013308 Ga0157375_13141042 Ga0157375_131410422 78
272 3300013308 Ga0157375_13165848 Ga0157375_131658482 78
273 3300014325 Ga0163163_10010547 Ga0163163_100105474 78
274 3300014325 Ga0163163_10012529 Ga0163163_100125294 78
275 3300014325 Ga0163163_10694615 Ga0163163_106946152 78
276 3300014325 Ga0163163_10719066 Ga0163163_107190662 78
277 3300014326 Ga0157380_10000392 Ga0157380_1000039210 78
278 3300014326 Ga0157380_10144014 Ga0157380_101440143 78
279 3300014745 Ga0157377_10001431 Ga0157377_100014319 78
280 3300014968 Ga0157379_10028061 Ga0157379_100280613 78
281 3300014968 Ga0157379_10075352 Ga0157379_100753525 78
282 3300014969 Ga0157376_10117550 Ga0157376_101175503 78
283 3300014969 Ga0157376_10723711 Ga0157376_107237112 78
284 3300017792 Ga0163161_10016460 Ga0163161_100164603 78
285 3300017792 Ga0163161_10070881 Ga0163161_100708813 78
286 3300017792 Ga0163161_10218509 Ga0163161_102185092 78
287 3300017792 Ga0163161_10379412 Ga0163161_103794122 78
288 3300021361 Ga0213872_10333460 Ga0213872_103334602 78
289 3300021377 Ga0213874_10155723 Ga0213874_101557232 78
290 3300021377 Ga0213874_10378954 Ga0213874_103789541 78
291 3300021384 Ga0213876_10002020 Ga0213876_1000202012 78
292 3300021384 Ga0213876_10201969 Ga0213876_102019692 78
293 3300021388 Ga0213875_10011877 Ga0213875_100118775 78
294 3300021388 Ga0213875_10621076 Ga0213875_106210761 78
295 3300025223 Ga0207672_1003246 Ga0207672_10032462 78
296 3300025711 Ga0207696_1047401 Ga0207696_10474012 78
297 3300025885 Ga0207653_10028251 Ga0207653_100282513 78
298 3300025893 Ga0207682_10201039 Ga0207682_102010392 78
299 3300025898 Ga0207692_10009413 Ga0207692_100094133 78
300 3300025898 Ga0207692_10024317 Ga0207692_100243173 78
301 3300025898 Ga0207692_11096842 Ga0207692_110968422 78
302 3300025899 Ga0207642_10000167 Ga0207642_100001675 78
303 3300025899 Ga0207642_10011950 Ga0207642_100119504 78
304 3300025900 Ga0207710_10000060 Ga0207710_1000006058 78
305 3300025900 Ga0207710_10002164 Ga0207710_100021642 78
306 3300025901 Ga0207688_10002083 Ga0207688_1000208310 78
307 3300025901 Ga0207688_10002935 Ga0207688_1000293510 78
308 3300025901 Ga0207688_10308502 Ga0207688_103085022 78
309 3300025901 Ga0207688_10464274 Ga0207688_104642742 78
310 3300025903 Ga0207680_10227594 Ga0207680_102275942 78
311 3300025903 Ga0207680_10356304 Ga0207680_103563042 78
312 3300025904 Ga0207647_10110703 Ga0207647_101107033 78
313 3300025904 Ga0207647_10123121 Ga0207647_101231213 78
314 3300025905 Ga0207685_10001566 Ga0207685_100015662 78
315 3300025905 Ga0207685_10011806 Ga0207685_100118063 78
316 3300025906 Ga0207699_10043101 Ga0207699_100431013 78
317 3300025906 Ga0207699_10324815 Ga0207699_103248152 78
318 3300025907 Ga0207645_10006460 Ga0207645_100064608 78
319 3300025911 Ga0207654_10105711 Ga0207654_101057113 78
320 3300025912 Ga0207707_11039206 Ga0207707_110392061 78
321 3300025914 Ga0207671_10460298 Ga0207671_104602982 78
322 3300025915 Ga0207693_10001382 Ga0207693_100013828 78
323 3300025915 Ga0207693_10001847 Ga0207693_1000184715 78
324 3300025915 Ga0207693_10429275 Ga0207693_104292752 78
325 3300025916 Ga0207663_10002032 Ga0207663_100020323 78
326 3300025916 Ga0207663_10011241 Ga0207663_100112413 78
327 3300025918 Ga0207662_10057183 Ga0207662_100571834 78
328 3300025918 Ga0207662_10455245 Ga0207662_104552452 78
329 3300025919 Ga0207657_10053439 Ga0207657_100534394 78
330 3300025919 Ga0207657_10297913 Ga0207657_102979132 78
331 3300025921 Ga0207652_10550576 Ga0207652_105505761 78
332 3300025923 Ga0207681_10014914 Ga0207681_100149145 78
333 3300025923 Ga0207681_10048026 Ga0207681_100480263 78
334 3300025924 Ga0207694_11042688 Ga0207694_110426882 78
335 3300025925 Ga0207650_11906520 Ga0207650_119065202 78
336 3300025926 Ga0207659_10216495 Ga0207659_102164952 78
337 3300025927 Ga0207687_10006868 Ga0207687_100068687 78
338 3300025927 Ga0207687_10055429 Ga0207687_100554293 78
339 3300025927 Ga0207687_10520984 Ga0207687_105209842 78
340 3300025927 Ga0207687_11082534 Ga0207687_110825342 78
341 3300025928 Ga0207700_10934600 Ga0207700_109346001 78
342 3300025929 Ga0207664_10170042 Ga0207664_101700422 78
343 3300025929 Ga0207664_10273554 Ga0207664_102735543 78
344 3300025929 Ga0207664_11607051 Ga0207664_116070512 78
345 3300025931 Ga0207644_10013536 Ga0207644_100135362 78
346 3300025932 Ga0207690_10013779 Ga0207690_100137796 78
347 3300025932 Ga0207690_11112989 Ga0207690_111129892 78
348 3300025933 Ga0207706_10007224 Ga0207706_100072244 78
349 3300025934 Ga0207686_10001374 Ga0207686_100013748 78
350 3300025934 Ga0207686_10864728 Ga0207686_108647282 78
351 3300025934 Ga0207686_11295226 Ga0207686_112952262 78
352 3300025935 Ga0207709_10004392 Ga0207709_100043928 78
353 3300025935 Ga0207709_10060986 Ga0207709_100609863 78
354 3300025936 Ga0207670_10166891 Ga0207670_101668912 78
355 3300025936 Ga0207670_11612016 Ga0207670_116120162 78
356 3300025937 Ga0207669_10002459 Ga0207669_100024597 78
357 3300025937 Ga0207669_10850045 Ga0207669_108500452 78
358 3300025938 Ga0207704_10000782 Ga0207704_1000078213 78
359 3300025938 Ga0207704_10255994 Ga0207704_102559942 78
360 3300025939 Ga0207665_10002538 Ga0207665_100025383 78
361 3300025939 Ga0207665_10009183 Ga0207665_100091833 78
362 3300025939 Ga0207665_10238527 Ga0207665_102385272 78
363 3300025939 Ga0207665_10464640 Ga0207665_104646402 78
364 3300025941 Ga0207711_10000202 Ga0207711_1000020236 78
365 3300025941 Ga0207711_10034656 Ga0207711_100346566 78
366 3300025941 Ga0207711_10196945 Ga0207711_101969452 78
367 3300025942 Ga0207689_10026005 Ga0207689_100260053 78
368 3300025942 Ga0207689_11229313 Ga0207689_112293131 78
369 3300025944 Ga0207661_10534907 Ga0207661_105349072 78
370 3300025949 Ga0207667_10438704 Ga0207667_104387042 78
371 3300025949 Ga0207667_10748967 Ga0207667_107489672 78
372 3300025960 Ga0207651_10336513 Ga0207651_103365132 78
373 3300025960 Ga0207651_10377840 Ga0207651_103778402 78
374 3300025961 Ga0207712_10000042 Ga0207712_100000428 78
375 3300025961 Ga0207712_10008647 Ga0207712_100086474 78
376 3300025961 Ga0207712_10065648 Ga0207712_100656483 78
377 3300025961 Ga0207712_10370364 Ga0207712_103703642 78
378 3300025961 Ga0207712_11190356 Ga0207712_111903562 78
379 3300025972 Ga0207668_10011924 Ga0207668_100119243 78
380 3300025972 Ga0207668_10111900 Ga0207668_101119003 78
381 3300025972 Ga0207668_11357484 Ga0207668_113574842 78
382 3300025981 Ga0207640_10004834 Ga0207640_100048347 78
383 3300025981 Ga0207640_10182979 Ga0207640_101829792 78
384 3300025981 Ga0207640_10522786 Ga0207640_105227862 78
385 3300025986 Ga0207658_10000409 Ga0207658_100004093 78
386 3300025986 Ga0207658_10010952 Ga0207658_100109525 78
387 3300025986 Ga0207658_10161563 Ga0207658_101615632 78
388 3300025986 Ga0207658_10263243 Ga0207658_102632432 78
389 3300025986 Ga0207658_11474042 Ga0207658_114740422 78
390 3300026023 Ga0207677_10004948 Ga0207677_100049484 78
391 3300026023 Ga0207677_10031317 Ga0207677_100313173 78
392 3300026023 Ga0207677_10437664 Ga0207677_104376642 78
393 3300026035 Ga0207703_10010438 Ga0207703_100104384 78
394 3300026035 Ga0207703_10210689 Ga0207703_102106892 78
395 3300026035 Ga0207703_10335301 Ga0207703_103353013 78
396 3300026035 Ga0207703_11463870 Ga0207703_114638702 78
397 3300026041 Ga0207639_10039781 Ga0207639_100397811 78
398 3300026041 Ga0207639_10497629 Ga0207639_104976292 78
399 3300026067 Ga0207678_10006686 Ga0207678_100066865 78
400 3300026067 Ga0207678_10015033 Ga0207678_100150332 78
401 3300026075 Ga0207708_10004516 Ga0207708_100045161 78
402 3300026075 Ga0207708_10052632 Ga0207708_100526322 78
403 3300026075 Ga0207708_10268385 Ga0207708_102683852 78
404 3300026075 Ga0207708_10623401 Ga0207708_106234012 78
405 3300026078 Ga0207702_10386599 Ga0207702_103865992 78
406 3300026088 Ga0207641_10007933 Ga0207641_100079339 78
407 3300026088 Ga0207641_10009388 Ga0207641_100093883 78
408 3300026088 Ga0207641_10093421 Ga0207641_100934212 78
409 3300026089 Ga0207648_10004400 Ga0207648_100044007 78
410 3300026089 Ga0207648_10122222 Ga0207648_101222223 78
411 3300026095 Ga0207676_10207378 Ga0207676_102073783 78
412 3300026095 Ga0207676_10696378 Ga0207676_106963782 78
413 3300026095 Ga0207676_11563999 Ga0207676_115639992 78
414 3300026118 Ga0207675_100000419 Ga0207675_10000041910 78
415 3300026118 Ga0207675_100085853 Ga0207675_1000858533 78
416 3300026118 Ga0207675_101726178 Ga0207675_1017261781 78
417 3300026121 Ga0207683_10000386 Ga0207683_1000038610 78
418 3300026121 Ga0207683_10096016 Ga0207683_100960163 78
419 3300026142 Ga0207698_10187837 Ga0207698_101878373 78
420 3300026142 Ga0207698_10344979 Ga0207698_103449792 78
421 3300027866 Ga0209813_10133789 Ga0209813_101337892 78
422 3300028379 Ga0268266_10015538 Ga0268266_100155382 78
423 3300028379 Ga0268266_10020057 Ga0268266_100200575 78
424 3300028379 Ga0268266_10033092 Ga0268266_100330925 78
425 3300028380 Ga0268265_10000051 Ga0268265_10000051171 78
426 3300028380 Ga0268265_10006561 Ga0268265_100065616 78
427 3300028380 Ga0268265_10188270 Ga0268265_101882702 78
428 3300028380 Ga0268265_10197437 Ga0268265_101974372 78
429 3300028380 Ga0268265_10524320 Ga0268265_105243202 78
430 3300028380 Ga0268265_11726196 Ga0268265_117261962 78
431 3300028381 Ga0268264_10000108 Ga0268264_1000010834 78
432 3300028381 Ga0268264_10019336 Ga0268264_100193364 78
433 3300028381 Ga0268264_10181326 Ga0268264_101813263 78
434 3300028381 Ga0268264_10258218 Ga0268264_102582182 78
435 3300028381 Ga0268264_11229131 Ga0268264_112291312 78
436 3300028381 Ga0268264_11319055 Ga0268264_113190551 78
437 3300031852 Ga0307410_10002941 Ga0307410_100029414 78
438 3300031852 Ga0307410_10160464 Ga0307410_101604642 78
439 3300031852 Ga0307410_11374609 Ga0307410_113746092 78
440 3300031901 Ga0307406_10037252 Ga0307406_100372522 78
441 3300031903 Ga0307407_10169413 Ga0307407_101694132 78
442 3300031903 Ga0307407_10706202 Ga0307407_107062021 78
443 3300031995 Ga0307409_100117999 Ga0307409_1001179992 78
444 3300031995 Ga0307409_100516895 Ga0307409_1005168952 78
445 3300031995 Ga0307409_101360740 Ga0307409_1013607401 78
446 3300032002 Ga0307416_100239307 Ga0307416_1002393072 78
447 3300032002 Ga0307416_101046657 Ga0307416_1010466572 78
448 3300032004 Ga0307414_10329339 Ga0307414_103293392 78
449 3300032005 Ga0307411_10010708 Ga0307411_100107084 78
450 3300032005 Ga0307411_10844074 Ga0307411_108440742 78
451 3300032126 Ga0307415_100191992 Ga0307415_1001919922 78
452 3300034819 Ga0373958_0075028 Ga0373958_0075028_182_424 78
453 3300034957 Ga0373938_0161466 Ga0373938_0161466_68_310 78
454 3300035091 Ga0373951_0108321 Ga0373951_0108321_212_448 78
455 3300035114 Ga0373939_0126951 Ga0373939_0126951_508_750 78
456 3300035115 Ga0373941_0068426 Ga0373941_0068426_545_781 78
457 3300035121 Ga0373960_0032858 Ga0373960_0032858_1015_1257 78
458 3300035691 Ga0373931_0007355 Ga0373931_0007355_2969_3211 78
459 3300035691 Ga0373931_0172817 Ga0373931_0172817_253_489 78
460 3300035725 Ga0373947_0413402 Ga0373947_0413402_515_751 78
461 3300037068 Ga0373925_0720096 Ga0373925_0720096_509_751 78
462 3300037466 Ga0395898_1044394 Ga0395898_1044394_92_328 78
463 3300037471 Ga0395905_0656641 Ga0395905_0656641_478_714 78
464 3300037853 Ga0436364_0210802 Ga0436364_0210802_24_260 78
465 3300037853 Ga0436364_0665239 Ga0436364_0665239_11136_11372 78
466 3300037853 Ga0436364_0740200 Ga0436364_0740200_287_523 78
467 3300037853 Ga0436364_1035203 Ga0436364_1035203_513_749 78
468 3300039437 Ga0436365_0085052 Ga0436365_0085052_1186_1440 78
469 3300039437 Ga0436365_0411865 Ga0436365_0411865_4887_5123 78
470 3300039437 Ga0436365_0922410 Ga0436365_0922410_1711_1947 78
471 3300039437 Ga0436365_1355905 Ga0436365_1355905_22640_22876 78
472 3300039438 Ga0436360_0892117 Ga0436360_0892117_706_942 78
473 3300039447 Ga0436361_0217454 Ga0436361_0217454_48_284 78
474 3300039447 Ga0436361_0492283 Ga0436361_0492283_140_376 78
475 3300039450 Ga0436363_0141792 Ga0436363_0141792_267_503 78
476 3300039450 Ga0436363_0669183 Ga0436363_0669183_25_276 78
477 3300039450 Ga0436363_0829327 Ga0436363_0829327_327_569 78
478 3300039450 Ga0436363_0861738 Ga0436363_0861738_339_575 78
479 3300039450 Ga0436363_1362967 Ga0436363_1362967_776_1012 78
480 3300039450 Ga0436363_1519424 Ga0436363_1519424_1609_1845 78
481 3300039450 Ga0436363_1702584 Ga0436363_1702584_279_515 78
482 3300039453 Ga0436362_1160607 Ga0436362_1160607_218_454 78
483 3300041410 Ga0439461_0012051 Ga0439461_0012051_1009_1251 78
484 3300041411 Ga0439466_0001413 Ga0439466_0001413_168_410 78
485 3300041411 Ga0439466_0052592 Ga0439466_0052592_309_545 78
486 3300041413 Ga0439465_0002196 Ga0439465_0002196_5026_5262 78
487 3300041413 Ga0439465_0002908 Ga0439465_0002908_376_618 78
488 3300041413 Ga0439465_0209662 Ga0439465_0209662_446_682 78
489 3300041491 Ga0451833_1334059 Ga0451833_1334059_249_485 78
490 3300041501 Ga0451845_0290541 Ga0451845_0290541_144_380 78
491 3300041507 Ga0451851_1366376 Ga0451851_1366376_257_493 78
492 3300041512 Ga0451853_0827965 Ga0451853_0827965_317_559 78
493 3300041997 Ga0439431_0085283 Ga0439431_0085283_239_481 78
494 3300041997 Ga0439431_0155130 Ga0439431_0155130_240_476 78
495 3300042002 Ga0439442_004331 Ga0439442_004331_463_705 78
496 3300042004 Ga0439445_0012586 Ga0439445_0012586_1348_1584 78
497 3300042004 Ga0439445_0026649 Ga0439445_0026649_957_1199 78
498 3300042435 Ga0439434_0010245 Ga0439434_0010245_803_1045 78
499 3300042438 Ga0439459_0071878 Ga0439459_0071878_38_274 78
500 3300044656 Ga0466969_0041698 Ga0466969_0041698_891_1127 78
501 3300044656 Ga0466969_0117849 Ga0466969_0117849_504_740 78
502 3300044658 Ga0466972_0048372 Ga0466972_0048372_577_819 78
503 3300044658 Ga0466972_0089285 Ga0466972_0089285_322_558 78
504 3300044658 Ga0466972_0138215 Ga0466972_0138215_510_746 78
505 3300044683 Ga0466965_0300226 Ga0466965_0300226_261_497 78
506 3300044684 Ga0466966_0003513 Ga0466966_0003513_8896_9132 78
507 3300044684 Ga0466966_0010506 Ga0466966_0010506_4308_4544 78
508 3300044684 Ga0466966_0136596 Ga0466966_0136596_402_638 78
509 3300044693 Ga0466961_0011041 Ga0466961_0011041_2504_2740 78
510 3300044693 Ga0466961_0137673 Ga0466961_0137673_764_1000 78
511 3300044693 Ga0466961_0985250 Ga0466961_0985250_54_290 78
512 3300044694 Ga0466963_0065877 Ga0466963_0065877_1963_2199 78
513 3300044694 Ga0466963_0088987 Ga0466963_0088987_1703_1939 78
514 3300044694 Ga0466963_0186490 Ga0466963_0186490_600_836 78
515 3300044694 Ga0466963_0190247 Ga0466963_0190247_368_604 78
516 3300044694 Ga0466963_0190617 Ga0466963_0190617_581_829 78
517 3300044694 Ga0466963_0552132 Ga0466963_0552132_409_645 78
518 3300044706 Ga0466964_0096277 Ga0466964_0096277_832_1068 78
519 3300044706 Ga0466964_0162813 Ga0466964_0162813_422_658 78
520 3300044706 Ga0466964_0324821 Ga0466964_0324821_162_398 78
521 3300044719 Ga0466971_0030802 Ga0466971_0030802_1180_1416 78
522 3300044719 Ga0466971_0077300 Ga0466971_0077300_633_869 78
523 3300044719 Ga0466971_0177058 Ga0466971_0177058_210_458 78
524 3300044719 Ga0466971_0378190 Ga0466971_0378190_289_525 78
525 3300044735 Ga0466968_0004782 Ga0466968_0004782_639_887 78
526 3300044735 Ga0466968_0266771 Ga0466968_0266771_63_299 78
527 3300044765 Ga0466970_0046356 Ga0466970_0046356_1093_1329 78
528 3300044842 Ga0466957_0003608 Ga0466957_0003608_3225_3461 78
529 3300044842 Ga0466957_0156352 Ga0466957_0156352_761_997 78
530 3300044842 Ga0466957_0200628 Ga0466957_0200628_529_765 78
531 3300044842 Ga0466957_0217607 Ga0466957_0217607_495_731 78
532 3300044842 Ga0466957_0452894 Ga0466957_0452894_527_763 78
533 3300044901 Ga0466960_0002343 Ga0466960_0002343_2605_2841 78
534 3300044901 Ga0466960_0020412 Ga0466960_0020412_2298_2534 78
535 3300044901 Ga0466960_0564862 Ga0466960_0564862_218_454 78
536 3300044901 Ga0466960_0985694 Ga0466960_0985694_156_392 78
537 3300045049 Ga0466959_0068362 Ga0466959_0068362_366_602 78
538 3300045049 Ga0466959_0582925 Ga0466959_0582925_278_514 78
539 3300045836 Ga0466958_0002894 Ga0466958_0002894_6261_6497 78
540 3300045836 Ga0466958_0042317 Ga0466958_0042317_25_261 78
541 3300045836 Ga0466958_0063326 Ga0466958_0063326_681_917 78
542 3300045836 Ga0466958_0105310 Ga0466958_0105310_776_1012 78
543 3300045976 Ga0466967_0007417 Ga0466967_0007417_3429_3665 78
544 3300045976 Ga0466967_0128451 Ga0466967_0128451_1405_1641 78
545 3300045976 Ga0466967_0354590 Ga0466967_0354590_764_1000 78
546 3300045976 Ga0466967_0507133 Ga0466967_0507133_866_1102 78
547 3300045976 Ga0466967_0679503 Ga0466967_0679503_180_416 78
548 3300045976 Ga0466967_0754954 Ga0466967_0754954_542_778 78
549 3300045976 Ga0466967_2169028 Ga0466967_2169028_77_313 78
550 3300045976 Ga0466967_2434759 Ga0466967_2434759_101_337 78
551 3300046459 Ga0495629_0144134 Ga0495629_0144134_1008_1244 78
552 3300046461 Ga0495641_0016281 Ga0495641_0016281_112_348 78
553 3300046473 Ga0495582_0008239 Ga0495582_0008239_1702_1938 78
554 3300046475 Ga0495639_0137128 Ga0495639_0137128_249_485 78
555 3300046491 Ga0495584_0376903 Ga0495584_0376903_216_452 78
556 3300046507 Ga0495606_0617058 Ga0495606_0617058_162_404 78
557 3300046517 Ga0495630_0055810 Ga0495630_0055810_1991_2227 78
558 3300046533 Ga0495640_0049163 Ga0495640_0049163_2030_2266 78
559 3300046557 Ga0495622_0394675 Ga0495622_0394675_267_509 78
560 3300046642 Ga0495634_0883627 Ga0495634_0883627_184_420 78
561 3300046648 Ga0495611_0315501 Ga0495611_0315501_230_466 78
562 3300046683 Ga0495658_0037158 Ga0495658_0037158_1359_1595 78
563 3300046689 Ga0495613_0492805 Ga0495613_0492805_485_721 78
564 3300046690 Ga0495624_0562225 Ga0495624_0562225_262_498 78
565 3300046694 Ga0495649_0243805 Ga0495649_0243805_513_749 78
566 3300046794 Ga0495589_0440009 Ga0495589_0440009_159_401 78
567 3300047315 Ga0495581_0259194 Ga0495581_0259194_23_259 78
568 3300047319 Ga0495674_0130317 Ga0495674_0130317_605_841 78
569 3300047320 Ga0495672_0109666 Ga0495672_0109666_1062_1304 78
570 3300047321 Ga0495676_0236647 Ga0495676_0236647_726_968 78
571 3300047471 Ga0495684_0672487 Ga0495684_0672487_28_264 78
572 3300047673 Ga0495593_0170572 Ga0495593_0170572_300_542 78
573 3300048091 Ga0495626_0408599 Ga0495626_0408599_270_506 78
574 3300048903 Ga0496100_0020033 Ga0496100_0020033_2869_3105 78
575 3300048903 Ga0496100_0120217 Ga0496100_0120217_124_366 78
576 3300048903 Ga0496100_0121195 Ga0496100_0121195_899_1135 78
577 3300048903 Ga0496100_1434927 Ga0496100_1434927_210_446 78
578 3300048904 Ga0496101_0002255 Ga0496101_0002255_3069_3311 78
579 3300048904 Ga0496101_0006735 Ga0496101_0006735_5222_5458 78
580 3300048904 Ga0496101_0032011 Ga0496101_0032011_1087_1323 78
581 3300048904 Ga0496101_0040574 Ga0496101_0040574_781_1017 78
582 3300048904 Ga0496101_0582327 Ga0496101_0582327_82_324 78
583 3300048904 Ga0496101_0728461 Ga0496101_0728461_203_439 78
584 3300048904 Ga0496101_1362230 Ga0496101_1362230_33_287 78
585 3300048905 Ga0496102_0001066 Ga0496102_0001066_16517_16753 78
586 3300048905 Ga0496102_0014356 Ga0496102_0014356_6473_6715 78
587 3300048905 Ga0496102_0052105 Ga0496102_0052105_77_313 78
588 3300048905 Ga0496102_0082538 Ga0496102_0082538_1602_1838 78
589 3300048905 Ga0496102_0085035 Ga0496102_0085035_496_732 78
590 3300048905 Ga0496102_0156613 Ga0496102_0156613_1486_1722 78
591 3300048905 Ga0496102_0201134 Ga0496102_0201134_1287_1523 78
592 3300048906 Ga0496103_0001226 Ga0496103_0001226_11269_11511 78
593 3300048906 Ga0496103_0002026 Ga0496103_0002026_10788_11024 78
594 3300048906 Ga0496103_0055611 Ga0496103_0055611_583_819 78
595 3300048906 Ga0496103_0146630 Ga0496103_0146630_702_938 78
596 3300048906 Ga0496103_0769103 Ga0496103_0769103_259_495 78
597 3300048906 Ga0496103_0802779 Ga0496103_0802779_279_515 78
598 3300048907 Ga0496104_0198656 Ga0496104_0198656_589_825 78
599 3300048907 Ga0496104_1780180 Ga0496104_1780180_142_396 78
600 3300048908 Ga0496105_0063979 Ga0496105_0063979_1199_1435 78
601 3300048908 Ga0496105_0394129 Ga0496105_0394129_31_273 78
602 3300048908 Ga0496105_0533487 Ga0496105_0533487_159_401 78
603 3300048908 Ga0496105_0606666 Ga0496105_0606666_318_554 78
604 3300048908 Ga0496105_0648962 Ga0496105_0648962_58_294 78
605 3300048909 Ga0496106_0001406 Ga0496106_0001406_9153_9395 78
606 3300048909 Ga0496106_0188350 Ga0496106_0188350_1117_1359 78
607 3300048909 Ga0496106_0197064 Ga0496106_0197064_939_1175 78
608 3300048909 Ga0496106_0702616 Ga0496106_0702616_49_285 78
609 3300048910 Ga0496107_0001641 Ga0496107_0001641_2441_2683 78
610 3300048910 Ga0496107_0209830 Ga0496107_0209830_1124_1360 78
611 3300048910 Ga0496107_0849672 Ga0496107_0849672_54_290 78
612 3300048911 Ga0496108_0012478 Ga0496108_0012478_4131_4367 78
613 3300048911 Ga0496108_0147864 Ga0496108_0147864_879_1121 78
614 3300048911 Ga0496108_0183240 Ga0496108_0183240_531_767 78
615 3300048912 Ga0496109_0005854 Ga0496109_0005854_7479_7721 78
616 3300048912 Ga0496109_0009168 Ga0496109_0009168_2997_3233 78
617 3300048912 Ga0496109_0562674 Ga0496109_0562674_28_264 78
618 3300048912 Ga0496109_0720040 Ga0496109_0720040_190_426 78
619 3300048912 Ga0496109_0969161 Ga0496109_0969161_175_411 78
620 3300048913 Ga0496110_0051203 Ga0496110_0051203_3272_3508 78
621 3300048913 Ga0496110_0143004 Ga0496110_0143004_573_809 78
622 3300048913 Ga0496110_0414374 Ga0496110_0414374_284_520 78
623 3300048913 Ga0496110_0485996 Ga0496110_0485996_228_470 78
624 3300048913 Ga0496110_1046413 Ga0496110_1046413_279_521 78
625 3300048914 Ga0496111_0226749 Ga0496111_0226749_118_354 78
626 3300048914 Ga0496111_0381433 Ga0496111_0381433_384_620 78
627 3300048914 Ga0496111_1062026 Ga0496111_1062026_81_335 78
628 3300048915 Ga0496112_0014391 Ga0496112_0014391_1784_2020 78
629 3300048915 Ga0496112_0038501 Ga0496112_0038501_2480_2716 78
630 3300048915 Ga0496112_0045521 Ga0496112_0045521_3024_3266 78
631 3300048915 Ga0496112_0085695 Ga0496112_0085695_300_536 78
632 3300048915 Ga0496112_0322217 Ga0496112_0322217_576_812 78
633 3300048915 Ga0496112_0796494 Ga0496112_0796494_566_802 78
634 3300048915 Ga0496112_1044831 Ga0496112_1044831_413_649 78
635 3300048916 Ga0496113_0034812 Ga0496113_0034812_1489_1725 78
636 3300048916 Ga0496113_0267046 Ga0496113_0267046_999_1241 78
637 3300048916 Ga0496113_0668779 Ga0496113_0668779_418_654 78
638 3300048917 Ga0496114_0000486 Ga0496114_0000486_23718_23960 78
639 3300048917 Ga0496114_0445083 Ga0496114_0445083_473_709 78
640 3300048917 Ga0496114_0799519 Ga0496114_0799519_477_713 78
641 3300048917 Ga0496114_1541820 Ga0496114_1541820_283_525 78
642 3300048918 Ga0496115_0002673 Ga0496115_0002673_1714_1956 78
643 3300048918 Ga0496115_0362645 Ga0496115_0362645_785_1027 78
644 3300048918 Ga0496115_0625441 Ga0496115_0625441_148_384 78
645 3300048919 Ga0496116_0181686 Ga0496116_0181686_406_642 78
646 3300048920 Ga0496117_0000430 Ga0496117_0000430_40124_40360 78
647 3300048921 Ga0496118_0000165 Ga0496118_0000165_79621_79857 78
648 3300048921 Ga0496118_0002530 Ga0496118_0002530_5600_5836 78
649 3300048922 Ga0496119_0005297 Ga0496119_0005297_5472_5708 78
650 3300048923 Ga0496120_0020219 Ga0496120_0020219_1085_1321 78
651 3300048924 Ga0496121_0007201 Ga0496121_0007201_9146_9382 78
652 3300048925 Ga0496122_0362701 Ga0496122_0362701_449_685 78
653 3300048927 Ga0496124_0203883 Ga0496124_0203883_75_311 78
654 3300048928 Ga0496125_0006092 Ga0496125_0006092_6738_6974 78
655 3300048929 Ga0496126_0003255 Ga0496126_0003255_17537_17773 78
656 3300048929 Ga0496126_0010065 Ga0496126_0010065_6708_6944 78
657 3300049569 Ga0501032_0006334 Ga0501032_0006334_299_535 78
658 3300049570 Ga0501033_0008828 Ga0501033_0008828_6989_7225 78
659 3300049570 Ga0501033_0614765 Ga0501033_0614765_118_354 78
660 3300049571 Ga0501034_0005259 Ga0501034_0005259_12035_12271 78
661 3300049571 Ga0501034_0075196 Ga0501034_0075196_1898_2134 78
662 3300049571 Ga0501034_0530082 Ga0501034_0530082_178_414 78
663 3300049572 Ga0501036_0076998 Ga0501036_0076998_662_898 78
664 3300049573 Ga0501037_0003402 Ga0501037_0003402_3132_3368 78
665 3300049575 Ga0501039_0772504 Ga0501039_0772504_292_543 78
666 3300049579 Ga0501043_0461422 Ga0501043_0461422_656_892 78
667 3300049580 Ga0501046_0003379 Ga0501046_0003379_10965_11201 78
668 3300049580 Ga0501046_0683761 Ga0501046_0683761_71_322 78
669 3300049580 Ga0501046_1079268 Ga0501046_1079268_259_495 78
670 3300049581 Ga0501047_0004498 Ga0501047_0004498_1790_2026 78
671 3300049581 Ga0501047_0019957 Ga0501047_0019957_2778_3029 78
672 3300049581 Ga0501047_0425496 Ga0501047_0425496_313_549 78
673 3300049581 Ga0501047_1357948 Ga0501047_1357948_60_296 78
674 3300049582 Ga0501048_0000667 Ga0501048_0000667_21005_21241 78
675 3300049584 Ga0501068_0742350 Ga0501068_0742350_218_460 78
676 3300049585 Ga0501069_0034450 Ga0501069_0034450_725_961 78
677 3300049586 Ga0501070_0000669 Ga0501070_0000669_8471_8707 78
678 3300049586 Ga0501070_0026142 Ga0501070_0026142_4614_4856 78
679 3300049589 Ga0501073_0296647 Ga0501073_0296647_329_565 78
680 3300049589 Ga0501073_0379916 Ga0501073_0379916_347_589 78
681 3300049591 Ga0501075_0504579 Ga0501075_0504579_366_608 78
682 3300049742 Ga0501080_0061436 Ga0501080_0061436_60_296 78
683 3300049742 Ga0501080_0162495 Ga0501080_0162495_1642_1884 78
684 3300049822 Ga0501035_0001642 Ga0501035_0001642_5578_5829 78
685 3300049822 Ga0501035_0005600 Ga0501035_0005600_1951_2187 78
686 3300049823 Ga0501044_0002795 Ga0501044_0002795_16435_16686 78
687 3300049823 Ga0501044_0080500 Ga0501044_0080500_1295_1531 78
688 3300049823 Ga0501044_0759775 Ga0501044_0759775_102_338 78
689 3300050489 nmdc:mga03683_391651_c1 nmdc:mga03683_391651_c1_70_306 78
690 3300050490 nmdc:mga03n38_10754_c1 nmdc:mga03n38_10754_c1_1070_1306 78
691 3300050490 nmdc:mga03n38_1784_c1 nmdc:mga03n38_1784_c1_3444_3704 78
692 3300050490 nmdc:mga03n38_24001_c1 nmdc:mga03n38_24001_c1_2153_2404 78
693 3300050490 nmdc:mga03n38_646847_c1 nmdc:mga03n38_646847_c1_16_258 78
694 3300050490 nmdc:mga03n38_7109_c1 nmdc:mga03n38_7109_c1_2642_2878 78
695 3300050490 nmdc:mga03n38_7316_c1 nmdc:mga03n38_7316_c1_1850_2086 78
696 3300050491 nmdc:mga00v17_19256_c1 nmdc:mga00v17_19256_c1_1705_1965 78
697 3300050491 nmdc:mga00v17_3944_c1 nmdc:mga00v17_3944_c1_352_588 78
698 3300050491 nmdc:mga00v17_940870_c1 nmdc:mga00v17_940870_c1_296_532 78
699 3300050492 nmdc:mga0yw44_1004714_c1 nmdc:mga0yw44_1004714_c1_60_302 78
700 3300050492 nmdc:mga0yw44_143534_c1 nmdc:mga0yw44_143534_c1_92_343 78
701 3300050492 nmdc:mga0yw44_198331_c1 nmdc:mga0yw44_198331_c1_262_498 78
702 3300050492 nmdc:mga0yw44_5528_c1 nmdc:mga0yw44_5528_c1_1658_1918 78
703 3300050494 nmdc:mga06z11_224830_c1 nmdc:mga06z11_224830_c1_753_989 78
704 3300050494 nmdc:mga06z11_73724_c1 nmdc:mga06z11_73724_c1_782_1018 78
705 3300050494 nmdc:mga06z11_78535_c1 nmdc:mga06z11_78535_c1_428_664 78
706 3300050495 nmdc:mga04h51_127934_c1 nmdc:mga04h51_127934_c1_154_405 78
707 3300050495 nmdc:mga04h51_143312_c1 nmdc:mga04h51_143312_c1_237_473 78
708 3300050495 nmdc:mga04h51_253272_c1 nmdc:mga04h51_253272_c1_277_513 78
709 3300050496 nmdc:mga07m45_110684_c1 nmdc:mga07m45_110684_c1_309_545 78
710 3300050496 nmdc:mga07m45_12019_c2 nmdc:mga07m45_12019_c2_1460_1696 78
711 3300050496 nmdc:mga07m45_189061_c1 nmdc:mga07m45_189061_c1_240_476 78
712 3300050496 nmdc:mga07m45_44078_c1 nmdc:mga07m45_44078_c1_1477_1713 78
713 3300050496 nmdc:mga07m45_47558_c1 nmdc:mga07m45_47558_c1_1319_1555 78
714 3300050496 nmdc:mga07m45_97324_c1 nmdc:mga07m45_97324_c1_1134_1385 78
715 3300050507 nmdc:mga05p37_95168_c1 nmdc:mga05p37_95168_c1_1056_1292 78
716 3300050509 nmdc:mga0qj67_28389_c1 nmdc:mga0qj67_28389_c1_3754_3990 78
717 3300050509 nmdc:mga0qj67_60357_c1 nmdc:mga0qj67_60357_c1_1846_2082 78
718 3300050510 nmdc:mga06r32_21217_c1 nmdc:mga06r32_21217_c1_4410_4646 78
719 3300050511 nmdc:mga08y16_384990_c1 nmdc:mga08y16_384990_c1_13_255 78
720 3300050511 nmdc:mga08y16_760618_c1 nmdc:mga08y16_760618_c1_41_301 78
721 3300050512 nmdc:mga0n895_794066_c1 nmdc:mga0n895_794066_c1_486_722 78
722 3300050516 nmdc:mga0sz30_14487_c1 nmdc:mga0sz30_14487_c1_961_1197 78
723 3300050516 nmdc:mga0sz30_14605_c1 nmdc:mga0sz30_14605_c1_2469_2705 78
724 3300050516 nmdc:mga0sz30_5539_c1 nmdc:mga0sz30_5539_c1_3341_3577 78
725 3300050516 nmdc:mga0sz30_63749_c1 nmdc:mga0sz30_63749_c1_945_1181 78
726 3300053083 Ga0495655_0152644 Ga0495655_0152644_260_502 78
727 3300053085 Ga0495619_1066477 Ga0495619_1066477_180_416 78
728 3300053086 Ga0500578_0093282 Ga0500578_0093282_1573_1809 78
729 3300053130 Ga0500642_0049190 Ga0500642_0049190_1608_1844 78
730 3300053151 Ga0500604_0228985 Ga0500604_0228985_156_392 78
731 3300053155 Ga0500620_106883 Ga0500620_106883_575_811 78
732 3300061719 Ga0466962_0149282 Ga0466962_0149282_348_584 78
733 3300061719 Ga0466962_0183455 Ga0466962_0183455_769_1005 78
734 3300061719 Ga0466962_0368541 Ga0466962_0368541_348_584 78

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

19

90

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5csa-assembly1.cif.gz_A crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase 0.9421 5 77
5csa-assembly1.cif.gz_B crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase 0.94 5 77
2kcc-assembly1.cif.gz_A solution structure of biotinoyl domain from human acetyl-coa carboxylase 2 0.9363 4 78
2pnr-assembly2.cif.gz_G crystal structure of the asymmetric pdk3-l2 complex 0.9331 6 78
6g2d-assembly1.cif.gz_D citrate-induced acetyl-coa carboxylase (acc-cit) filament at 5.4 a resolution 0.9328 4 77
ID Description Score Start End Superfamily
af_P9WIS7_123_196_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9717 7 77 2.40.50.100
af_A0A1D6KPB2_40_143_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9612 2 76 2.40.50.100
af_Q2FYM2_1_102_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9597 5 78 2.40.50.100
af_A4I3X3_25_102_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9591 4 78 2.40.50.100
af_A0A0R0K6S7_676_747_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9571 16 78 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A031K6L3-F1-model_v4 Biotin/lipoyl attachment domain-containing protein 0.9967 3 77 GO:0005737
GO:0016407
GO:0031405
AF-A0A1A2P3P7-F1-model_v4 Dihydrolipoamide acyltransferase 0.9944 1 78 GO:0016746
AF-A0A6J7B039-F1-model_v4 Unannotated protein 0.9927 4 78 GO:0006086
GO:0045254
AF-A0A2U3PG49-F1-model_v4 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component 0.9924 1 78 GO:0016746
AF-A0A7C7Q232-F1-model_v4 Lipoyl-binding domain-containing protein 0.9923 2 77 GO:0006086
GO:0045254

Feature Viewer

pLDDT pTM Quality
90.8 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map