F478122
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 734 | 337 | 726 | 79 |
Family's Representative Sequence
| Representative Sequence | 3300005438|Ga0070701_11237876|Ga0070701_112378761 |
| Length | 92 |
| Sequence | LSRRRCGRWTLRAPVADFVIRIPRVSVAVSEAELTEILVNAGEHVEEGTPIYVIATEKVEQEIEAGASGTVQWTGQVGTTYDIGAEIGVITS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 3 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 4 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 5 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 6 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 7 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 16 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 17 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 18 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 58 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 104 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 134 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 135 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 136 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 137 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 208 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 209 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 211 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 219 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 220 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 221 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 222 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 223 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 224 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 225 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 226 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 227 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 228 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 229 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 230 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 231 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 232 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 233 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 234 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 235 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 236 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 237 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 242 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 243 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 244 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 245 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 246 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 247 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 248 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 249 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 250 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 251 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 291 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 292 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 293 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 294 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 319 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 320 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 321 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 323 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 325 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 331 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 334 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 335 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 336 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 337 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.91 |
| Metatranscriptomes | 0 |
| Isolates | 1.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.49 |
| Nodule | 0.54 |
| Rhizoplane | 9.81 |
| Rhizosphere | 76.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1003844 | 3300001977 | Bacteria | 2372 |
| 2 | JGI24747J21853_1040525 | 3300001978 | Bacteria | 551 |
| 3 | JGI24739J22299_10142746 | 3300001989 | Bacteria | 709 |
| 4 | JGI24739J22299_10167850 | 3300001989 | Bacteria | 647 |
| 5 | JGI24737J22298_10067153 | 3300001990 | Bacteria | 1073 |
| 6 | JGI24743J22301_10069859 | 3300001991 | Bacteria | 732 |
| 7 | JGI24750J21931_1010568 | 3300002070 | Bacteria | 1204 |
| 8 | JGI24750J21931_1014002 | 3300002070 | Bacteria | 1076 |
| 9 | JGI24745J21846_1003575 | 3300002073 | Bacteria | 1634 |
| 10 | JGI24738J21930_10102929 | 3300002075 | Bacteria | 610 |
| 11 | JGI24749J21850_1006529 | 3300002076 | Bacteria | 1625 |
| 12 | JGI24744J21845_10004148 | 3300002077 | Bacteria | 2987 |
| 13 | JGI24034J26672_10005717 | 3300002239 | Bacteria | 1787 |
| 14 | JGI24742J22300_10000982 | 3300002244 | Bacteria | 4370 |
| 15 | JGI24751J29686_10022339 | 3300002459 | Bacteria | 1313 |
| 16 | Ga0070676_10003809 | 3300005328 | Bacteria | 7914 |
| 17 | Ga0070676_10111686 | 3300005328 | Bacteria | 1703 |
| 18 | Ga0070683_100949319 | 3300005329 | Bacteria | 825 |
| 19 | Ga0070690_100143236 | 3300005330 | Bacteria | 1624 |
| 20 | Ga0070677_10293857 | 3300005333 | Bacteria | 823 |
| 21 | Ga0068869_100352668 | 3300005334 | Bacteria | 1200 |
| 22 | Ga0068869_101691055 | 3300005334 | Bacteria | 565 |
| 23 | Ga0070666_10027962 | 3300005335 | Bacteria | 3698 |
| 24 | Ga0070666_10138787 | 3300005335 | Bacteria | 1693 |
| 25 | Ga0070680_101358935 | 3300005336 | Bacteria | 615 |
| 26 | Ga0070682_100004846 | 3300005337 | Bacteria | 7474 |
| 27 | Ga0070682_100008532 | 3300005337 | Bacteria | 5787 |
| 28 | Ga0070682_100114231 | 3300005337 | Bacteria | 1804 |
| 29 | Ga0070682_100202482 | 3300005337 | Bacteria | 1401 |
| 30 | Ga0070682_102003385 | 3300005337 | Bacteria | 509 |
| 31 | Ga0068868_100006571 | 3300005338 | Bacteria | 8238 |
| 32 | Ga0068868_100050862 | 3300005338 | Bacteria | 3256 |
| 33 | Ga0068868_100225213 | 3300005338 | Bacteria | 1571 |
| 34 | Ga0070660_100308245 | 3300005339 | Bacteria | 1299 |
| 35 | Ga0070689_100017358 | 3300005340 | Bacteria | 5284 |
| 36 | Ga0070689_100695098 | 3300005340 | Bacteria | 888 |
| 37 | Ga0070689_102047397 | 3300005340 | Bacteria | 524 |
| 38 | Ga0070691_10011557 | 3300005341 | Bacteria | 4033 |
| 39 | Ga0070691_11014694 | 3300005341 | Bacteria | 518 |
| 40 | Ga0070687_100053109 | 3300005343 | Bacteria | 2106 |
| 41 | Ga0070687_100553947 | 3300005343 | Bacteria | 783 |
| 42 | Ga0070661_100944430 | 3300005344 | Bacteria | 713 |
| 43 | Ga0070668_100017633 | 3300005347 | Bacteria | 5353 |
| 44 | Ga0070668_100461139 | 3300005347 | Bacteria | 1094 |
| 45 | Ga0070668_100755082 | 3300005347 | Bacteria | 861 |
| 46 | Ga0070669_100121698 | 3300005353 | Bacteria | 1992 |
| 47 | Ga0070669_100803285 | 3300005353 | Bacteria | 800 |
| 48 | Ga0070669_101106707 | 3300005353 | Bacteria | 682 |
| 49 | Ga0070675_100050003 | 3300005354 | Bacteria | 3432 |
| 50 | Ga0070675_100215175 | 3300005354 | Bacteria | 1672 |
| 51 | Ga0070671_100007747 | 3300005355 | Bacteria | 8580 |
| 52 | Ga0070671_100817756 | 3300005355 | Bacteria | 812 |
| 53 | Ga0070674_100000125 | 3300005356 | Bacteria | 35199 |
| 54 | Ga0070674_100618146 | 3300005356 | Bacteria | 918 |
| 55 | Ga0070674_101103215 | 3300005356 | Bacteria | 701 |
| 56 | Ga0070673_100462271 | 3300005364 | Bacteria | 1143 |
| 57 | Ga0070688_100015022 | 3300005365 | Bacteria | 4396 |
| 58 | Ga0070688_100017298 | 3300005365 | Bacteria | 4136 |
| 59 | Ga0070688_100383610 | 3300005365 | Bacteria | 1036 |
| 60 | Ga0070659_100491028 | 3300005366 | Bacteria | 1046 |
| 61 | Ga0070659_101600805 | 3300005366 | Bacteria | 581 |
| 62 | Ga0070667_100000056 | 3300005367 | Bacteria | 150952 |
| 63 | Ga0070667_100001317 | 3300005367 | Bacteria | 22315 |
| 64 | Ga0070667_100008096 | 3300005367 | Bacteria | 8717 |
| 65 | Ga0070667_100516773 | 3300005367 | Bacteria | 1096 |
| 66 | Ga0070667_101841691 | 3300005367 | Bacteria | 570 |
| 67 | Ga0070703_10618581 | 3300005406 | Bacteria | 502 |
| 68 | Ga0070709_10038393 | 3300005434 | Bacteria | 2932 |
| 69 | Ga0070709_10131988 | 3300005434 | Bacteria | 1706 |
| 70 | Ga0070714_100033072 | 3300005435 | Bacteria | 4321 |
| 71 | Ga0070714_100417176 | 3300005435 | Bacteria | 1271 |
| 72 | Ga0070713_100021734 | 3300005436 | Bacteria | 4943 |
| 73 | Ga0070710_10000890 | 3300005437 | Bacteria | 14275 |
| 74 | Ga0070710_10360544 | 3300005437 | Bacteria | 965 |
| 75 | Ga0070701_10002203 | 3300005438 | Bacteria | 7440 |
| 76 | Ga0070701_10079012 | 3300005438 | Bacteria | 1777 |
| 77 | Ga0070701_11237876 | 3300005438 | Bacteria | 531 |
| 78 | Ga0070711_100000244 | 3300005439 | Bacteria | 27954 |
| 79 | Ga0070711_100002056 | 3300005439 | Bacteria | 11342 |
| 80 | Ga0070711_101140039 | 3300005439 | Bacteria | 673 |
| 81 | Ga0070705_100003441 | 3300005440 | Bacteria | 7762 |
| 82 | Ga0070705_100803031 | 3300005440 | Bacteria | 749 |
| 83 | Ga0070700_100038052 | 3300005441 | Bacteria | 2930 |
| 84 | Ga0070700_100042260 | 3300005441 | Bacteria | 2798 |
| 85 | Ga0070694_100012110 | 3300005444 | Bacteria | 5357 |
| 86 | Ga0070694_101882304 | 3300005444 | Bacteria | 511 |
| 87 | Ga0070708_100474824 | 3300005445 | Bacteria | 1180 |
| 88 | Ga0070663_100006113 | 3300005455 | Bacteria | 7204 |
| 89 | Ga0070663_100038377 | 3300005455 | Bacteria | 3341 |
| 90 | Ga0070678_100001944 | 3300005456 | Bacteria | 11148 |
| 91 | Ga0070678_100087424 | 3300005456 | Bacteria | 2380 |
| 92 | Ga0070662_100004850 | 3300005457 | Bacteria | 8530 |
| 93 | Ga0070662_100732064 | 3300005457 | Bacteria | 838 |
| 94 | Ga0070681_11110476 | 3300005458 | Bacteria | 712 |
| 95 | Ga0068867_100002467 | 3300005459 | Bacteria | 13007 |
| 96 | Ga0068867_100222207 | 3300005459 | Bacteria | 1523 |
| 97 | Ga0070685_10027360 | 3300005466 | Bacteria | 3151 |
| 98 | Ga0070685_10156666 | 3300005466 | Bacteria | 1448 |
| 99 | Ga0070679_100254143 | 3300005530 | Bacteria | 1713 |
| 100 | Ga0070684_100899269 | 3300005535 | Bacteria | 829 |
| 101 | Ga0068853_100998417 | 3300005539 | Bacteria | 806 |
| 102 | Ga0070672_100171461 | 3300005543 | Bacteria | 1805 |
| 103 | Ga0070672_100597421 | 3300005543 | Bacteria | 961 |
| 104 | Ga0070686_100119173 | 3300005544 | Bacteria | 1810 |
| 105 | Ga0070695_100046005 | 3300005545 | Bacteria | 2784 |
| 106 | Ga0070695_100237823 | 3300005545 | Bacteria | 1320 |
| 107 | Ga0070696_100004673 | 3300005546 | Bacteria | 9147 |
| 108 | Ga0070693_100044051 | 3300005547 | Bacteria | 2523 |
| 109 | Ga0070693_100051890 | 3300005547 | Bacteria | 2350 |
| 110 | Ga0070693_100356719 | 3300005547 | Bacteria | 1002 |
| 111 | Ga0070665_100002065 | 3300005548 | Bacteria | 22532 |
| 112 | Ga0070665_100018546 | 3300005548 | Bacteria | 6973 |
| 113 | Ga0070665_100125228 | 3300005548 | Bacteria | 2572 |
| 114 | Ga0070665_100132369 | 3300005548 | Bacteria | 2496 |
| 115 | Ga0070704_100044657 | 3300005549 | Bacteria | 3081 |
| 116 | Ga0068855_100202858 | 3300005563 | Bacteria | 2232 |
| 117 | Ga0068855_101754197 | 3300005563 | Bacteria | 632 |
| 118 | Ga0068854_100000659 | 3300005578 | Bacteria | 20556 |
| 119 | Ga0068854_100059346 | 3300005578 | Bacteria | 2764 |
| 120 | Ga0068854_100168774 | 3300005578 | Bacteria | 1701 |
| 121 | Ga0068856_100821730 | 3300005614 | Bacteria | 949 |
| 122 | Ga0070702_100091209 | 3300005615 | Bacteria | 1848 |
| 123 | Ga0068852_100029304 | 3300005616 | Bacteria | 4520 |
| 124 | Ga0068852_100636864 | 3300005616 | Bacteria | 1073 |
| 125 | Ga0068852_100808859 | 3300005616 | Bacteria | 952 |
| 126 | Ga0068859_100000801 | 3300005617 | Bacteria | 31888 |
| 127 | Ga0068859_100001161 | 3300005617 | Bacteria | 26914 |
| 128 | Ga0068859_103058062 | 3300005617 | Bacteria | 510 |
| 129 | Ga0068864_100058296 | 3300005618 | Bacteria | 3337 |
| 130 | Ga0068864_101413687 | 3300005618 | Bacteria | 698 |
| 131 | Ga0068866_10003532 | 3300005718 | Bacteria | 6402 |
| 132 | Ga0068866_10009379 | 3300005718 | Bacteria | 4153 |
| 133 | Ga0068861_100002743 | 3300005719 | Bacteria | 11538 |
| 134 | Ga0068861_100802914 | 3300005719 | Bacteria | 883 |
| 135 | Ga0068861_101001818 | 3300005719 | Bacteria | 797 |
| 136 | Ga0068861_101870850 | 3300005719 | Bacteria | 596 |
| 137 | Ga0068861_102321736 | 3300005719 | Bacteria | 538 |
| 138 | Ga0068870_11356155 | 3300005840 | Bacteria | 520 |
| 139 | Ga0068863_100001477 | 3300005841 | Bacteria | 23298 |
| 140 | Ga0068863_100008103 | 3300005841 | Bacteria | 10254 |
| 141 | Ga0068858_100005735 | 3300005842 | Bacteria | 12134 |
| 142 | Ga0068858_100065066 | 3300005842 | Bacteria | 3374 |
| 143 | Ga0068860_100000092 | 3300005843 | Bacteria | 150190 |
| 144 | Ga0068860_100000743 | 3300005843 | Bacteria | 37175 |
| 145 | Ga0068860_100127206 | 3300005843 | Bacteria | 2442 |
| 146 | Ga0068860_100432761 | 3300005843 | Bacteria | 1306 |
| 147 | Ga0068862_100000035 | 3300005844 | Bacteria | 174953 |
| 148 | Ga0068862_100001026 | 3300005844 | Bacteria | 26891 |
| 149 | Ga0068862_100270806 | 3300005844 | Bacteria | 1553 |
| 150 | Ga0068862_100580203 | 3300005844 | Bacteria | 1074 |
| 151 | Ga0068862_102291687 | 3300005844 | Bacteria | 552 |
| 152 | Ga0081455_10057421 | 3300005937 | Bacteria | 3298 |
| 153 | Ga0081455_10345322 | 3300005937 | Bacteria | 1052 |
| 154 | Ga0081538_10093999 | 3300005981 | Bacteria | 1537 |
| 155 | Ga0075365_10018897 | 3300006038 | Bacteria | 4244 |
| 156 | Ga0075368_10168052 | 3300006042 | Bacteria | 921 |
| 157 | Ga0075368_10528402 | 3300006042 | Bacteria | 528 |
| 158 | Ga0075363_100001319 | 3300006048 | Bacteria | 9277 |
| 159 | Ga0075363_100003961 | 3300006048 | Bacteria | 6399 |
| 160 | Ga0075363_100005296 | 3300006048 | Bacteria | 5725 |
| 161 | Ga0075363_100017527 | 3300006048 | Bacteria | 3553 |
| 162 | Ga0075363_100060736 | 3300006048 | Bacteria | 2036 |
| 163 | Ga0075363_100464694 | 3300006048 | Bacteria | 749 |
| 164 | Ga0075363_100514708 | 3300006048 | Bacteria | 712 |
| 165 | Ga0075364_10002016 | 3300006051 | Bacteria | 11320 |
| 166 | Ga0075364_10164966 | 3300006051 | Bacteria | 1496 |
| 167 | Ga0070715_10007687 | 3300006163 | Bacteria | 3723 |
| 168 | Ga0070715_10039854 | 3300006163 | Bacteria | 1960 |
| 169 | Ga0070715_10200384 | 3300006163 | Bacteria | 1014 |
| 170 | Ga0070716_100001677 | 3300006173 | Bacteria | 9996 |
| 171 | Ga0070716_100014528 | 3300006173 | Bacteria | 4034 |
| 172 | Ga0070716_100021378 | 3300006173 | Bacteria | 3409 |
| 173 | Ga0070712_100002977 | 3300006175 | Bacteria | 10484 |
| 174 | Ga0070712_100135898 | 3300006175 | Bacteria | 1869 |
| 175 | Ga0075367_10112952 | 3300006178 | Bacteria | 1669 |
| 176 | Ga0075369_10011236 | 3300006186 | Bacteria | 3520 |
| 177 | Ga0075369_10026716 | 3300006186 | Bacteria | 2408 |
| 178 | Ga0075369_10031671 | 3300006186 | Bacteria | 2234 |
| 179 | Ga0075369_10454059 | 3300006186 | Bacteria | 607 |
| 180 | Ga0097621_100039034 | 3300006237 | Bacteria | 3812 |
| 181 | Ga0097621_100852837 | 3300006237 | Bacteria | 846 |
| 182 | Ga0075370_10007593 | 3300006353 | Bacteria | 5530 |
| 183 | Ga0075370_10129248 | 3300006353 | Bacteria | 1473 |
| 184 | Ga0075370_10520229 | 3300006353 | Bacteria | 719 |
| 185 | Ga0068871_100049221 | 3300006358 | Bacteria | 3406 |
| 186 | Ga0075428_100017974 | 3300006844 | Bacteria | 7813 |
| 187 | Ga0075430_100018968 | 3300006846 | Bacteria | 5852 |
| 188 | Ga0075430_100063237 | 3300006846 | Bacteria | 3109 |
| 189 | Ga0075431_100026875 | 3300006847 | Bacteria | 5904 |
| 190 | Ga0068865_100003557 | 3300006881 | Bacteria | 9354 |
| 191 | Ga0068865_100946340 | 3300006881 | Bacteria | 751 |
| 192 | Ga0075436_100773281 | 3300006914 | Bacteria | 714 |
| 193 | Ga0097620_100000801 | 3300006931 | Bacteria | 31888 |
| 194 | Ga0097620_100001161 | 3300006931 | Bacteria | 26914 |
| 195 | Ga0097620_103058010 | 3300006931 | Bacteria | 510 |
| 196 | Ga0099795_10227932 | 3300007788 | Bacteria | 795 |
| 197 | Ga0099795_10293691 | 3300007788 | Bacteria | 713 |
| 198 | Ga0105250_10062397 | 3300009092 | Bacteria | 1499 |
| 199 | Ga0105240_10209469 | 3300009093 | Bacteria | 2279 |
| 200 | Ga0105240_10701408 | 3300009093 | Bacteria | 1105 |
| 201 | Ga0111539_10665372 | 3300009094 | Bacteria | 1212 |
| 202 | Ga0111539_13363862 | 3300009094 | Bacteria | 514 |
| 203 | Ga0105245_10004088 | 3300009098 | Bacteria | 12951 |
| 204 | Ga0105245_10266341 | 3300009098 | Bacteria | 1669 |
| 205 | Ga0105245_10477959 | 3300009098 | Bacteria | 1259 |
| 206 | Ga0105247_10000062 | 3300009101 | Bacteria | 126437 |
| 207 | Ga0105247_10000806 | 3300009101 | Bacteria | 23917 |
| 208 | Ga0105247_10107295 | 3300009101 | Bacteria | 1793 |
| 209 | Ga0114129_10046799 | 3300009147 | Bacteria | 6078 |
| 210 | Ga0114129_10691953 | 3300009147 | Bacteria | 1311 |
| 211 | Ga0105243_10003563 | 3300009148 | Bacteria | 12569 |
| 212 | Ga0105243_10018727 | 3300009148 | Bacteria | 5245 |
| 213 | Ga0105241_10057026 | 3300009174 | Bacteria | 2995 |
| 214 | Ga0105241_11621191 | 3300009174 | Bacteria | 626 |
| 215 | Ga0105241_12045680 | 3300009174 | Bacteria | 565 |
| 216 | Ga0105241_12233381 | 3300009174 | Bacteria | 543 |
| 217 | Ga0105242_10007246 | 3300009176 | Bacteria | 8550 |
| 218 | Ga0105242_10099489 | 3300009176 | Bacteria | 2461 |
| 219 | Ga0105242_11233799 | 3300009176 | Bacteria | 768 |
| 220 | Ga0105248_10000036 | 3300009177 | Bacteria | 187421 |
| 221 | Ga0105248_10000634 | 3300009177 | Bacteria | 39924 |
| 222 | Ga0105248_10553936 | 3300009177 | Bacteria | 1297 |
| 223 | Ga0105248_10754286 | 3300009177 | Bacteria | 1098 |
| 224 | Ga0105248_10767147 | 3300009177 | Bacteria | 1088 |
| 225 | Ga0105237_10111323 | 3300009545 | Bacteria | 2730 |
| 226 | Ga0105237_10129714 | 3300009545 | Bacteria | 2516 |
| 227 | Ga0105237_10701180 | 3300009545 | Bacteria | 1019 |
| 228 | Ga0105238_10222721 | 3300009551 | Bacteria | 1863 |
| 229 | Ga0105238_11123542 | 3300009551 | Bacteria | 809 |
| 230 | Ga0105249_10000046 | 3300009553 | Bacteria | 176363 |
| 231 | Ga0105249_10001173 | 3300009553 | Bacteria | 23210 |
| 232 | Ga0105249_10049221 | 3300009553 | Bacteria | 3843 |
| 233 | Ga0105249_11959758 | 3300009553 | Bacteria | 658 |
| 234 | Ga0099796_10085731 | 3300010159 | Bacteria | 1163 |
| 235 | Ga0099796_10127969 | 3300010159 | Bacteria | 982 |
| 236 | Ga0105239_10003767 | 3300010375 | Bacteria | 18446 |
| 237 | Ga0105239_10111843 | 3300010375 | Bacteria | 3028 |
| 238 | Ga0105239_10591824 | 3300010375 | Bacteria | 1265 |
| 239 | Ga0105239_12893421 | 3300010375 | Bacteria | 560 |
| 240 | Ga0105246_10058357 | 3300011119 | Bacteria | 2673 |
| 241 | Ga0105246_10963103 | 3300011119 | Bacteria | 770 |
| 242 | Ga0105246_11025176 | 3300011119 | Bacteria | 749 |
| 243 | Ga0105246_12254920 | 3300011119 | Bacteria | 531 |
| 244 | Ga0157373_10522362 | 3300013100 | Bacteria | 859 |
| 245 | Ga0157369_10497233 | 3300013105 | Bacteria | 1262 |
| 246 | Ga0157374_10059129 | 3300013296 | Bacteria | 3583 |
| 247 | Ga0157378_10004246 | 3300013297 | Bacteria | 12635 |
| 248 | Ga0157378_10271142 | 3300013297 | Bacteria | 1632 |
| 249 | Ga0163162_10024496 | 3300013306 | Bacteria | 5956 |
| 250 | Ga0163162_10154319 | 3300013306 | Bacteria | 2415 |
| 251 | Ga0163162_10419971 | 3300013306 | Bacteria | 1470 |
| 252 | Ga0163162_10529598 | 3300013306 | Bacteria | 1307 |
| 253 | Ga0163162_10678895 | 3300013306 | Bacteria | 1153 |
| 254 | Ga0163162_10819523 | 3300013306 | Bacteria | 1047 |
| 255 | Ga0163162_11571371 | 3300013306 | Bacteria | 750 |
| 256 | Ga0163162_13154370 | 3300013306 | Bacteria | 529 |
| 257 | Ga0157372_10001604 | 3300013307 | Bacteria | 24551 |
| 258 | Ga0157372_10473707 | 3300013307 | Bacteria | 1460 |
| 259 | Ga0157372_10519610 | 3300013307 | Bacteria | 1388 |
| 260 | Ga0157375_10000618 | 3300013308 | Bacteria | 31552 |
| 261 | Ga0157375_10780559 | 3300013308 | Bacteria | 1105 |
| 262 | Ga0157375_13141042 | 3300013308 | Bacteria | 551 |
| 263 | Ga0157375_13165848 | 3300013308 | Bacteria | 549 |
| 264 | Ga0163163_10010547 | 3300014325 | Bacteria | 8316 |
| 265 | Ga0163163_10012529 | 3300014325 | Bacteria | 7732 |
| 266 | Ga0163163_10694615 | 3300014325 | Bacteria | 1081 |
| 267 | Ga0163163_10719066 | 3300014325 | Bacteria | 1062 |
| 268 | Ga0157380_10000392 | 3300014326 | Bacteria | 26452 |
| 269 | Ga0157380_10144014 | 3300014326 | Bacteria | 2051 |
| 270 | Ga0157377_10001431 | 3300014745 | Bacteria | 10293 |
| 271 | Ga0157379_10028061 | 3300014968 | Bacteria | 5010 |
| 272 | Ga0157379_10075352 | 3300014968 | Bacteria | 3021 |
| 273 | Ga0157376_10117550 | 3300014969 | Bacteria | 2351 |
| 274 | Ga0157376_10723711 | 3300014969 | Bacteria | 1002 |
| 275 | Ga0163161_10016460 | 3300017792 | Bacteria | 5162 |
| 276 | Ga0163161_10070881 | 3300017792 | Bacteria | 2549 |
| 277 | Ga0163161_10218509 | 3300017792 | Bacteria | 1475 |
| 278 | Ga0163161_10379412 | 3300017792 | Bacteria | 1130 |
| 279 | Ga0213872_10333460 | 3300021361 | Bacteria | 625 |
| 280 | Ga0213874_10155723 | 3300021377 | Bacteria | 800 |
| 281 | Ga0213874_10378954 | 3300021377 | Bacteria | 547 |
| 282 | Ga0213876_10002020 | 3300021384 | Bacteria | 12119 |
| 283 | Ga0213876_10201969 | 3300021384 | Bacteria | 1057 |
| 284 | Ga0213875_10011877 | 3300021388 | Bacteria | 4318 |
| 285 | Ga0213875_10621076 | 3300021388 | Bacteria | 523 |
| 286 | Ga0207672_1003246 | 3300025223 | Bacteria | 934 |
| 287 | Ga0207696_1047401 | 3300025711 | Bacteria | 1238 |
| 288 | Ga0207653_10028251 | 3300025885 | Bacteria | 1804 |
| 289 | Ga0207682_10201039 | 3300025893 | Bacteria | 916 |
| 290 | Ga0207692_10009413 | 3300025898 | Bacteria | 4081 |
| 291 | Ga0207692_10024317 | 3300025898 | Bacteria | 2815 |
| 292 | Ga0207692_11096842 | 3300025898 | Bacteria | 527 |
| 293 | Ga0207642_10000167 | 3300025899 | Bacteria | 18730 |
| 294 | Ga0207642_10011950 | 3300025899 | Bacteria | 3117 |
| 295 | Ga0207710_10000060 | 3300025900 | Bacteria | 168230 |
| 296 | Ga0207710_10002164 | 3300025900 | Bacteria | 9233 |
| 297 | Ga0207688_10002083 | 3300025901 | Bacteria | 10748 |
| 298 | Ga0207688_10002935 | 3300025901 | Bacteria | 9273 |
| 299 | Ga0207688_10308502 | 3300025901 | Bacteria | 969 |
| 300 | Ga0207688_10464274 | 3300025901 | Bacteria | 790 |
| 301 | Ga0207680_10227594 | 3300025903 | Bacteria | 1281 |
| 302 | Ga0207680_10356304 | 3300025903 | Bacteria | 1028 |
| 303 | Ga0207647_10110703 | 3300025904 | Bacteria | 1624 |
| 304 | Ga0207647_10123121 | 3300025904 | Bacteria | 1528 |
| 305 | Ga0207685_10001566 | 3300025905 | Bacteria | 4871 |
| 306 | Ga0207685_10011806 | 3300025905 | Bacteria | 2642 |
| 307 | Ga0207699_10043101 | 3300025906 | Bacteria | 2620 |
| 308 | Ga0207699_10324815 | 3300025906 | Bacteria | 1080 |
| 309 | Ga0207645_10006460 | 3300025907 | Bacteria | 8410 |
| 310 | Ga0207654_10105711 | 3300025911 | Bacteria | 1742 |
| 311 | Ga0207707_11039206 | 3300025912 | Bacteria | 670 |
| 312 | Ga0207671_10460298 | 3300025914 | Bacteria | 1013 |
| 313 | Ga0207693_10001382 | 3300025915 | Bacteria | 21519 |
| 314 | Ga0207693_10001847 | 3300025915 | Bacteria | 18553 |
| 315 | Ga0207693_10429275 | 3300025915 | Bacteria | 1033 |
| 316 | Ga0207663_10002032 | 3300025916 | Bacteria | 9618 |
| 317 | Ga0207663_10011241 | 3300025916 | Bacteria | 4801 |
| 318 | Ga0207662_10057183 | 3300025918 | Bacteria | 2330 |
| 319 | Ga0207662_10455245 | 3300025918 | Bacteria | 875 |
| 320 | Ga0207657_10053439 | 3300025919 | Bacteria | 3499 |
| 321 | Ga0207657_10297913 | 3300025919 | Bacteria | 1278 |
| 322 | Ga0207652_10550576 | 3300025921 | Bacteria | 1037 |
| 323 | Ga0207681_10014914 | 3300025923 | Bacteria | 4840 |
| 324 | Ga0207681_10048026 | 3300025923 | Bacteria | 2879 |
| 325 | Ga0207694_11042688 | 3300025924 | Bacteria | 692 |
| 326 | Ga0207650_11906520 | 3300025925 | Bacteria | 502 |
| 327 | Ga0207659_10216495 | 3300025926 | Bacteria | 1537 |
| 328 | Ga0207687_10006868 | 3300025927 | Bacteria | 7497 |
| 329 | Ga0207687_10055429 | 3300025927 | Bacteria | 2778 |
| 330 | Ga0207687_10520984 | 3300025927 | Bacteria | 994 |
| 331 | Ga0207687_11082534 | 3300025927 | Bacteria | 688 |
| 332 | Ga0207700_10934600 | 3300025928 | Bacteria | 776 |
| 333 | Ga0207664_10170042 | 3300025929 | Bacteria | 1865 |
| 334 | Ga0207664_10273554 | 3300025929 | Bacteria | 1480 |
| 335 | Ga0207664_11607051 | 3300025929 | Bacteria | 572 |
| 336 | Ga0207644_10013536 | 3300025931 | Bacteria | 5441 |
| 337 | Ga0207690_10013779 | 3300025932 | Bacteria | 4868 |
| 338 | Ga0207690_11112989 | 3300025932 | Bacteria | 658 |
| 339 | Ga0207706_10007224 | 3300025933 | Bacteria | 10270 |
| 340 | Ga0207686_10001374 | 3300025934 | Bacteria | 13815 |
| 341 | Ga0207686_10864728 | 3300025934 | Bacteria | 728 |
| 342 | Ga0207686_11295226 | 3300025934 | Bacteria | 598 |
| 343 | Ga0207709_10004392 | 3300025935 | Bacteria | 8164 |
| 344 | Ga0207709_10060986 | 3300025935 | Bacteria | 2355 |
| 345 | Ga0207670_10166891 | 3300025936 | Bacteria | 1648 |
| 346 | Ga0207670_11612016 | 3300025936 | Bacteria | 552 |
| 347 | Ga0207669_10002459 | 3300025937 | Bacteria | 7909 |
| 348 | Ga0207669_10850045 | 3300025937 | Bacteria | 759 |
| 349 | Ga0207704_10000782 | 3300025938 | Bacteria | 14026 |
| 350 | Ga0207704_10255994 | 3300025938 | Bacteria | 1317 |
| 351 | Ga0207665_10002538 | 3300025939 | Bacteria | 12277 |
| 352 | Ga0207665_10009183 | 3300025939 | Bacteria | 6493 |
| 353 | Ga0207665_10238527 | 3300025939 | Bacteria | 1339 |
| 354 | Ga0207665_10464640 | 3300025939 | Bacteria | 973 |
| 355 | Ga0207711_10000202 | 3300025941 | Bacteria | 63414 |
| 356 | Ga0207711_10034656 | 3300025941 | Bacteria | 4275 |
| 357 | Ga0207711_10196945 | 3300025941 | Bacteria | 1838 |
| 358 | Ga0207689_10026005 | 3300025942 | Bacteria | 4901 |
| 359 | Ga0207689_11229313 | 3300025942 | Bacteria | 630 |
| 360 | Ga0207661_10534907 | 3300025944 | Bacteria | 1073 |
| 361 | Ga0207667_10438704 | 3300025949 | Bacteria | 1328 |
| 362 | Ga0207667_10748967 | 3300025949 | Bacteria | 976 |
| 363 | Ga0207651_10336513 | 3300025960 | Bacteria | 1267 |
| 364 | Ga0207651_10377840 | 3300025960 | Bacteria | 1200 |
| 365 | Ga0207712_10000042 | 3300025961 | Bacteria | 176338 |
| 366 | Ga0207712_10008647 | 3300025961 | Bacteria | 6438 |
| 367 | Ga0207712_10065648 | 3300025961 | Bacteria | 2591 |
| 368 | Ga0207712_10370364 | 3300025961 | Bacteria | 1196 |
| 369 | Ga0207712_11190356 | 3300025961 | Bacteria | 680 |
| 370 | Ga0207668_10011924 | 3300025972 | Bacteria | 5302 |
| 371 | Ga0207668_10111900 | 3300025972 | Bacteria | 2050 |
| 372 | Ga0207668_11357484 | 3300025972 | Bacteria | 640 |
| 373 | Ga0207640_10004834 | 3300025981 | Bacteria | 7314 |
| 374 | Ga0207640_10182979 | 3300025981 | Bacteria | 1573 |
| 375 | Ga0207640_10522786 | 3300025981 | Bacteria | 992 |
| 376 | Ga0207658_10000409 | 3300025986 | Bacteria | 40927 |
| 377 | Ga0207658_10010952 | 3300025986 | Bacteria | 6174 |
| 378 | Ga0207658_10161563 | 3300025986 | Bacteria | 1836 |
| 379 | Ga0207658_10263243 | 3300025986 | Bacteria | 1470 |
| 380 | Ga0207658_11474042 | 3300025986 | Bacteria | 622 |
| 381 | Ga0207677_10004948 | 3300026023 | Bacteria | 7194 |
| 382 | Ga0207677_10031317 | 3300026023 | Bacteria | 3406 |
| 383 | Ga0207677_10437664 | 3300026023 | Bacteria | 1117 |
| 384 | Ga0207703_10010438 | 3300026035 | Bacteria | 7263 |
| 385 | Ga0207703_10210689 | 3300026035 | Bacteria | 1732 |
| 386 | Ga0207703_10335301 | 3300026035 | Bacteria | 1388 |
| 387 | Ga0207703_11463870 | 3300026035 | Bacteria | 657 |
| 388 | Ga0207639_10039781 | 3300026041 | Bacteria | 3506 |
| 389 | Ga0207639_10497629 | 3300026041 | Bacteria | 1113 |
| 390 | Ga0207678_10006686 | 3300026067 | Bacteria | 10223 |
| 391 | Ga0207678_10015033 | 3300026067 | Bacteria | 6810 |
| 392 | Ga0207708_10004516 | 3300026075 | Bacteria | 10238 |
| 393 | Ga0207708_10052632 | 3300026075 | Bacteria | 3101 |
| 394 | Ga0207708_10268385 | 3300026075 | Bacteria | 1379 |
| 395 | Ga0207708_10623401 | 3300026075 | Bacteria | 916 |
| 396 | Ga0207702_10386599 | 3300026078 | Bacteria | 1346 |
| 397 | Ga0207641_10007933 | 3300026088 | Bacteria | 8805 |
| 398 | Ga0207641_10009388 | 3300026088 | Bacteria | 8061 |
| 399 | Ga0207641_10093421 | 3300026088 | Bacteria | 2637 |
| 400 | Ga0207648_10004400 | 3300026089 | Bacteria | 14473 |
| 401 | Ga0207648_10122222 | 3300026089 | Bacteria | 2289 |
| 402 | Ga0207676_10207378 | 3300026095 | Bacteria | 1736 |
| 403 | Ga0207676_10696378 | 3300026095 | Bacteria | 984 |
| 404 | Ga0207676_11563999 | 3300026095 | Bacteria | 657 |
| 405 | Ga0207675_100000419 | 3300026118 | Bacteria | 41020 |
| 406 | Ga0207675_100085853 | 3300026118 | Bacteria | 2954 |
| 407 | Ga0207675_101726178 | 3300026118 | Bacteria | 646 |
| 408 | Ga0207683_10000386 | 3300026121 | Bacteria | 40766 |
| 409 | Ga0207683_10096016 | 3300026121 | Bacteria | 2643 |
| 410 | Ga0207698_10187837 | 3300026142 | Bacteria | 1837 |
| 411 | Ga0207698_10344979 | 3300026142 | Bacteria | 1404 |
| 412 | Ga0209813_10133789 | 3300027866 | Bacteria | 874 |
| 413 | Ga0268266_10015538 | 3300028379 | Bacteria | 6528 |
| 414 | Ga0268266_10020057 | 3300028379 | Bacteria | 5698 |
| 415 | Ga0268266_10033092 | 3300028379 | Bacteria | 4396 |
| 416 | Ga0268265_10000051 | 3300028380 | Bacteria | 174968 |
| 417 | Ga0268265_10006561 | 3300028380 | Bacteria | 7874 |
| 418 | Ga0268265_10188270 | 3300028380 | Bacteria | 1780 |
| 419 | Ga0268265_10197437 | 3300028380 | Bacteria | 1742 |
| 420 | Ga0268265_10524320 | 3300028380 | Bacteria | 1120 |
| 421 | Ga0268265_11726196 | 3300028380 | Bacteria | 632 |
| 422 | Ga0268264_10000108 | 3300028381 | Bacteria | 208791 |
| 423 | Ga0268264_10019336 | 3300028381 | Bacteria | 5566 |
| 424 | Ga0268264_10181326 | 3300028381 | Bacteria | 1913 |
| 425 | Ga0268264_10258218 | 3300028381 | Bacteria | 1622 |
| 426 | Ga0268264_11229131 | 3300028381 | Bacteria | 759 |
| 427 | Ga0268264_11319055 | 3300028381 | Bacteria | 732 |
| 428 | Ga0307410_10002941 | 3300031852 | Bacteria | 8400 |
| 429 | Ga0307410_10160464 | 3300031852 | Bacteria | 1684 |
| 430 | Ga0307410_11374609 | 3300031852 | Bacteria | 619 |
| 431 | Ga0307406_10037252 | 3300031901 | Bacteria | 3003 |
| 432 | Ga0307407_10169413 | 3300031903 | Bacteria | 1437 |
| 433 | Ga0307407_10706202 | 3300031903 | Bacteria | 760 |
| 434 | Ga0307409_100117999 | 3300031995 | Bacteria | 2240 |
| 435 | Ga0307409_100516895 | 3300031995 | Bacteria | 1166 |
| 436 | Ga0307409_101360740 | 3300031995 | Bacteria | 736 |
| 437 | Ga0307416_100239307 | 3300032002 | Bacteria | 1757 |
| 438 | Ga0307416_101046657 | 3300032002 | Bacteria | 920 |
| 439 | Ga0307414_10329339 | 3300032004 | Bacteria | 1303 |
| 440 | Ga0307411_10010708 | 3300032005 | Bacteria | 4904 |
| 441 | Ga0307411_10844074 | 3300032005 | Bacteria | 810 |
| 442 | Ga0307415_100191992 | 3300032126 | Bacteria | 1612 |
| 443 | Ga0373958_0075028 | 3300034819 | Bacteria | 757 |
| 444 | Ga0373938_0161466 | 3300034957 | Bacteria | 602 |
| 445 | Ga0373951_0108321 | 3300035091 | Bacteria | 745 |
| 446 | Ga0373939_0126951 | 3300035114 | Bacteria | 906 |
| 447 | Ga0373941_0068426 | 3300035115 | Bacteria | 1173 |
| 448 | Ga0373960_0032858 | 3300035121 | Bacteria | 1459 |
| 449 | Ga0373931_0007355 | 3300035691 | Bacteria | 5184 |
| 450 | Ga0373931_0172817 | 3300035691 | Bacteria | 1274 |
| 451 | Ga0373947_0413402 | 3300035725 | Bacteria | 911 |
| 452 | Ga0373925_0720096 | 3300037068 | Bacteria | 823 |
| 453 | Ga0395898_1044394 | 3300037466 | Bacteria | 752 |
| 454 | Ga0395905_0656641 | 3300037471 | Bacteria | 951 |
| 455 | Ga0436364_0210802 | 3300037853 | Bacteria | 2295 |
| 456 | Ga0436364_0665239 | 3300037853 | Bacteria | 42065 |
| 457 | Ga0436364_0740200 | 3300037853 | Bacteria | 725 |
| 458 | Ga0436364_1035203 | 3300037853 | Bacteria | 776 |
| 459 | Ga0436365_0085052 | 3300039437 | Bacteria | 14182 |
| 460 | Ga0436365_0411865 | 3300039437 | Bacteria | 16194 |
| 461 | Ga0436365_0922410 | 3300039437 | Bacteria | 2846 |
| 462 | Ga0436365_1355905 | 3300039437 | Bacteria | 26021 |
| 463 | Ga0436360_0892117 | 3300039438 | Bacteria | 2189 |
| 464 | Ga0436361_0217454 | 3300039447 | Bacteria | 785 |
| 465 | Ga0436361_0492283 | 3300039447 | Bacteria | 848 |
| 466 | Ga0436363_0141792 | 3300039450 | Bacteria | 555 |
| 467 | Ga0436363_0669183 | 3300039450 | Bacteria | 797 |
| 468 | Ga0436363_0829327 | 3300039450 | Bacteria | 840 |
| 469 | Ga0436363_0861738 | 3300039450 | Bacteria | 669 |
| 470 | Ga0436363_1362967 | 3300039450 | Bacteria | 1680 |
| 471 | Ga0436363_1519424 | 3300039450 | Bacteria | 2600 |
| 472 | Ga0436363_1702584 | 3300039450 | Bacteria | 1416 |
| 473 | Ga0436362_1160607 | 3300039453 | Bacteria | 500 |
| 474 | Ga0439461_0012051 | 3300041410 | Bacteria | 1614 |
| 475 | Ga0439466_0001413 | 3300041411 | Bacteria | 9363 |
| 476 | Ga0439466_0052592 | 3300041411 | Bacteria | 1331 |
| 477 | Ga0439465_0002196 | 3300041413 | Bacteria | 6397 |
| 478 | Ga0439465_0002908 | 3300041413 | Bacteria | 5614 |
| 479 | Ga0439465_0209662 | 3300041413 | Bacteria | 712 |
| 480 | Ga0451833_1334059 | 3300041491 | Bacteria | 605 |
| 481 | Ga0451845_0290541 | 3300041501 | Bacteria | 927 |
| 482 | Ga0451851_1366376 | 3300041507 | Bacteria | 513 |
| 483 | Ga0451853_0827965 | 3300041512 | Bacteria | 1263 |
| 484 | Ga0439431_0085283 | 3300041997 | Bacteria | 855 |
| 485 | Ga0439431_0155130 | 3300041997 | Bacteria | 652 |
| 486 | Ga0439442_004331 | 3300042002 | Bacteria | 2818 |
| 487 | Ga0439445_0012586 | 3300042004 | Bacteria | 2036 |
| 488 | Ga0439445_0026649 | 3300042004 | Bacteria | 1481 |
| 489 | Ga0439434_0010245 | 3300042435 | Bacteria | 2763 |
| 490 | Ga0439459_0071878 | 3300042438 | Bacteria | 802 |
| 491 | Ga0466969_0041698 | 3300044656 | Bacteria | 2295 |
| 492 | Ga0466969_0117849 | 3300044656 | Bacteria | 1238 |
| 493 | Ga0466972_0048372 | 3300044658 | Bacteria | 2055 |
| 494 | Ga0466972_0089285 | 3300044658 | Bacteria | 1462 |
| 495 | Ga0466972_0138215 | 3300044658 | Bacteria | 1147 |
| 496 | Ga0466965_0300226 | 3300044683 | Bacteria | 871 |
| 497 | Ga0466966_0003513 | 3300044684 | Bacteria | 10340 |
| 498 | Ga0466966_0010506 | 3300044684 | Bacteria | 6152 |
| 499 | Ga0466966_0136596 | 3300044684 | Bacteria | 1499 |
| 500 | Ga0466961_0011041 | 3300044693 | Bacteria | 5774 |
| 501 | Ga0466961_0137673 | 3300044693 | Bacteria | 1529 |
| 502 | Ga0466961_0985250 | 3300044693 | Bacteria | 501 |
| 503 | Ga0466963_0065877 | 3300044694 | Bacteria | 2429 |
| 504 | Ga0466963_0088987 | 3300044694 | Bacteria | 2100 |
| 505 | Ga0466963_0186490 | 3300044694 | Bacteria | 1449 |
| 506 | Ga0466963_0190247 | 3300044694 | Bacteria | 1434 |
| 507 | Ga0466963_0190617 | 3300044694 | Bacteria | 1432 |
| 508 | Ga0466963_0552132 | 3300044694 | Bacteria | 813 |
| 509 | Ga0466964_0096277 | 3300044706 | Bacteria | 1297 |
| 510 | Ga0466964_0162813 | 3300044706 | Bacteria | 1044 |
| 511 | Ga0466964_0324821 | 3300044706 | Bacteria | 783 |
| 512 | Ga0466971_0030802 | 3300044719 | Bacteria | 2401 |
| 513 | Ga0466971_0077300 | 3300044719 | Bacteria | 1515 |
| 514 | Ga0466971_0177058 | 3300044719 | Bacteria | 1002 |
| 515 | Ga0466971_0378190 | 3300044719 | Bacteria | 688 |
| 516 | Ga0466968_0004782 | 3300044735 | Bacteria | 5069 |
| 517 | Ga0466968_0266771 | 3300044735 | Bacteria | 816 |
| 518 | Ga0466970_0046356 | 3300044765 | Bacteria | 2315 |
| 519 | Ga0466957_0003608 | 3300044842 | Bacteria | 8532 |
| 520 | Ga0466957_0156352 | 3300044842 | Bacteria | 1478 |
| 521 | Ga0466957_0200628 | 3300044842 | Bacteria | 1310 |
| 522 | Ga0466957_0217607 | 3300044842 | Bacteria | 1260 |
| 523 | Ga0466957_0452894 | 3300044842 | Bacteria | 884 |
| 524 | Ga0466960_0002343 | 3300044901 | Bacteria | 7118 |
| 525 | Ga0466960_0020412 | 3300044901 | Bacteria | 2934 |
| 526 | Ga0466960_0564862 | 3300044901 | Bacteria | 672 |
| 527 | Ga0466960_0985694 | 3300044901 | Bacteria | 517 |
| 528 | Ga0466959_0068362 | 3300045049 | Bacteria | 2574 |
| 529 | Ga0466959_0582925 | 3300045049 | Bacteria | 753 |
| 530 | Ga0466958_0002894 | 3300045836 | Bacteria | 8760 |
| 531 | Ga0466958_0042317 | 3300045836 | Bacteria | 2743 |
| 532 | Ga0466958_0063326 | 3300045836 | Bacteria | 2255 |
| 533 | Ga0466958_0105310 | 3300045836 | Bacteria | 1757 |
| 534 | Ga0466967_0007417 | 3300045976 | Bacteria | 7910 |
| 535 | Ga0466967_0128451 | 3300045976 | Bacteria | 2350 |
| 536 | Ga0466967_0354590 | 3300045976 | Bacteria | 1420 |
| 537 | Ga0466967_0507133 | 3300045976 | Bacteria | 1184 |
| 538 | Ga0466967_0679503 | 3300045976 | Bacteria | 1019 |
| 539 | Ga0466967_0754954 | 3300045976 | Bacteria | 965 |
| 540 | Ga0466967_2169028 | 3300045976 | Bacteria | 552 |
| 541 | Ga0466967_2434759 | 3300045976 | Bacteria | 519 |
| 542 | Ga0495629_0144134 | 3300046459 | Bacteria | 1657 |
| 543 | Ga0495641_0016281 | 3300046461 | Bacteria | 3922 |
| 544 | Ga0495582_0008239 | 3300046473 | Bacteria | 5751 |
| 545 | Ga0495639_0137128 | 3300046475 | Bacteria | 1174 |
| 546 | Ga0495584_0376903 | 3300046491 | Bacteria | 721 |
| 547 | Ga0495606_0617058 | 3300046507 | Bacteria | 530 |
| 548 | Ga0495630_0055810 | 3300046517 | Bacteria | 2960 |
| 549 | Ga0495640_0049163 | 3300046533 | Bacteria | 2909 |
| 550 | Ga0495622_0394675 | 3300046557 | Bacteria | 596 |
| 551 | Ga0495634_0883627 | 3300046642 | Bacteria | 506 |
| 552 | Ga0495611_0315501 | 3300046648 | Bacteria | 720 |
| 553 | Ga0495658_0037158 | 3300046683 | Bacteria | 2691 |
| 554 | Ga0495613_0492805 | 3300046689 | Bacteria | 826 |
| 555 | Ga0495624_0562225 | 3300046690 | Bacteria | 681 |
| 556 | Ga0495649_0243805 | 3300046694 | Bacteria | 925 |
| 557 | Ga0495589_0440009 | 3300046794 | Bacteria | 597 |
| 558 | Ga0495581_0259194 | 3300047315 | Bacteria | 1017 |
| 559 | Ga0495674_0130317 | 3300047319 | Bacteria | 2119 |
| 560 | Ga0495672_0109666 | 3300047320 | Bacteria | 1483 |
| 561 | Ga0495676_0236647 | 3300047321 | Bacteria | 1252 |
| 562 | Ga0495684_0672487 | 3300047471 | Bacteria | 690 |
| 563 | Ga0495593_0170572 | 3300047673 | Bacteria | 1097 |
| 564 | Ga0495626_0408599 | 3300048091 | Bacteria | 524 |
| 565 | Ga0496100_0020033 | 3300048903 | Bacteria | 4004 |
| 566 | Ga0496100_0120217 | 3300048903 | Bacteria | 1836 |
| 567 | Ga0496100_0121195 | 3300048903 | Bacteria | 1830 |
| 568 | Ga0496100_0445024 | 3300048903 | Bacteria | 993 |
| 569 | Ga0496100_1434927 | 3300048903 | Bacteria | 545 |
| 570 | Ga0496101_0002255 | 3300048904 | Bacteria | 11786 |
| 571 | Ga0496101_0006735 | 3300048904 | Bacteria | 7412 |
| 572 | Ga0496101_0032011 | 3300048904 | Bacteria | 3700 |
| 573 | Ga0496101_0040574 | 3300048904 | Bacteria | 3315 |
| 574 | Ga0496101_0582327 | 3300048904 | Bacteria | 885 |
| 575 | Ga0496101_0728461 | 3300048904 | Bacteria | 783 |
| 576 | Ga0496101_1362230 | 3300048904 | Bacteria | 554 |
| 577 | Ga0496102_0001066 | 3300048905 | Bacteria | 25405 |
| 578 | Ga0496102_0014356 | 3300048905 | Bacteria | 6880 |
| 579 | Ga0496102_0052105 | 3300048905 | Bacteria | 3728 |
| 580 | Ga0496102_0082538 | 3300048905 | Bacteria | 2964 |
| 581 | Ga0496102_0085035 | 3300048905 | Bacteria | 2920 |
| 582 | Ga0496102_0156613 | 3300048905 | Bacteria | 2141 |
| 583 | Ga0496102_0201134 | 3300048905 | Bacteria | 1878 |
| 584 | Ga0496103_0001226 | 3300048906 | Bacteria | 17581 |
| 585 | Ga0496103_0002026 | 3300048906 | Bacteria | 13017 |
| 586 | Ga0496103_0055611 | 3300048906 | Bacteria | 2455 |
| 587 | Ga0496103_0146630 | 3300048906 | Bacteria | 1511 |
| 588 | Ga0496103_0769103 | 3300048906 | Bacteria | 608 |
| 589 | Ga0496103_0802779 | 3300048906 | Bacteria | 593 |
| 590 | Ga0496104_0198656 | 3300048907 | Bacteria | 1917 |
| 591 | Ga0496104_1780180 | 3300048907 | Bacteria | 518 |
| 592 | Ga0496105_0063979 | 3300048908 | Bacteria | 3035 |
| 593 | Ga0496105_0394129 | 3300048908 | Bacteria | 1100 |
| 594 | Ga0496105_0533487 | 3300048908 | Bacteria | 918 |
| 595 | Ga0496105_0606666 | 3300048908 | Bacteria | 849 |
| 596 | Ga0496105_0648962 | 3300048908 | Bacteria | 815 |
| 597 | Ga0496106_0001406 | 3300048909 | Bacteria | 18048 |
| 598 | Ga0496106_0188350 | 3300048909 | Bacteria | 1640 |
| 599 | Ga0496106_0197064 | 3300048909 | Bacteria | 1602 |
| 600 | Ga0496106_0702616 | 3300048909 | Bacteria | 806 |
| 601 | Ga0496107_0001641 | 3300048910 | Bacteria | 13951 |
| 602 | Ga0496107_0209830 | 3300048910 | Bacteria | 1448 |
| 603 | Ga0496107_0849672 | 3300048910 | Bacteria | 667 |
| 604 | Ga0496108_0012478 | 3300048911 | Bacteria | 6919 |
| 605 | Ga0496108_0147864 | 3300048911 | Bacteria | 2026 |
| 606 | Ga0496108_0183240 | 3300048911 | Bacteria | 1814 |
| 607 | Ga0496109_0005854 | 3300048912 | Bacteria | 10307 |
| 608 | Ga0496109_0009168 | 3300048912 | Bacteria | 8427 |
| 609 | Ga0496109_0562674 | 3300048912 | Bacteria | 1075 |
| 610 | Ga0496109_0720040 | 3300048912 | Bacteria | 935 |
| 611 | Ga0496109_0969161 | 3300048912 | Bacteria | 788 |
| 612 | Ga0496110_0051203 | 3300048913 | Bacteria | 3629 |
| 613 | Ga0496110_0143004 | 3300048913 | Bacteria | 2163 |
| 614 | Ga0496110_0414374 | 3300048913 | Bacteria | 1228 |
| 615 | Ga0496110_0485996 | 3300048913 | Bacteria | 1125 |
| 616 | Ga0496110_1046413 | 3300048913 | Bacteria | 724 |
| 617 | Ga0496111_0226749 | 3300048914 | Bacteria | 1388 |
| 618 | Ga0496111_0381433 | 3300048914 | Bacteria | 1042 |
| 619 | Ga0496111_1062026 | 3300048914 | Bacteria | 578 |
| 620 | Ga0496112_0014391 | 3300048915 | Bacteria | 7336 |
| 621 | Ga0496112_0038501 | 3300048915 | Bacteria | 4669 |
| 622 | Ga0496112_0045521 | 3300048915 | Bacteria | 4301 |
| 623 | Ga0496112_0085695 | 3300048915 | Bacteria | 3117 |
| 624 | Ga0496112_0322217 | 3300048915 | Bacteria | 1490 |
| 625 | Ga0496112_0796494 | 3300048915 | Bacteria | 870 |
| 626 | Ga0496112_1044831 | 3300048915 | Bacteria | 736 |
| 627 | Ga0496113_0034812 | 3300048916 | Bacteria | 3678 |
| 628 | Ga0496113_0267046 | 3300048916 | Bacteria | 1367 |
| 629 | Ga0496113_0668779 | 3300048916 | Bacteria | 830 |
| 630 | Ga0496114_0000486 | 3300048917 | Bacteria | 29134 |
| 631 | Ga0496114_0445083 | 3300048917 | Bacteria | 1147 |
| 632 | Ga0496114_0799519 | 3300048917 | Bacteria | 822 |
| 633 | Ga0496114_1541820 | 3300048917 | Bacteria | 552 |
| 634 | Ga0496115_0002673 | 3300048918 | Bacteria | 12785 |
| 635 | Ga0496115_0362645 | 3300048918 | Bacteria | 1181 |
| 636 | Ga0496115_0625441 | 3300048918 | Bacteria | 854 |
| 637 | Ga0496116_0181686 | 3300048919 | Bacteria | 1125 |
| 638 | Ga0496117_0000430 | 3300048920 | Bacteria | 70406 |
| 639 | Ga0496118_0000165 | 3300048921 | Bacteria | 119376 |
| 640 | Ga0496118_0002530 | 3300048921 | Bacteria | 24503 |
| 641 | Ga0496119_0005297 | 3300048922 | Bacteria | 12422 |
| 642 | Ga0496120_0020219 | 3300048923 | Bacteria | 4238 |
| 643 | Ga0496121_0007201 | 3300048924 | Bacteria | 13473 |
| 644 | Ga0496122_0362701 | 3300048925 | Bacteria | 751 |
| 645 | Ga0496124_0203883 | 3300048927 | Bacteria | 1501 |
| 646 | Ga0496125_0006092 | 3300048928 | Bacteria | 13162 |
| 647 | Ga0496126_0003255 | 3300048929 | Bacteria | 20757 |
| 648 | Ga0496126_0010065 | 3300048929 | Bacteria | 9976 |
| 649 | Ga0501032_0006334 | 3300049569 | Bacteria | 8723 |
| 650 | Ga0501033_0008828 | 3300049570 | Bacteria | 7787 |
| 651 | Ga0501033_0614765 | 3300049570 | Bacteria | 744 |
| 652 | Ga0501034_0005259 | 3300049571 | Bacteria | 14207 |
| 653 | Ga0501034_0075196 | 3300049571 | Bacteria | 3386 |
| 654 | Ga0501034_0530082 | 3300049571 | Bacteria | 1089 |
| 655 | Ga0501036_0076998 | 3300049572 | Bacteria | 2822 |
| 656 | Ga0501037_0003402 | 3300049573 | Bacteria | 11568 |
| 657 | Ga0501039_0772504 | 3300049575 | Bacteria | 750 |
| 658 | Ga0501043_0461422 | 3300049579 | Bacteria | 953 |
| 659 | Ga0501046_0003379 | 3300049580 | Bacteria | 14646 |
| 660 | Ga0501046_0683761 | 3300049580 | Bacteria | 724 |
| 661 | Ga0501046_1079268 | 3300049580 | Bacteria | 555 |
| 662 | Ga0501047_0004498 | 3300049581 | Bacteria | 13115 |
| 663 | Ga0501047_0019957 | 3300049581 | Bacteria | 6435 |
| 664 | Ga0501047_0425496 | 3300049581 | Bacteria | 1159 |
| 665 | Ga0501047_1357948 | 3300049581 | Bacteria | 525 |
| 666 | Ga0501048_0000667 | 3300049582 | Bacteria | 24833 |
| 667 | Ga0501068_0742350 | 3300049584 | Bacteria | 643 |
| 668 | Ga0501069_0034450 | 3300049585 | Bacteria | 2789 |
| 669 | Ga0501070_0000669 | 3300049586 | Bacteria | 31597 |
| 670 | Ga0501070_0026142 | 3300049586 | Bacteria | 4899 |
| 671 | Ga0501073_0296647 | 3300049589 | Bacteria | 1115 |
| 672 | Ga0501073_0379916 | 3300049589 | Bacteria | 976 |
| 673 | Ga0501075_0504579 | 3300049591 | Bacteria | 923 |
| 674 | Ga0501080_0061436 | 3300049742 | Bacteria | 3498 |
| 675 | Ga0501080_0162495 | 3300049742 | Bacteria | 2062 |
| 676 | Ga0501035_0001642 | 3300049822 | Bacteria | 22591 |
| 677 | Ga0501035_0005600 | 3300049822 | Bacteria | 11861 |
| 678 | Ga0501044_0002795 | 3300049823 | Bacteria | 19887 |
| 679 | Ga0501044_0080500 | 3300049823 | Bacteria | 3299 |
| 680 | Ga0501044_0759775 | 3300049823 | Bacteria | 851 |
| 681 | nmdc:mga03683_391651_c1 | 3300050489 | Bacteria | 662 |
| 682 | nmdc:mga03n38_10754_c1 | 3300050490 | Bacteria | 3382 |
| 683 | nmdc:mga03n38_1784_c1 | 3300050490 | Bacteria | 6377 |
| 684 | nmdc:mga03n38_24001_c1 | 3300050490 | Bacteria | 2489 |
| 685 | nmdc:mga03n38_646847_c1 | 3300050490 | Bacteria | 605 |
| 686 | nmdc:mga03n38_7109_c1 | 3300050490 | Bacteria | 3939 |
| 687 | nmdc:mga03n38_7316_c1 | 3300050490 | Bacteria | 3901 |
| 688 | nmdc:mga00v17_19256_c1 | 3300050491 | Bacteria | 3894 |
| 689 | nmdc:mga00v17_3944_c1 | 3300050491 | Bacteria | 7656 |
| 690 | nmdc:mga00v17_940870_c1 | 3300050491 | Bacteria | 546 |
| 691 | nmdc:mga0yw44_1004714_c1 | 3300050492 | Bacteria | 565 |
| 692 | nmdc:mga0yw44_143534_c1 | 3300050492 | Bacteria | 1553 |
| 693 | nmdc:mga0yw44_198331_c1 | 3300050492 | Bacteria | 1325 |
| 694 | nmdc:mga0yw44_5528_c1 | 3300050492 | Bacteria | 5989 |
| 695 | nmdc:mga06z11_224830_c1 | 3300050494 | Bacteria | 1098 |
| 696 | nmdc:mga06z11_73724_c1 | 3300050494 | Bacteria | 1813 |
| 697 | nmdc:mga06z11_78535_c1 | 3300050494 | Bacteria | 1764 |
| 698 | nmdc:mga04h51_127934_c1 | 3300050495 | Bacteria | 952 |
| 699 | nmdc:mga04h51_143312_c1 | 3300050495 | Bacteria | 908 |
| 700 | nmdc:mga04h51_253272_c1 | 3300050495 | Bacteria | 706 |
| 701 | nmdc:mga07m45_110684_c1 | 3300050496 | Bacteria | 1581 |
| 702 | nmdc:mga07m45_12019_c2 | 3300050496 | Bacteria | 2913 |
| 703 | nmdc:mga07m45_189061_c1 | 3300050496 | Bacteria | 1197 |
| 704 | nmdc:mga07m45_44078_c1 | 3300050496 | Bacteria | 1980 |
| 705 | nmdc:mga07m45_47558_c1 | 3300050496 | Bacteria | 2412 |
| 706 | nmdc:mga07m45_97324_c1 | 3300050496 | Bacteria | 1689 |
| 707 | nmdc:mga05p37_95168_c1 | 3300050507 | Bacteria | 3669 |
| 708 | nmdc:mga0qj67_28389_c1 | 3300050509 | Bacteria | 4343 |
| 709 | nmdc:mga0qj67_60357_c1 | 3300050509 | Bacteria | 3009 |
| 710 | nmdc:mga06r32_21217_c1 | 3300050510 | Bacteria | 5995 |
| 711 | nmdc:mga08y16_384990_c1 | 3300050511 | Bacteria | 1437 |
| 712 | nmdc:mga08y16_760618_c1 | 3300050511 | Bacteria | 964 |
| 713 | nmdc:mga0n895_794066_c1 | 3300050512 | Bacteria | 937 |
| 714 | nmdc:mga0sz30_14487_c1 | 3300050516 | Bacteria | 3105 |
| 715 | nmdc:mga0sz30_14605_c1 | 3300050516 | Bacteria | 3094 |
| 716 | nmdc:mga0sz30_5539_c1 | 3300050516 | Bacteria | 4638 |
| 717 | nmdc:mga0sz30_63749_c1 | 3300050516 | Bacteria | 1578 |
| 718 | Ga0495655_0152644 | 3300053083 | Bacteria | 727 |
| 719 | Ga0495619_1066477 | 3300053085 | Bacteria | 538 |
| 720 | Ga0500578_0093282 | 3300053086 | Bacteria | 1910 |
| 721 | Ga0500642_0049190 | 3300053130 | Bacteria | 1855 |
| 722 | Ga0500604_0228985 | 3300053151 | Bacteria | 642 |
| 723 | Ga0500620_106883 | 3300053155 | Bacteria | 979 |
| 724 | Ga0466962_0149282 | 3300061719 | Bacteria | 1134 |
| 725 | Ga0466962_0183455 | 3300061719 | Bacteria | 1020 |
| 726 | Ga0466962_0368541 | 3300061719 | Bacteria | 717 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2508501039 | 2508672945 | 74 |
| 2 | iso_pu_bacteria | 2508501039 | 2508675341 | 74 |
| 3 | iso_pu_bacteria | 2684623035 | 2686534866 | 74 |
| 4 | iso_pu_bacteria | 2684623035 | 2686539147 | 74 |
| 5 | iso_pu_bacteria | 2687453737 | 2689955756 | 74 |
| 6 | iso_pu_bacteria | 2687453743 | 2689991030 | 74 |
| 7 | iso_pu_bacteria | 2895880812 | 2895881981 | 74 |
| 8 | iso_pu_bacteria | 2895880812 | 2895887673 | 74 |
| 9 | 3300010375 | Ga0105239_10591824 | Ga0105239_105918242 | 77 |
| 10 | 3300048903 | Ga0496100_0445024 | Ga0496100_0445024_57_308 | 77 |
| 11 | 3300001977 | JGI24746J21847_1003844 | JGI24746J21847_10038443 | 78 |
| 12 | 3300001978 | JGI24747J21853_1040525 | JGI24747J21853_10405252 | 78 |
| 13 | 3300001989 | JGI24739J22299_10142746 | JGI24739J22299_101427462 | 78 |
| 14 | 3300001989 | JGI24739J22299_10167850 | JGI24739J22299_101678502 | 78 |
| 15 | 3300001990 | JGI24737J22298_10067153 | JGI24737J22298_100671532 | 78 |
| 16 | 3300001991 | JGI24743J22301_10069859 | JGI24743J22301_100698592 | 78 |
| 17 | 3300002070 | JGI24750J21931_1010568 | JGI24750J21931_10105681 | 78 |
| 18 | 3300002070 | JGI24750J21931_1014002 | JGI24750J21931_10140022 | 78 |
| 19 | 3300002073 | JGI24745J21846_1003575 | JGI24745J21846_10035753 | 78 |
| 20 | 3300002075 | JGI24738J21930_10102929 | JGI24738J21930_101029291 | 78 |
| 21 | 3300002076 | JGI24749J21850_1006529 | JGI24749J21850_10065293 | 78 |
| 22 | 3300002077 | JGI24744J21845_10004148 | JGI24744J21845_100041483 | 78 |
| 23 | 3300002239 | JGI24034J26672_10005717 | JGI24034J26672_100057173 | 78 |
| 24 | 3300002244 | JGI24742J22300_10000982 | JGI24742J22300_100009825 | 78 |
| 25 | 3300002459 | JGI24751J29686_10022339 | JGI24751J29686_100223392 | 78 |
| 26 | 3300005328 | Ga0070676_10003809 | Ga0070676_100038098 | 78 |
| 27 | 3300005328 | Ga0070676_10111686 | Ga0070676_101116863 | 78 |
| 28 | 3300005329 | Ga0070683_100949319 | Ga0070683_1009493192 | 78 |
| 29 | 3300005330 | Ga0070690_100143236 | Ga0070690_1001432362 | 78 |
| 30 | 3300005333 | Ga0070677_10293857 | Ga0070677_102938572 | 78 |
| 31 | 3300005334 | Ga0068869_100352668 | Ga0068869_1003526682 | 78 |
| 32 | 3300005334 | Ga0068869_101691055 | Ga0068869_1016910551 | 78 |
| 33 | 3300005335 | Ga0070666_10027962 | Ga0070666_100279622 | 78 |
| 34 | 3300005335 | Ga0070666_10138787 | Ga0070666_101387872 | 78 |
| 35 | 3300005336 | Ga0070680_101358935 | Ga0070680_1013589352 | 78 |
| 36 | 3300005337 | Ga0070682_100004846 | Ga0070682_1000048463 | 78 |
| 37 | 3300005337 | Ga0070682_100008532 | Ga0070682_1000085322 | 78 |
| 38 | 3300005337 | Ga0070682_100114231 | Ga0070682_1001142312 | 78 |
| 39 | 3300005337 | Ga0070682_100202482 | Ga0070682_1002024822 | 78 |
| 40 | 3300005337 | Ga0070682_102003385 | Ga0070682_1020033851 | 78 |
| 41 | 3300005338 | Ga0068868_100006571 | Ga0068868_1000065717 | 78 |
| 42 | 3300005338 | Ga0068868_100050862 | Ga0068868_1000508622 | 78 |
| 43 | 3300005338 | Ga0068868_100225213 | Ga0068868_1002252132 | 78 |
| 44 | 3300005339 | Ga0070660_100308245 | Ga0070660_1003082452 | 78 |
| 45 | 3300005340 | Ga0070689_100017358 | Ga0070689_1000173582 | 78 |
| 46 | 3300005340 | Ga0070689_100695098 | Ga0070689_1006950982 | 78 |
| 47 | 3300005340 | Ga0070689_102047397 | Ga0070689_1020473972 | 78 |
| 48 | 3300005341 | Ga0070691_10011557 | Ga0070691_100115572 | 78 |
| 49 | 3300005341 | Ga0070691_11014694 | Ga0070691_110146942 | 78 |
| 50 | 3300005343 | Ga0070687_100053109 | Ga0070687_1000531093 | 78 |
| 51 | 3300005343 | Ga0070687_100553947 | Ga0070687_1005539472 | 78 |
| 52 | 3300005344 | Ga0070661_100944430 | Ga0070661_1009444302 | 78 |
| 53 | 3300005347 | Ga0070668_100017633 | Ga0070668_1000176335 | 78 |
| 54 | 3300005347 | Ga0070668_100461139 | Ga0070668_1004611392 | 78 |
| 55 | 3300005347 | Ga0070668_100755082 | Ga0070668_1007550822 | 78 |
| 56 | 3300005353 | Ga0070669_100121698 | Ga0070669_1001216982 | 78 |
| 57 | 3300005353 | Ga0070669_100803285 | Ga0070669_1008032851 | 78 |
| 58 | 3300005353 | Ga0070669_101106707 | Ga0070669_1011067071 | 78 |
| 59 | 3300005354 | Ga0070675_100050003 | Ga0070675_1000500032 | 78 |
| 60 | 3300005354 | Ga0070675_100215175 | Ga0070675_1002151752 | 78 |
| 61 | 3300005355 | Ga0070671_100007747 | Ga0070671_1000077473 | 78 |
| 62 | 3300005355 | Ga0070671_100817756 | Ga0070671_1008177562 | 78 |
| 63 | 3300005356 | Ga0070674_100000125 | Ga0070674_10000012534 | 78 |
| 64 | 3300005356 | Ga0070674_100618146 | Ga0070674_1006181462 | 78 |
| 65 | 3300005356 | Ga0070674_101103215 | Ga0070674_1011032152 | 78 |
| 66 | 3300005364 | Ga0070673_100462271 | Ga0070673_1004622712 | 78 |
| 67 | 3300005365 | Ga0070688_100015022 | Ga0070688_1000150225 | 78 |
| 68 | 3300005365 | Ga0070688_100017298 | Ga0070688_1000172987 | 78 |
| 69 | 3300005365 | Ga0070688_100383610 | Ga0070688_1003836102 | 78 |
| 70 | 3300005366 | Ga0070659_100491028 | Ga0070659_1004910282 | 78 |
| 71 | 3300005366 | Ga0070659_101600805 | Ga0070659_1016008051 | 78 |
| 72 | 3300005367 | Ga0070667_100000056 | Ga0070667_100000056151 | 78 |
| 73 | 3300005367 | Ga0070667_100001317 | Ga0070667_1000013178 | 78 |
| 74 | 3300005367 | Ga0070667_100008096 | Ga0070667_1000080962 | 78 |
| 75 | 3300005367 | Ga0070667_100516773 | Ga0070667_1005167732 | 78 |
| 76 | 3300005367 | Ga0070667_101841691 | Ga0070667_1018416911 | 78 |
| 77 | 3300005406 | Ga0070703_10618581 | Ga0070703_106185811 | 78 |
| 78 | 3300005434 | Ga0070709_10038393 | Ga0070709_100383933 | 78 |
| 79 | 3300005434 | Ga0070709_10131988 | Ga0070709_101319881 | 78 |
| 80 | 3300005435 | Ga0070714_100033072 | Ga0070714_1000330725 | 78 |
| 81 | 3300005435 | Ga0070714_100417176 | Ga0070714_1004171762 | 78 |
| 82 | 3300005436 | Ga0070713_100021734 | Ga0070713_1000217343 | 78 |
| 83 | 3300005437 | Ga0070710_10000890 | Ga0070710_100008904 | 78 |
| 84 | 3300005437 | Ga0070710_10360544 | Ga0070710_103605442 | 78 |
| 85 | 3300005438 | Ga0070701_10002203 | Ga0070701_100022032 | 78 |
| 86 | 3300005438 | Ga0070701_10079012 | Ga0070701_100790122 | 78 |
| 87 | 3300005438 | Ga0070701_11237876 | Ga0070701_112378761 | 78 |
| 88 | 3300005439 | Ga0070711_100000244 | Ga0070711_1000002446 | 78 |
| 89 | 3300005439 | Ga0070711_100002056 | Ga0070711_1000020563 | 78 |
| 90 | 3300005439 | Ga0070711_101140039 | Ga0070711_1011400392 | 78 |
| 91 | 3300005440 | Ga0070705_100003441 | Ga0070705_1000034416 | 78 |
| 92 | 3300005440 | Ga0070705_100803031 | Ga0070705_1008030312 | 78 |
| 93 | 3300005441 | Ga0070700_100038052 | Ga0070700_1000380524 | 78 |
| 94 | 3300005441 | Ga0070700_100042260 | Ga0070700_1000422601 | 78 |
| 95 | 3300005444 | Ga0070694_100012110 | Ga0070694_1000121106 | 78 |
| 96 | 3300005444 | Ga0070694_101882304 | Ga0070694_1018823041 | 78 |
| 97 | 3300005445 | Ga0070708_100474824 | Ga0070708_1004748242 | 78 |
| 98 | 3300005455 | Ga0070663_100006113 | Ga0070663_1000061135 | 78 |
| 99 | 3300005455 | Ga0070663_100038377 | Ga0070663_1000383772 | 78 |
| 100 | 3300005456 | Ga0070678_100001944 | Ga0070678_1000019444 | 78 |
| 101 | 3300005456 | Ga0070678_100087424 | Ga0070678_1000874242 | 78 |
| 102 | 3300005457 | Ga0070662_100004850 | Ga0070662_1000048503 | 78 |
| 103 | 3300005457 | Ga0070662_100732064 | Ga0070662_1007320642 | 78 |
| 104 | 3300005458 | Ga0070681_11110476 | Ga0070681_111104762 | 78 |
| 105 | 3300005459 | Ga0068867_100002467 | Ga0068867_10000246713 | 78 |
| 106 | 3300005459 | Ga0068867_100222207 | Ga0068867_1002222071 | 78 |
| 107 | 3300005466 | Ga0070685_10027360 | Ga0070685_100273603 | 78 |
| 108 | 3300005466 | Ga0070685_10156666 | Ga0070685_101566662 | 78 |
| 109 | 3300005530 | Ga0070679_100254143 | Ga0070679_1002541432 | 78 |
| 110 | 3300005535 | Ga0070684_100899269 | Ga0070684_1008992692 | 78 |
| 111 | 3300005539 | Ga0068853_100998417 | Ga0068853_1009984172 | 78 |
| 112 | 3300005543 | Ga0070672_100171461 | Ga0070672_1001714612 | 78 |
| 113 | 3300005543 | Ga0070672_100597421 | Ga0070672_1005974212 | 78 |
| 114 | 3300005544 | Ga0070686_100119173 | Ga0070686_1001191732 | 78 |
| 115 | 3300005545 | Ga0070695_100046005 | Ga0070695_1000460052 | 78 |
| 116 | 3300005545 | Ga0070695_100237823 | Ga0070695_1002378232 | 78 |
| 117 | 3300005546 | Ga0070696_100004673 | Ga0070696_1000046735 | 78 |
| 118 | 3300005547 | Ga0070693_100044051 | Ga0070693_1000440513 | 78 |
| 119 | 3300005547 | Ga0070693_100051890 | Ga0070693_1000518901 | 78 |
| 120 | 3300005547 | Ga0070693_100356719 | Ga0070693_1003567191 | 78 |
| 121 | 3300005548 | Ga0070665_100002065 | Ga0070665_10000206516 | 78 |
| 122 | 3300005548 | Ga0070665_100018546 | Ga0070665_1000185465 | 78 |
| 123 | 3300005548 | Ga0070665_100125228 | Ga0070665_1001252282 | 78 |
| 124 | 3300005548 | Ga0070665_100132369 | Ga0070665_1001323691 | 78 |
| 125 | 3300005549 | Ga0070704_100044657 | Ga0070704_1000446573 | 78 |
| 126 | 3300005563 | Ga0068855_100202858 | Ga0068855_1002028582 | 78 |
| 127 | 3300005563 | Ga0068855_101754197 | Ga0068855_1017541971 | 78 |
| 128 | 3300005578 | Ga0068854_100000659 | Ga0068854_1000006593 | 78 |
| 129 | 3300005578 | Ga0068854_100059346 | Ga0068854_1000593463 | 78 |
| 130 | 3300005578 | Ga0068854_100168774 | Ga0068854_1001687743 | 78 |
| 131 | 3300005614 | Ga0068856_100821730 | Ga0068856_1008217301 | 78 |
| 132 | 3300005615 | Ga0070702_100091209 | Ga0070702_1000912093 | 78 |
| 133 | 3300005616 | Ga0068852_100029304 | Ga0068852_1000293042 | 78 |
| 134 | 3300005616 | Ga0068852_100636864 | Ga0068852_1006368642 | 78 |
| 135 | 3300005616 | Ga0068852_100808859 | Ga0068852_1008088592 | 78 |
| 136 | 3300005617 | Ga0068859_100000801 | Ga0068859_10000080129 | 78 |
| 137 | 3300005617 | Ga0068859_100001161 | Ga0068859_10000116119 | 78 |
| 138 | 3300005617 | Ga0068859_103058062 | Ga0068859_1030580622 | 78 |
| 139 | 3300005618 | Ga0068864_100058296 | Ga0068864_1000582964 | 78 |
| 140 | 3300005618 | Ga0068864_101413687 | Ga0068864_1014136872 | 78 |
| 141 | 3300005718 | Ga0068866_10003532 | Ga0068866_100035327 | 78 |
| 142 | 3300005718 | Ga0068866_10009379 | Ga0068866_100093791 | 78 |
| 143 | 3300005719 | Ga0068861_100002743 | Ga0068861_1000027431 | 78 |
| 144 | 3300005719 | Ga0068861_100802914 | Ga0068861_1008029142 | 78 |
| 145 | 3300005719 | Ga0068861_101001818 | Ga0068861_1010018182 | 78 |
| 146 | 3300005719 | Ga0068861_101870850 | Ga0068861_1018708502 | 78 |
| 147 | 3300005719 | Ga0068861_102321736 | Ga0068861_1023217361 | 78 |
| 148 | 3300005840 | Ga0068870_11356155 | Ga0068870_113561552 | 78 |
| 149 | 3300005841 | Ga0068863_100001477 | Ga0068863_1000014779 | 78 |
| 150 | 3300005841 | Ga0068863_100008103 | Ga0068863_1000081033 | 78 |
| 151 | 3300005842 | Ga0068858_100005735 | Ga0068858_1000057354 | 78 |
| 152 | 3300005842 | Ga0068858_100065066 | Ga0068858_1000650663 | 78 |
| 153 | 3300005843 | Ga0068860_100000092 | Ga0068860_1000000924 | 78 |
| 154 | 3300005843 | Ga0068860_100000743 | Ga0068860_10000074334 | 78 |
| 155 | 3300005843 | Ga0068860_100127206 | Ga0068860_1001272064 | 78 |
| 156 | 3300005843 | Ga0068860_100432761 | Ga0068860_1004327612 | 78 |
| 157 | 3300005844 | Ga0068862_100000035 | Ga0068862_1000000359 | 78 |
| 158 | 3300005844 | Ga0068862_100001026 | Ga0068862_1000010265 | 78 |
| 159 | 3300005844 | Ga0068862_100270806 | Ga0068862_1002708062 | 78 |
| 160 | 3300005844 | Ga0068862_100580203 | Ga0068862_1005802032 | 78 |
| 161 | 3300005844 | Ga0068862_102291687 | Ga0068862_1022916872 | 78 |
| 162 | 3300005937 | Ga0081455_10057421 | Ga0081455_100574213 | 78 |
| 163 | 3300005937 | Ga0081455_10345322 | Ga0081455_103453222 | 78 |
| 164 | 3300005981 | Ga0081538_10093999 | Ga0081538_100939993 | 78 |
| 165 | 3300006038 | Ga0075365_10018897 | Ga0075365_100188975 | 78 |
| 166 | 3300006042 | Ga0075368_10168052 | Ga0075368_101680522 | 78 |
| 167 | 3300006042 | Ga0075368_10528402 | Ga0075368_105284021 | 78 |
| 168 | 3300006048 | Ga0075363_100001319 | Ga0075363_1000013198 | 78 |
| 169 | 3300006048 | Ga0075363_100003961 | Ga0075363_1000039614 | 78 |
| 170 | 3300006048 | Ga0075363_100005296 | Ga0075363_1000052963 | 78 |
| 171 | 3300006048 | Ga0075363_100017527 | Ga0075363_1000175273 | 78 |
| 172 | 3300006048 | Ga0075363_100060736 | Ga0075363_1000607362 | 78 |
| 173 | 3300006048 | Ga0075363_100464694 | Ga0075363_1004646942 | 78 |
| 174 | 3300006048 | Ga0075363_100514708 | Ga0075363_1005147082 | 78 |
| 175 | 3300006051 | Ga0075364_10002016 | Ga0075364_100020162 | 78 |
| 176 | 3300006051 | Ga0075364_10164966 | Ga0075364_101649662 | 78 |
| 177 | 3300006163 | Ga0070715_10007687 | Ga0070715_100076874 | 78 |
| 178 | 3300006163 | Ga0070715_10039854 | Ga0070715_100398542 | 78 |
| 179 | 3300006163 | Ga0070715_10200384 | Ga0070715_102003842 | 78 |
| 180 | 3300006173 | Ga0070716_100001677 | Ga0070716_1000016778 | 78 |
| 181 | 3300006173 | Ga0070716_100014528 | Ga0070716_1000145283 | 78 |
| 182 | 3300006173 | Ga0070716_100021378 | Ga0070716_1000213782 | 78 |
| 183 | 3300006175 | Ga0070712_100002977 | Ga0070712_1000029778 | 78 |
| 184 | 3300006175 | Ga0070712_100135898 | Ga0070712_1001358982 | 78 |
| 185 | 3300006178 | Ga0075367_10112952 | Ga0075367_101129522 | 78 |
| 186 | 3300006186 | Ga0075369_10011236 | Ga0075369_100112362 | 78 |
| 187 | 3300006186 | Ga0075369_10026716 | Ga0075369_100267163 | 78 |
| 188 | 3300006186 | Ga0075369_10031671 | Ga0075369_100316712 | 78 |
| 189 | 3300006186 | Ga0075369_10454059 | Ga0075369_104540592 | 78 |
| 190 | 3300006237 | Ga0097621_100039034 | Ga0097621_1000390344 | 78 |
| 191 | 3300006237 | Ga0097621_100852837 | Ga0097621_1008528372 | 78 |
| 192 | 3300006353 | Ga0075370_10007593 | Ga0075370_100075933 | 78 |
| 193 | 3300006353 | Ga0075370_10129248 | Ga0075370_101292482 | 78 |
| 194 | 3300006353 | Ga0075370_10520229 | Ga0075370_105202292 | 78 |
| 195 | 3300006358 | Ga0068871_100049221 | Ga0068871_1000492215 | 78 |
| 196 | 3300006844 | Ga0075428_100017974 | Ga0075428_1000179746 | 78 |
| 197 | 3300006846 | Ga0075430_100018968 | Ga0075430_1000189685 | 78 |
| 198 | 3300006846 | Ga0075430_100063237 | Ga0075430_1000632373 | 78 |
| 199 | 3300006847 | Ga0075431_100026875 | Ga0075431_1000268755 | 78 |
| 200 | 3300006881 | Ga0068865_100003557 | Ga0068865_1000035574 | 78 |
| 201 | 3300006881 | Ga0068865_100946340 | Ga0068865_1009463402 | 78 |
| 202 | 3300006914 | Ga0075436_100773281 | Ga0075436_1007732812 | 78 |
| 203 | 3300006931 | Ga0097620_100000801 | Ga0097620_10000080129 | 78 |
| 204 | 3300006931 | Ga0097620_100001161 | Ga0097620_1000011618 | 78 |
| 205 | 3300006931 | Ga0097620_103058010 | Ga0097620_1030580102 | 78 |
| 206 | 3300007788 | Ga0099795_10227932 | Ga0099795_102279322 | 78 |
| 207 | 3300007788 | Ga0099795_10293691 | Ga0099795_102936912 | 78 |
| 208 | 3300009092 | Ga0105250_10062397 | Ga0105250_100623972 | 78 |
| 209 | 3300009093 | Ga0105240_10209469 | Ga0105240_102094693 | 78 |
| 210 | 3300009093 | Ga0105240_10701408 | Ga0105240_107014082 | 78 |
| 211 | 3300009094 | Ga0111539_10665372 | Ga0111539_106653722 | 78 |
| 212 | 3300009094 | Ga0111539_13363862 | Ga0111539_133638622 | 78 |
| 213 | 3300009098 | Ga0105245_10004088 | Ga0105245_1000408810 | 78 |
| 214 | 3300009098 | Ga0105245_10266341 | Ga0105245_102663412 | 78 |
| 215 | 3300009098 | Ga0105245_10477959 | Ga0105245_104779592 | 78 |
| 216 | 3300009101 | Ga0105247_10000062 | Ga0105247_1000006259 | 78 |
| 217 | 3300009101 | Ga0105247_10000806 | Ga0105247_1000080622 | 78 |
| 218 | 3300009101 | Ga0105247_10107295 | Ga0105247_101072954 | 78 |
| 219 | 3300009147 | Ga0114129_10046799 | Ga0114129_100467993 | 78 |
| 220 | 3300009147 | Ga0114129_10691953 | Ga0114129_106919532 | 78 |
| 221 | 3300009148 | Ga0105243_10003563 | Ga0105243_100035632 | 78 |
| 222 | 3300009148 | Ga0105243_10018727 | Ga0105243_100187275 | 78 |
| 223 | 3300009174 | Ga0105241_10057026 | Ga0105241_100570263 | 78 |
| 224 | 3300009174 | Ga0105241_11621191 | Ga0105241_116211911 | 78 |
| 225 | 3300009174 | Ga0105241_12045680 | Ga0105241_120456801 | 78 |
| 226 | 3300009174 | Ga0105241_12233381 | Ga0105241_122333812 | 78 |
| 227 | 3300009176 | Ga0105242_10007246 | Ga0105242_100072461 | 78 |
| 228 | 3300009176 | Ga0105242_10099489 | Ga0105242_100994893 | 78 |
| 229 | 3300009176 | Ga0105242_11233799 | Ga0105242_112337992 | 78 |
| 230 | 3300009177 | Ga0105248_10000036 | Ga0105248_10000036150 | 78 |
| 231 | 3300009177 | Ga0105248_10000634 | Ga0105248_1000063410 | 78 |
| 232 | 3300009177 | Ga0105248_10553936 | Ga0105248_105539362 | 78 |
| 233 | 3300009177 | Ga0105248_10754286 | Ga0105248_107542862 | 78 |
| 234 | 3300009177 | Ga0105248_10767147 | Ga0105248_107671472 | 78 |
| 235 | 3300009545 | Ga0105237_10111323 | Ga0105237_101113232 | 78 |
| 236 | 3300009545 | Ga0105237_10129714 | Ga0105237_101297143 | 78 |
| 237 | 3300009545 | Ga0105237_10701180 | Ga0105237_107011802 | 78 |
| 238 | 3300009551 | Ga0105238_10222721 | Ga0105238_102227212 | 78 |
| 239 | 3300009551 | Ga0105238_11123542 | Ga0105238_111235422 | 78 |
| 240 | 3300009553 | Ga0105249_10000046 | Ga0105249_10000046173 | 78 |
| 241 | 3300009553 | Ga0105249_10001173 | Ga0105249_100011738 | 78 |
| 242 | 3300009553 | Ga0105249_10049221 | Ga0105249_100492212 | 78 |
| 243 | 3300009553 | Ga0105249_11959758 | Ga0105249_119597582 | 78 |
| 244 | 3300010159 | Ga0099796_10085731 | Ga0099796_100857312 | 78 |
| 245 | 3300010159 | Ga0099796_10127969 | Ga0099796_101279692 | 78 |
| 246 | 3300010375 | Ga0105239_10003767 | Ga0105239_1000376719 | 78 |
| 247 | 3300010375 | Ga0105239_10111843 | Ga0105239_101118432 | 78 |
| 248 | 3300010375 | Ga0105239_12893421 | Ga0105239_128934212 | 78 |
| 249 | 3300011119 | Ga0105246_10058357 | Ga0105246_100583573 | 78 |
| 250 | 3300011119 | Ga0105246_10963103 | Ga0105246_109631031 | 78 |
| 251 | 3300011119 | Ga0105246_11025176 | Ga0105246_110251762 | 78 |
| 252 | 3300011119 | Ga0105246_12254920 | Ga0105246_122549201 | 78 |
| 253 | 3300013100 | Ga0157373_10522362 | Ga0157373_105223622 | 78 |
| 254 | 3300013105 | Ga0157369_10497233 | Ga0157369_104972332 | 78 |
| 255 | 3300013296 | Ga0157374_10059129 | Ga0157374_100591292 | 78 |
| 256 | 3300013297 | Ga0157378_10004246 | Ga0157378_100042463 | 78 |
| 257 | 3300013297 | Ga0157378_10271142 | Ga0157378_102711422 | 78 |
| 258 | 3300013306 | Ga0163162_10024496 | Ga0163162_100244965 | 78 |
| 259 | 3300013306 | Ga0163162_10154319 | Ga0163162_101543193 | 78 |
| 260 | 3300013306 | Ga0163162_10419971 | Ga0163162_104199712 | 78 |
| 261 | 3300013306 | Ga0163162_10529598 | Ga0163162_105295982 | 78 |
| 262 | 3300013306 | Ga0163162_10678895 | Ga0163162_106788952 | 78 |
| 263 | 3300013306 | Ga0163162_10819523 | Ga0163162_108195232 | 78 |
| 264 | 3300013306 | Ga0163162_11571371 | Ga0163162_115713712 | 78 |
| 265 | 3300013306 | Ga0163162_13154370 | Ga0163162_131543702 | 78 |
| 266 | 3300013307 | Ga0157372_10001604 | Ga0157372_1000160415 | 78 |
| 267 | 3300013307 | Ga0157372_10473707 | Ga0157372_104737072 | 78 |
| 268 | 3300013307 | Ga0157372_10519610 | Ga0157372_105196103 | 78 |
| 269 | 3300013308 | Ga0157375_10000618 | Ga0157375_100006189 | 78 |
| 270 | 3300013308 | Ga0157375_10780559 | Ga0157375_107805592 | 78 |
| 271 | 3300013308 | Ga0157375_13141042 | Ga0157375_131410422 | 78 |
| 272 | 3300013308 | Ga0157375_13165848 | Ga0157375_131658482 | 78 |
| 273 | 3300014325 | Ga0163163_10010547 | Ga0163163_100105474 | 78 |
| 274 | 3300014325 | Ga0163163_10012529 | Ga0163163_100125294 | 78 |
| 275 | 3300014325 | Ga0163163_10694615 | Ga0163163_106946152 | 78 |
| 276 | 3300014325 | Ga0163163_10719066 | Ga0163163_107190662 | 78 |
| 277 | 3300014326 | Ga0157380_10000392 | Ga0157380_1000039210 | 78 |
| 278 | 3300014326 | Ga0157380_10144014 | Ga0157380_101440143 | 78 |
| 279 | 3300014745 | Ga0157377_10001431 | Ga0157377_100014319 | 78 |
| 280 | 3300014968 | Ga0157379_10028061 | Ga0157379_100280613 | 78 |
| 281 | 3300014968 | Ga0157379_10075352 | Ga0157379_100753525 | 78 |
| 282 | 3300014969 | Ga0157376_10117550 | Ga0157376_101175503 | 78 |
| 283 | 3300014969 | Ga0157376_10723711 | Ga0157376_107237112 | 78 |
| 284 | 3300017792 | Ga0163161_10016460 | Ga0163161_100164603 | 78 |
| 285 | 3300017792 | Ga0163161_10070881 | Ga0163161_100708813 | 78 |
| 286 | 3300017792 | Ga0163161_10218509 | Ga0163161_102185092 | 78 |
| 287 | 3300017792 | Ga0163161_10379412 | Ga0163161_103794122 | 78 |
| 288 | 3300021361 | Ga0213872_10333460 | Ga0213872_103334602 | 78 |
| 289 | 3300021377 | Ga0213874_10155723 | Ga0213874_101557232 | 78 |
| 290 | 3300021377 | Ga0213874_10378954 | Ga0213874_103789541 | 78 |
| 291 | 3300021384 | Ga0213876_10002020 | Ga0213876_1000202012 | 78 |
| 292 | 3300021384 | Ga0213876_10201969 | Ga0213876_102019692 | 78 |
| 293 | 3300021388 | Ga0213875_10011877 | Ga0213875_100118775 | 78 |
| 294 | 3300021388 | Ga0213875_10621076 | Ga0213875_106210761 | 78 |
| 295 | 3300025223 | Ga0207672_1003246 | Ga0207672_10032462 | 78 |
| 296 | 3300025711 | Ga0207696_1047401 | Ga0207696_10474012 | 78 |
| 297 | 3300025885 | Ga0207653_10028251 | Ga0207653_100282513 | 78 |
| 298 | 3300025893 | Ga0207682_10201039 | Ga0207682_102010392 | 78 |
| 299 | 3300025898 | Ga0207692_10009413 | Ga0207692_100094133 | 78 |
| 300 | 3300025898 | Ga0207692_10024317 | Ga0207692_100243173 | 78 |
| 301 | 3300025898 | Ga0207692_11096842 | Ga0207692_110968422 | 78 |
| 302 | 3300025899 | Ga0207642_10000167 | Ga0207642_100001675 | 78 |
| 303 | 3300025899 | Ga0207642_10011950 | Ga0207642_100119504 | 78 |
| 304 | 3300025900 | Ga0207710_10000060 | Ga0207710_1000006058 | 78 |
| 305 | 3300025900 | Ga0207710_10002164 | Ga0207710_100021642 | 78 |
| 306 | 3300025901 | Ga0207688_10002083 | Ga0207688_1000208310 | 78 |
| 307 | 3300025901 | Ga0207688_10002935 | Ga0207688_1000293510 | 78 |
| 308 | 3300025901 | Ga0207688_10308502 | Ga0207688_103085022 | 78 |
| 309 | 3300025901 | Ga0207688_10464274 | Ga0207688_104642742 | 78 |
| 310 | 3300025903 | Ga0207680_10227594 | Ga0207680_102275942 | 78 |
| 311 | 3300025903 | Ga0207680_10356304 | Ga0207680_103563042 | 78 |
| 312 | 3300025904 | Ga0207647_10110703 | Ga0207647_101107033 | 78 |
| 313 | 3300025904 | Ga0207647_10123121 | Ga0207647_101231213 | 78 |
| 314 | 3300025905 | Ga0207685_10001566 | Ga0207685_100015662 | 78 |
| 315 | 3300025905 | Ga0207685_10011806 | Ga0207685_100118063 | 78 |
| 316 | 3300025906 | Ga0207699_10043101 | Ga0207699_100431013 | 78 |
| 317 | 3300025906 | Ga0207699_10324815 | Ga0207699_103248152 | 78 |
| 318 | 3300025907 | Ga0207645_10006460 | Ga0207645_100064608 | 78 |
| 319 | 3300025911 | Ga0207654_10105711 | Ga0207654_101057113 | 78 |
| 320 | 3300025912 | Ga0207707_11039206 | Ga0207707_110392061 | 78 |
| 321 | 3300025914 | Ga0207671_10460298 | Ga0207671_104602982 | 78 |
| 322 | 3300025915 | Ga0207693_10001382 | Ga0207693_100013828 | 78 |
| 323 | 3300025915 | Ga0207693_10001847 | Ga0207693_1000184715 | 78 |
| 324 | 3300025915 | Ga0207693_10429275 | Ga0207693_104292752 | 78 |
| 325 | 3300025916 | Ga0207663_10002032 | Ga0207663_100020323 | 78 |
| 326 | 3300025916 | Ga0207663_10011241 | Ga0207663_100112413 | 78 |
| 327 | 3300025918 | Ga0207662_10057183 | Ga0207662_100571834 | 78 |
| 328 | 3300025918 | Ga0207662_10455245 | Ga0207662_104552452 | 78 |
| 329 | 3300025919 | Ga0207657_10053439 | Ga0207657_100534394 | 78 |
| 330 | 3300025919 | Ga0207657_10297913 | Ga0207657_102979132 | 78 |
| 331 | 3300025921 | Ga0207652_10550576 | Ga0207652_105505761 | 78 |
| 332 | 3300025923 | Ga0207681_10014914 | Ga0207681_100149145 | 78 |
| 333 | 3300025923 | Ga0207681_10048026 | Ga0207681_100480263 | 78 |
| 334 | 3300025924 | Ga0207694_11042688 | Ga0207694_110426882 | 78 |
| 335 | 3300025925 | Ga0207650_11906520 | Ga0207650_119065202 | 78 |
| 336 | 3300025926 | Ga0207659_10216495 | Ga0207659_102164952 | 78 |
| 337 | 3300025927 | Ga0207687_10006868 | Ga0207687_100068687 | 78 |
| 338 | 3300025927 | Ga0207687_10055429 | Ga0207687_100554293 | 78 |
| 339 | 3300025927 | Ga0207687_10520984 | Ga0207687_105209842 | 78 |
| 340 | 3300025927 | Ga0207687_11082534 | Ga0207687_110825342 | 78 |
| 341 | 3300025928 | Ga0207700_10934600 | Ga0207700_109346001 | 78 |
| 342 | 3300025929 | Ga0207664_10170042 | Ga0207664_101700422 | 78 |
| 343 | 3300025929 | Ga0207664_10273554 | Ga0207664_102735543 | 78 |
| 344 | 3300025929 | Ga0207664_11607051 | Ga0207664_116070512 | 78 |
| 345 | 3300025931 | Ga0207644_10013536 | Ga0207644_100135362 | 78 |
| 346 | 3300025932 | Ga0207690_10013779 | Ga0207690_100137796 | 78 |
| 347 | 3300025932 | Ga0207690_11112989 | Ga0207690_111129892 | 78 |
| 348 | 3300025933 | Ga0207706_10007224 | Ga0207706_100072244 | 78 |
| 349 | 3300025934 | Ga0207686_10001374 | Ga0207686_100013748 | 78 |
| 350 | 3300025934 | Ga0207686_10864728 | Ga0207686_108647282 | 78 |
| 351 | 3300025934 | Ga0207686_11295226 | Ga0207686_112952262 | 78 |
| 352 | 3300025935 | Ga0207709_10004392 | Ga0207709_100043928 | 78 |
| 353 | 3300025935 | Ga0207709_10060986 | Ga0207709_100609863 | 78 |
| 354 | 3300025936 | Ga0207670_10166891 | Ga0207670_101668912 | 78 |
| 355 | 3300025936 | Ga0207670_11612016 | Ga0207670_116120162 | 78 |
| 356 | 3300025937 | Ga0207669_10002459 | Ga0207669_100024597 | 78 |
| 357 | 3300025937 | Ga0207669_10850045 | Ga0207669_108500452 | 78 |
| 358 | 3300025938 | Ga0207704_10000782 | Ga0207704_1000078213 | 78 |
| 359 | 3300025938 | Ga0207704_10255994 | Ga0207704_102559942 | 78 |
| 360 | 3300025939 | Ga0207665_10002538 | Ga0207665_100025383 | 78 |
| 361 | 3300025939 | Ga0207665_10009183 | Ga0207665_100091833 | 78 |
| 362 | 3300025939 | Ga0207665_10238527 | Ga0207665_102385272 | 78 |
| 363 | 3300025939 | Ga0207665_10464640 | Ga0207665_104646402 | 78 |
| 364 | 3300025941 | Ga0207711_10000202 | Ga0207711_1000020236 | 78 |
| 365 | 3300025941 | Ga0207711_10034656 | Ga0207711_100346566 | 78 |
| 366 | 3300025941 | Ga0207711_10196945 | Ga0207711_101969452 | 78 |
| 367 | 3300025942 | Ga0207689_10026005 | Ga0207689_100260053 | 78 |
| 368 | 3300025942 | Ga0207689_11229313 | Ga0207689_112293131 | 78 |
| 369 | 3300025944 | Ga0207661_10534907 | Ga0207661_105349072 | 78 |
| 370 | 3300025949 | Ga0207667_10438704 | Ga0207667_104387042 | 78 |
| 371 | 3300025949 | Ga0207667_10748967 | Ga0207667_107489672 | 78 |
| 372 | 3300025960 | Ga0207651_10336513 | Ga0207651_103365132 | 78 |
| 373 | 3300025960 | Ga0207651_10377840 | Ga0207651_103778402 | 78 |
| 374 | 3300025961 | Ga0207712_10000042 | Ga0207712_100000428 | 78 |
| 375 | 3300025961 | Ga0207712_10008647 | Ga0207712_100086474 | 78 |
| 376 | 3300025961 | Ga0207712_10065648 | Ga0207712_100656483 | 78 |
| 377 | 3300025961 | Ga0207712_10370364 | Ga0207712_103703642 | 78 |
| 378 | 3300025961 | Ga0207712_11190356 | Ga0207712_111903562 | 78 |
| 379 | 3300025972 | Ga0207668_10011924 | Ga0207668_100119243 | 78 |
| 380 | 3300025972 | Ga0207668_10111900 | Ga0207668_101119003 | 78 |
| 381 | 3300025972 | Ga0207668_11357484 | Ga0207668_113574842 | 78 |
| 382 | 3300025981 | Ga0207640_10004834 | Ga0207640_100048347 | 78 |
| 383 | 3300025981 | Ga0207640_10182979 | Ga0207640_101829792 | 78 |
| 384 | 3300025981 | Ga0207640_10522786 | Ga0207640_105227862 | 78 |
| 385 | 3300025986 | Ga0207658_10000409 | Ga0207658_100004093 | 78 |
| 386 | 3300025986 | Ga0207658_10010952 | Ga0207658_100109525 | 78 |
| 387 | 3300025986 | Ga0207658_10161563 | Ga0207658_101615632 | 78 |
| 388 | 3300025986 | Ga0207658_10263243 | Ga0207658_102632432 | 78 |
| 389 | 3300025986 | Ga0207658_11474042 | Ga0207658_114740422 | 78 |
| 390 | 3300026023 | Ga0207677_10004948 | Ga0207677_100049484 | 78 |
| 391 | 3300026023 | Ga0207677_10031317 | Ga0207677_100313173 | 78 |
| 392 | 3300026023 | Ga0207677_10437664 | Ga0207677_104376642 | 78 |
| 393 | 3300026035 | Ga0207703_10010438 | Ga0207703_100104384 | 78 |
| 394 | 3300026035 | Ga0207703_10210689 | Ga0207703_102106892 | 78 |
| 395 | 3300026035 | Ga0207703_10335301 | Ga0207703_103353013 | 78 |
| 396 | 3300026035 | Ga0207703_11463870 | Ga0207703_114638702 | 78 |
| 397 | 3300026041 | Ga0207639_10039781 | Ga0207639_100397811 | 78 |
| 398 | 3300026041 | Ga0207639_10497629 | Ga0207639_104976292 | 78 |
| 399 | 3300026067 | Ga0207678_10006686 | Ga0207678_100066865 | 78 |
| 400 | 3300026067 | Ga0207678_10015033 | Ga0207678_100150332 | 78 |
| 401 | 3300026075 | Ga0207708_10004516 | Ga0207708_100045161 | 78 |
| 402 | 3300026075 | Ga0207708_10052632 | Ga0207708_100526322 | 78 |
| 403 | 3300026075 | Ga0207708_10268385 | Ga0207708_102683852 | 78 |
| 404 | 3300026075 | Ga0207708_10623401 | Ga0207708_106234012 | 78 |
| 405 | 3300026078 | Ga0207702_10386599 | Ga0207702_103865992 | 78 |
| 406 | 3300026088 | Ga0207641_10007933 | Ga0207641_100079339 | 78 |
| 407 | 3300026088 | Ga0207641_10009388 | Ga0207641_100093883 | 78 |
| 408 | 3300026088 | Ga0207641_10093421 | Ga0207641_100934212 | 78 |
| 409 | 3300026089 | Ga0207648_10004400 | Ga0207648_100044007 | 78 |
| 410 | 3300026089 | Ga0207648_10122222 | Ga0207648_101222223 | 78 |
| 411 | 3300026095 | Ga0207676_10207378 | Ga0207676_102073783 | 78 |
| 412 | 3300026095 | Ga0207676_10696378 | Ga0207676_106963782 | 78 |
| 413 | 3300026095 | Ga0207676_11563999 | Ga0207676_115639992 | 78 |
| 414 | 3300026118 | Ga0207675_100000419 | Ga0207675_10000041910 | 78 |
| 415 | 3300026118 | Ga0207675_100085853 | Ga0207675_1000858533 | 78 |
| 416 | 3300026118 | Ga0207675_101726178 | Ga0207675_1017261781 | 78 |
| 417 | 3300026121 | Ga0207683_10000386 | Ga0207683_1000038610 | 78 |
| 418 | 3300026121 | Ga0207683_10096016 | Ga0207683_100960163 | 78 |
| 419 | 3300026142 | Ga0207698_10187837 | Ga0207698_101878373 | 78 |
| 420 | 3300026142 | Ga0207698_10344979 | Ga0207698_103449792 | 78 |
| 421 | 3300027866 | Ga0209813_10133789 | Ga0209813_101337892 | 78 |
| 422 | 3300028379 | Ga0268266_10015538 | Ga0268266_100155382 | 78 |
| 423 | 3300028379 | Ga0268266_10020057 | Ga0268266_100200575 | 78 |
| 424 | 3300028379 | Ga0268266_10033092 | Ga0268266_100330925 | 78 |
| 425 | 3300028380 | Ga0268265_10000051 | Ga0268265_10000051171 | 78 |
| 426 | 3300028380 | Ga0268265_10006561 | Ga0268265_100065616 | 78 |
| 427 | 3300028380 | Ga0268265_10188270 | Ga0268265_101882702 | 78 |
| 428 | 3300028380 | Ga0268265_10197437 | Ga0268265_101974372 | 78 |
| 429 | 3300028380 | Ga0268265_10524320 | Ga0268265_105243202 | 78 |
| 430 | 3300028380 | Ga0268265_11726196 | Ga0268265_117261962 | 78 |
| 431 | 3300028381 | Ga0268264_10000108 | Ga0268264_1000010834 | 78 |
| 432 | 3300028381 | Ga0268264_10019336 | Ga0268264_100193364 | 78 |
| 433 | 3300028381 | Ga0268264_10181326 | Ga0268264_101813263 | 78 |
| 434 | 3300028381 | Ga0268264_10258218 | Ga0268264_102582182 | 78 |
| 435 | 3300028381 | Ga0268264_11229131 | Ga0268264_112291312 | 78 |
| 436 | 3300028381 | Ga0268264_11319055 | Ga0268264_113190551 | 78 |
| 437 | 3300031852 | Ga0307410_10002941 | Ga0307410_100029414 | 78 |
| 438 | 3300031852 | Ga0307410_10160464 | Ga0307410_101604642 | 78 |
| 439 | 3300031852 | Ga0307410_11374609 | Ga0307410_113746092 | 78 |
| 440 | 3300031901 | Ga0307406_10037252 | Ga0307406_100372522 | 78 |
| 441 | 3300031903 | Ga0307407_10169413 | Ga0307407_101694132 | 78 |
| 442 | 3300031903 | Ga0307407_10706202 | Ga0307407_107062021 | 78 |
| 443 | 3300031995 | Ga0307409_100117999 | Ga0307409_1001179992 | 78 |
| 444 | 3300031995 | Ga0307409_100516895 | Ga0307409_1005168952 | 78 |
| 445 | 3300031995 | Ga0307409_101360740 | Ga0307409_1013607401 | 78 |
| 446 | 3300032002 | Ga0307416_100239307 | Ga0307416_1002393072 | 78 |
| 447 | 3300032002 | Ga0307416_101046657 | Ga0307416_1010466572 | 78 |
| 448 | 3300032004 | Ga0307414_10329339 | Ga0307414_103293392 | 78 |
| 449 | 3300032005 | Ga0307411_10010708 | Ga0307411_100107084 | 78 |
| 450 | 3300032005 | Ga0307411_10844074 | Ga0307411_108440742 | 78 |
| 451 | 3300032126 | Ga0307415_100191992 | Ga0307415_1001919922 | 78 |
| 452 | 3300034819 | Ga0373958_0075028 | Ga0373958_0075028_182_424 | 78 |
| 453 | 3300034957 | Ga0373938_0161466 | Ga0373938_0161466_68_310 | 78 |
| 454 | 3300035091 | Ga0373951_0108321 | Ga0373951_0108321_212_448 | 78 |
| 455 | 3300035114 | Ga0373939_0126951 | Ga0373939_0126951_508_750 | 78 |
| 456 | 3300035115 | Ga0373941_0068426 | Ga0373941_0068426_545_781 | 78 |
| 457 | 3300035121 | Ga0373960_0032858 | Ga0373960_0032858_1015_1257 | 78 |
| 458 | 3300035691 | Ga0373931_0007355 | Ga0373931_0007355_2969_3211 | 78 |
| 459 | 3300035691 | Ga0373931_0172817 | Ga0373931_0172817_253_489 | 78 |
| 460 | 3300035725 | Ga0373947_0413402 | Ga0373947_0413402_515_751 | 78 |
| 461 | 3300037068 | Ga0373925_0720096 | Ga0373925_0720096_509_751 | 78 |
| 462 | 3300037466 | Ga0395898_1044394 | Ga0395898_1044394_92_328 | 78 |
| 463 | 3300037471 | Ga0395905_0656641 | Ga0395905_0656641_478_714 | 78 |
| 464 | 3300037853 | Ga0436364_0210802 | Ga0436364_0210802_24_260 | 78 |
| 465 | 3300037853 | Ga0436364_0665239 | Ga0436364_0665239_11136_11372 | 78 |
| 466 | 3300037853 | Ga0436364_0740200 | Ga0436364_0740200_287_523 | 78 |
| 467 | 3300037853 | Ga0436364_1035203 | Ga0436364_1035203_513_749 | 78 |
| 468 | 3300039437 | Ga0436365_0085052 | Ga0436365_0085052_1186_1440 | 78 |
| 469 | 3300039437 | Ga0436365_0411865 | Ga0436365_0411865_4887_5123 | 78 |
| 470 | 3300039437 | Ga0436365_0922410 | Ga0436365_0922410_1711_1947 | 78 |
| 471 | 3300039437 | Ga0436365_1355905 | Ga0436365_1355905_22640_22876 | 78 |
| 472 | 3300039438 | Ga0436360_0892117 | Ga0436360_0892117_706_942 | 78 |
| 473 | 3300039447 | Ga0436361_0217454 | Ga0436361_0217454_48_284 | 78 |
| 474 | 3300039447 | Ga0436361_0492283 | Ga0436361_0492283_140_376 | 78 |
| 475 | 3300039450 | Ga0436363_0141792 | Ga0436363_0141792_267_503 | 78 |
| 476 | 3300039450 | Ga0436363_0669183 | Ga0436363_0669183_25_276 | 78 |
| 477 | 3300039450 | Ga0436363_0829327 | Ga0436363_0829327_327_569 | 78 |
| 478 | 3300039450 | Ga0436363_0861738 | Ga0436363_0861738_339_575 | 78 |
| 479 | 3300039450 | Ga0436363_1362967 | Ga0436363_1362967_776_1012 | 78 |
| 480 | 3300039450 | Ga0436363_1519424 | Ga0436363_1519424_1609_1845 | 78 |
| 481 | 3300039450 | Ga0436363_1702584 | Ga0436363_1702584_279_515 | 78 |
| 482 | 3300039453 | Ga0436362_1160607 | Ga0436362_1160607_218_454 | 78 |
| 483 | 3300041410 | Ga0439461_0012051 | Ga0439461_0012051_1009_1251 | 78 |
| 484 | 3300041411 | Ga0439466_0001413 | Ga0439466_0001413_168_410 | 78 |
| 485 | 3300041411 | Ga0439466_0052592 | Ga0439466_0052592_309_545 | 78 |
| 486 | 3300041413 | Ga0439465_0002196 | Ga0439465_0002196_5026_5262 | 78 |
| 487 | 3300041413 | Ga0439465_0002908 | Ga0439465_0002908_376_618 | 78 |
| 488 | 3300041413 | Ga0439465_0209662 | Ga0439465_0209662_446_682 | 78 |
| 489 | 3300041491 | Ga0451833_1334059 | Ga0451833_1334059_249_485 | 78 |
| 490 | 3300041501 | Ga0451845_0290541 | Ga0451845_0290541_144_380 | 78 |
| 491 | 3300041507 | Ga0451851_1366376 | Ga0451851_1366376_257_493 | 78 |
| 492 | 3300041512 | Ga0451853_0827965 | Ga0451853_0827965_317_559 | 78 |
| 493 | 3300041997 | Ga0439431_0085283 | Ga0439431_0085283_239_481 | 78 |
| 494 | 3300041997 | Ga0439431_0155130 | Ga0439431_0155130_240_476 | 78 |
| 495 | 3300042002 | Ga0439442_004331 | Ga0439442_004331_463_705 | 78 |
| 496 | 3300042004 | Ga0439445_0012586 | Ga0439445_0012586_1348_1584 | 78 |
| 497 | 3300042004 | Ga0439445_0026649 | Ga0439445_0026649_957_1199 | 78 |
| 498 | 3300042435 | Ga0439434_0010245 | Ga0439434_0010245_803_1045 | 78 |
| 499 | 3300042438 | Ga0439459_0071878 | Ga0439459_0071878_38_274 | 78 |
| 500 | 3300044656 | Ga0466969_0041698 | Ga0466969_0041698_891_1127 | 78 |
| 501 | 3300044656 | Ga0466969_0117849 | Ga0466969_0117849_504_740 | 78 |
| 502 | 3300044658 | Ga0466972_0048372 | Ga0466972_0048372_577_819 | 78 |
| 503 | 3300044658 | Ga0466972_0089285 | Ga0466972_0089285_322_558 | 78 |
| 504 | 3300044658 | Ga0466972_0138215 | Ga0466972_0138215_510_746 | 78 |
| 505 | 3300044683 | Ga0466965_0300226 | Ga0466965_0300226_261_497 | 78 |
| 506 | 3300044684 | Ga0466966_0003513 | Ga0466966_0003513_8896_9132 | 78 |
| 507 | 3300044684 | Ga0466966_0010506 | Ga0466966_0010506_4308_4544 | 78 |
| 508 | 3300044684 | Ga0466966_0136596 | Ga0466966_0136596_402_638 | 78 |
| 509 | 3300044693 | Ga0466961_0011041 | Ga0466961_0011041_2504_2740 | 78 |
| 510 | 3300044693 | Ga0466961_0137673 | Ga0466961_0137673_764_1000 | 78 |
| 511 | 3300044693 | Ga0466961_0985250 | Ga0466961_0985250_54_290 | 78 |
| 512 | 3300044694 | Ga0466963_0065877 | Ga0466963_0065877_1963_2199 | 78 |
| 513 | 3300044694 | Ga0466963_0088987 | Ga0466963_0088987_1703_1939 | 78 |
| 514 | 3300044694 | Ga0466963_0186490 | Ga0466963_0186490_600_836 | 78 |
| 515 | 3300044694 | Ga0466963_0190247 | Ga0466963_0190247_368_604 | 78 |
| 516 | 3300044694 | Ga0466963_0190617 | Ga0466963_0190617_581_829 | 78 |
| 517 | 3300044694 | Ga0466963_0552132 | Ga0466963_0552132_409_645 | 78 |
| 518 | 3300044706 | Ga0466964_0096277 | Ga0466964_0096277_832_1068 | 78 |
| 519 | 3300044706 | Ga0466964_0162813 | Ga0466964_0162813_422_658 | 78 |
| 520 | 3300044706 | Ga0466964_0324821 | Ga0466964_0324821_162_398 | 78 |
| 521 | 3300044719 | Ga0466971_0030802 | Ga0466971_0030802_1180_1416 | 78 |
| 522 | 3300044719 | Ga0466971_0077300 | Ga0466971_0077300_633_869 | 78 |
| 523 | 3300044719 | Ga0466971_0177058 | Ga0466971_0177058_210_458 | 78 |
| 524 | 3300044719 | Ga0466971_0378190 | Ga0466971_0378190_289_525 | 78 |
| 525 | 3300044735 | Ga0466968_0004782 | Ga0466968_0004782_639_887 | 78 |
| 526 | 3300044735 | Ga0466968_0266771 | Ga0466968_0266771_63_299 | 78 |
| 527 | 3300044765 | Ga0466970_0046356 | Ga0466970_0046356_1093_1329 | 78 |
| 528 | 3300044842 | Ga0466957_0003608 | Ga0466957_0003608_3225_3461 | 78 |
| 529 | 3300044842 | Ga0466957_0156352 | Ga0466957_0156352_761_997 | 78 |
| 530 | 3300044842 | Ga0466957_0200628 | Ga0466957_0200628_529_765 | 78 |
| 531 | 3300044842 | Ga0466957_0217607 | Ga0466957_0217607_495_731 | 78 |
| 532 | 3300044842 | Ga0466957_0452894 | Ga0466957_0452894_527_763 | 78 |
| 533 | 3300044901 | Ga0466960_0002343 | Ga0466960_0002343_2605_2841 | 78 |
| 534 | 3300044901 | Ga0466960_0020412 | Ga0466960_0020412_2298_2534 | 78 |
| 535 | 3300044901 | Ga0466960_0564862 | Ga0466960_0564862_218_454 | 78 |
| 536 | 3300044901 | Ga0466960_0985694 | Ga0466960_0985694_156_392 | 78 |
| 537 | 3300045049 | Ga0466959_0068362 | Ga0466959_0068362_366_602 | 78 |
| 538 | 3300045049 | Ga0466959_0582925 | Ga0466959_0582925_278_514 | 78 |
| 539 | 3300045836 | Ga0466958_0002894 | Ga0466958_0002894_6261_6497 | 78 |
| 540 | 3300045836 | Ga0466958_0042317 | Ga0466958_0042317_25_261 | 78 |
| 541 | 3300045836 | Ga0466958_0063326 | Ga0466958_0063326_681_917 | 78 |
| 542 | 3300045836 | Ga0466958_0105310 | Ga0466958_0105310_776_1012 | 78 |
| 543 | 3300045976 | Ga0466967_0007417 | Ga0466967_0007417_3429_3665 | 78 |
| 544 | 3300045976 | Ga0466967_0128451 | Ga0466967_0128451_1405_1641 | 78 |
| 545 | 3300045976 | Ga0466967_0354590 | Ga0466967_0354590_764_1000 | 78 |
| 546 | 3300045976 | Ga0466967_0507133 | Ga0466967_0507133_866_1102 | 78 |
| 547 | 3300045976 | Ga0466967_0679503 | Ga0466967_0679503_180_416 | 78 |
| 548 | 3300045976 | Ga0466967_0754954 | Ga0466967_0754954_542_778 | 78 |
| 549 | 3300045976 | Ga0466967_2169028 | Ga0466967_2169028_77_313 | 78 |
| 550 | 3300045976 | Ga0466967_2434759 | Ga0466967_2434759_101_337 | 78 |
| 551 | 3300046459 | Ga0495629_0144134 | Ga0495629_0144134_1008_1244 | 78 |
| 552 | 3300046461 | Ga0495641_0016281 | Ga0495641_0016281_112_348 | 78 |
| 553 | 3300046473 | Ga0495582_0008239 | Ga0495582_0008239_1702_1938 | 78 |
| 554 | 3300046475 | Ga0495639_0137128 | Ga0495639_0137128_249_485 | 78 |
| 555 | 3300046491 | Ga0495584_0376903 | Ga0495584_0376903_216_452 | 78 |
| 556 | 3300046507 | Ga0495606_0617058 | Ga0495606_0617058_162_404 | 78 |
| 557 | 3300046517 | Ga0495630_0055810 | Ga0495630_0055810_1991_2227 | 78 |
| 558 | 3300046533 | Ga0495640_0049163 | Ga0495640_0049163_2030_2266 | 78 |
| 559 | 3300046557 | Ga0495622_0394675 | Ga0495622_0394675_267_509 | 78 |
| 560 | 3300046642 | Ga0495634_0883627 | Ga0495634_0883627_184_420 | 78 |
| 561 | 3300046648 | Ga0495611_0315501 | Ga0495611_0315501_230_466 | 78 |
| 562 | 3300046683 | Ga0495658_0037158 | Ga0495658_0037158_1359_1595 | 78 |
| 563 | 3300046689 | Ga0495613_0492805 | Ga0495613_0492805_485_721 | 78 |
| 564 | 3300046690 | Ga0495624_0562225 | Ga0495624_0562225_262_498 | 78 |
| 565 | 3300046694 | Ga0495649_0243805 | Ga0495649_0243805_513_749 | 78 |
| 566 | 3300046794 | Ga0495589_0440009 | Ga0495589_0440009_159_401 | 78 |
| 567 | 3300047315 | Ga0495581_0259194 | Ga0495581_0259194_23_259 | 78 |
| 568 | 3300047319 | Ga0495674_0130317 | Ga0495674_0130317_605_841 | 78 |
| 569 | 3300047320 | Ga0495672_0109666 | Ga0495672_0109666_1062_1304 | 78 |
| 570 | 3300047321 | Ga0495676_0236647 | Ga0495676_0236647_726_968 | 78 |
| 571 | 3300047471 | Ga0495684_0672487 | Ga0495684_0672487_28_264 | 78 |
| 572 | 3300047673 | Ga0495593_0170572 | Ga0495593_0170572_300_542 | 78 |
| 573 | 3300048091 | Ga0495626_0408599 | Ga0495626_0408599_270_506 | 78 |
| 574 | 3300048903 | Ga0496100_0020033 | Ga0496100_0020033_2869_3105 | 78 |
| 575 | 3300048903 | Ga0496100_0120217 | Ga0496100_0120217_124_366 | 78 |
| 576 | 3300048903 | Ga0496100_0121195 | Ga0496100_0121195_899_1135 | 78 |
| 577 | 3300048903 | Ga0496100_1434927 | Ga0496100_1434927_210_446 | 78 |
| 578 | 3300048904 | Ga0496101_0002255 | Ga0496101_0002255_3069_3311 | 78 |
| 579 | 3300048904 | Ga0496101_0006735 | Ga0496101_0006735_5222_5458 | 78 |
| 580 | 3300048904 | Ga0496101_0032011 | Ga0496101_0032011_1087_1323 | 78 |
| 581 | 3300048904 | Ga0496101_0040574 | Ga0496101_0040574_781_1017 | 78 |
| 582 | 3300048904 | Ga0496101_0582327 | Ga0496101_0582327_82_324 | 78 |
| 583 | 3300048904 | Ga0496101_0728461 | Ga0496101_0728461_203_439 | 78 |
| 584 | 3300048904 | Ga0496101_1362230 | Ga0496101_1362230_33_287 | 78 |
| 585 | 3300048905 | Ga0496102_0001066 | Ga0496102_0001066_16517_16753 | 78 |
| 586 | 3300048905 | Ga0496102_0014356 | Ga0496102_0014356_6473_6715 | 78 |
| 587 | 3300048905 | Ga0496102_0052105 | Ga0496102_0052105_77_313 | 78 |
| 588 | 3300048905 | Ga0496102_0082538 | Ga0496102_0082538_1602_1838 | 78 |
| 589 | 3300048905 | Ga0496102_0085035 | Ga0496102_0085035_496_732 | 78 |
| 590 | 3300048905 | Ga0496102_0156613 | Ga0496102_0156613_1486_1722 | 78 |
| 591 | 3300048905 | Ga0496102_0201134 | Ga0496102_0201134_1287_1523 | 78 |
| 592 | 3300048906 | Ga0496103_0001226 | Ga0496103_0001226_11269_11511 | 78 |
| 593 | 3300048906 | Ga0496103_0002026 | Ga0496103_0002026_10788_11024 | 78 |
| 594 | 3300048906 | Ga0496103_0055611 | Ga0496103_0055611_583_819 | 78 |
| 595 | 3300048906 | Ga0496103_0146630 | Ga0496103_0146630_702_938 | 78 |
| 596 | 3300048906 | Ga0496103_0769103 | Ga0496103_0769103_259_495 | 78 |
| 597 | 3300048906 | Ga0496103_0802779 | Ga0496103_0802779_279_515 | 78 |
| 598 | 3300048907 | Ga0496104_0198656 | Ga0496104_0198656_589_825 | 78 |
| 599 | 3300048907 | Ga0496104_1780180 | Ga0496104_1780180_142_396 | 78 |
| 600 | 3300048908 | Ga0496105_0063979 | Ga0496105_0063979_1199_1435 | 78 |
| 601 | 3300048908 | Ga0496105_0394129 | Ga0496105_0394129_31_273 | 78 |
| 602 | 3300048908 | Ga0496105_0533487 | Ga0496105_0533487_159_401 | 78 |
| 603 | 3300048908 | Ga0496105_0606666 | Ga0496105_0606666_318_554 | 78 |
| 604 | 3300048908 | Ga0496105_0648962 | Ga0496105_0648962_58_294 | 78 |
| 605 | 3300048909 | Ga0496106_0001406 | Ga0496106_0001406_9153_9395 | 78 |
| 606 | 3300048909 | Ga0496106_0188350 | Ga0496106_0188350_1117_1359 | 78 |
| 607 | 3300048909 | Ga0496106_0197064 | Ga0496106_0197064_939_1175 | 78 |
| 608 | 3300048909 | Ga0496106_0702616 | Ga0496106_0702616_49_285 | 78 |
| 609 | 3300048910 | Ga0496107_0001641 | Ga0496107_0001641_2441_2683 | 78 |
| 610 | 3300048910 | Ga0496107_0209830 | Ga0496107_0209830_1124_1360 | 78 |
| 611 | 3300048910 | Ga0496107_0849672 | Ga0496107_0849672_54_290 | 78 |
| 612 | 3300048911 | Ga0496108_0012478 | Ga0496108_0012478_4131_4367 | 78 |
| 613 | 3300048911 | Ga0496108_0147864 | Ga0496108_0147864_879_1121 | 78 |
| 614 | 3300048911 | Ga0496108_0183240 | Ga0496108_0183240_531_767 | 78 |
| 615 | 3300048912 | Ga0496109_0005854 | Ga0496109_0005854_7479_7721 | 78 |
| 616 | 3300048912 | Ga0496109_0009168 | Ga0496109_0009168_2997_3233 | 78 |
| 617 | 3300048912 | Ga0496109_0562674 | Ga0496109_0562674_28_264 | 78 |
| 618 | 3300048912 | Ga0496109_0720040 | Ga0496109_0720040_190_426 | 78 |
| 619 | 3300048912 | Ga0496109_0969161 | Ga0496109_0969161_175_411 | 78 |
| 620 | 3300048913 | Ga0496110_0051203 | Ga0496110_0051203_3272_3508 | 78 |
| 621 | 3300048913 | Ga0496110_0143004 | Ga0496110_0143004_573_809 | 78 |
| 622 | 3300048913 | Ga0496110_0414374 | Ga0496110_0414374_284_520 | 78 |
| 623 | 3300048913 | Ga0496110_0485996 | Ga0496110_0485996_228_470 | 78 |
| 624 | 3300048913 | Ga0496110_1046413 | Ga0496110_1046413_279_521 | 78 |
| 625 | 3300048914 | Ga0496111_0226749 | Ga0496111_0226749_118_354 | 78 |
| 626 | 3300048914 | Ga0496111_0381433 | Ga0496111_0381433_384_620 | 78 |
| 627 | 3300048914 | Ga0496111_1062026 | Ga0496111_1062026_81_335 | 78 |
| 628 | 3300048915 | Ga0496112_0014391 | Ga0496112_0014391_1784_2020 | 78 |
| 629 | 3300048915 | Ga0496112_0038501 | Ga0496112_0038501_2480_2716 | 78 |
| 630 | 3300048915 | Ga0496112_0045521 | Ga0496112_0045521_3024_3266 | 78 |
| 631 | 3300048915 | Ga0496112_0085695 | Ga0496112_0085695_300_536 | 78 |
| 632 | 3300048915 | Ga0496112_0322217 | Ga0496112_0322217_576_812 | 78 |
| 633 | 3300048915 | Ga0496112_0796494 | Ga0496112_0796494_566_802 | 78 |
| 634 | 3300048915 | Ga0496112_1044831 | Ga0496112_1044831_413_649 | 78 |
| 635 | 3300048916 | Ga0496113_0034812 | Ga0496113_0034812_1489_1725 | 78 |
| 636 | 3300048916 | Ga0496113_0267046 | Ga0496113_0267046_999_1241 | 78 |
| 637 | 3300048916 | Ga0496113_0668779 | Ga0496113_0668779_418_654 | 78 |
| 638 | 3300048917 | Ga0496114_0000486 | Ga0496114_0000486_23718_23960 | 78 |
| 639 | 3300048917 | Ga0496114_0445083 | Ga0496114_0445083_473_709 | 78 |
| 640 | 3300048917 | Ga0496114_0799519 | Ga0496114_0799519_477_713 | 78 |
| 641 | 3300048917 | Ga0496114_1541820 | Ga0496114_1541820_283_525 | 78 |
| 642 | 3300048918 | Ga0496115_0002673 | Ga0496115_0002673_1714_1956 | 78 |
| 643 | 3300048918 | Ga0496115_0362645 | Ga0496115_0362645_785_1027 | 78 |
| 644 | 3300048918 | Ga0496115_0625441 | Ga0496115_0625441_148_384 | 78 |
| 645 | 3300048919 | Ga0496116_0181686 | Ga0496116_0181686_406_642 | 78 |
| 646 | 3300048920 | Ga0496117_0000430 | Ga0496117_0000430_40124_40360 | 78 |
| 647 | 3300048921 | Ga0496118_0000165 | Ga0496118_0000165_79621_79857 | 78 |
| 648 | 3300048921 | Ga0496118_0002530 | Ga0496118_0002530_5600_5836 | 78 |
| 649 | 3300048922 | Ga0496119_0005297 | Ga0496119_0005297_5472_5708 | 78 |
| 650 | 3300048923 | Ga0496120_0020219 | Ga0496120_0020219_1085_1321 | 78 |
| 651 | 3300048924 | Ga0496121_0007201 | Ga0496121_0007201_9146_9382 | 78 |
| 652 | 3300048925 | Ga0496122_0362701 | Ga0496122_0362701_449_685 | 78 |
| 653 | 3300048927 | Ga0496124_0203883 | Ga0496124_0203883_75_311 | 78 |
| 654 | 3300048928 | Ga0496125_0006092 | Ga0496125_0006092_6738_6974 | 78 |
| 655 | 3300048929 | Ga0496126_0003255 | Ga0496126_0003255_17537_17773 | 78 |
| 656 | 3300048929 | Ga0496126_0010065 | Ga0496126_0010065_6708_6944 | 78 |
| 657 | 3300049569 | Ga0501032_0006334 | Ga0501032_0006334_299_535 | 78 |
| 658 | 3300049570 | Ga0501033_0008828 | Ga0501033_0008828_6989_7225 | 78 |
| 659 | 3300049570 | Ga0501033_0614765 | Ga0501033_0614765_118_354 | 78 |
| 660 | 3300049571 | Ga0501034_0005259 | Ga0501034_0005259_12035_12271 | 78 |
| 661 | 3300049571 | Ga0501034_0075196 | Ga0501034_0075196_1898_2134 | 78 |
| 662 | 3300049571 | Ga0501034_0530082 | Ga0501034_0530082_178_414 | 78 |
| 663 | 3300049572 | Ga0501036_0076998 | Ga0501036_0076998_662_898 | 78 |
| 664 | 3300049573 | Ga0501037_0003402 | Ga0501037_0003402_3132_3368 | 78 |
| 665 | 3300049575 | Ga0501039_0772504 | Ga0501039_0772504_292_543 | 78 |
| 666 | 3300049579 | Ga0501043_0461422 | Ga0501043_0461422_656_892 | 78 |
| 667 | 3300049580 | Ga0501046_0003379 | Ga0501046_0003379_10965_11201 | 78 |
| 668 | 3300049580 | Ga0501046_0683761 | Ga0501046_0683761_71_322 | 78 |
| 669 | 3300049580 | Ga0501046_1079268 | Ga0501046_1079268_259_495 | 78 |
| 670 | 3300049581 | Ga0501047_0004498 | Ga0501047_0004498_1790_2026 | 78 |
| 671 | 3300049581 | Ga0501047_0019957 | Ga0501047_0019957_2778_3029 | 78 |
| 672 | 3300049581 | Ga0501047_0425496 | Ga0501047_0425496_313_549 | 78 |
| 673 | 3300049581 | Ga0501047_1357948 | Ga0501047_1357948_60_296 | 78 |
| 674 | 3300049582 | Ga0501048_0000667 | Ga0501048_0000667_21005_21241 | 78 |
| 675 | 3300049584 | Ga0501068_0742350 | Ga0501068_0742350_218_460 | 78 |
| 676 | 3300049585 | Ga0501069_0034450 | Ga0501069_0034450_725_961 | 78 |
| 677 | 3300049586 | Ga0501070_0000669 | Ga0501070_0000669_8471_8707 | 78 |
| 678 | 3300049586 | Ga0501070_0026142 | Ga0501070_0026142_4614_4856 | 78 |
| 679 | 3300049589 | Ga0501073_0296647 | Ga0501073_0296647_329_565 | 78 |
| 680 | 3300049589 | Ga0501073_0379916 | Ga0501073_0379916_347_589 | 78 |
| 681 | 3300049591 | Ga0501075_0504579 | Ga0501075_0504579_366_608 | 78 |
| 682 | 3300049742 | Ga0501080_0061436 | Ga0501080_0061436_60_296 | 78 |
| 683 | 3300049742 | Ga0501080_0162495 | Ga0501080_0162495_1642_1884 | 78 |
| 684 | 3300049822 | Ga0501035_0001642 | Ga0501035_0001642_5578_5829 | 78 |
| 685 | 3300049822 | Ga0501035_0005600 | Ga0501035_0005600_1951_2187 | 78 |
| 686 | 3300049823 | Ga0501044_0002795 | Ga0501044_0002795_16435_16686 | 78 |
| 687 | 3300049823 | Ga0501044_0080500 | Ga0501044_0080500_1295_1531 | 78 |
| 688 | 3300049823 | Ga0501044_0759775 | Ga0501044_0759775_102_338 | 78 |
| 689 | 3300050489 | nmdc:mga03683_391651_c1 | nmdc:mga03683_391651_c1_70_306 | 78 |
| 690 | 3300050490 | nmdc:mga03n38_10754_c1 | nmdc:mga03n38_10754_c1_1070_1306 | 78 |
| 691 | 3300050490 | nmdc:mga03n38_1784_c1 | nmdc:mga03n38_1784_c1_3444_3704 | 78 |
| 692 | 3300050490 | nmdc:mga03n38_24001_c1 | nmdc:mga03n38_24001_c1_2153_2404 | 78 |
| 693 | 3300050490 | nmdc:mga03n38_646847_c1 | nmdc:mga03n38_646847_c1_16_258 | 78 |
| 694 | 3300050490 | nmdc:mga03n38_7109_c1 | nmdc:mga03n38_7109_c1_2642_2878 | 78 |
| 695 | 3300050490 | nmdc:mga03n38_7316_c1 | nmdc:mga03n38_7316_c1_1850_2086 | 78 |
| 696 | 3300050491 | nmdc:mga00v17_19256_c1 | nmdc:mga00v17_19256_c1_1705_1965 | 78 |
| 697 | 3300050491 | nmdc:mga00v17_3944_c1 | nmdc:mga00v17_3944_c1_352_588 | 78 |
| 698 | 3300050491 | nmdc:mga00v17_940870_c1 | nmdc:mga00v17_940870_c1_296_532 | 78 |
| 699 | 3300050492 | nmdc:mga0yw44_1004714_c1 | nmdc:mga0yw44_1004714_c1_60_302 | 78 |
| 700 | 3300050492 | nmdc:mga0yw44_143534_c1 | nmdc:mga0yw44_143534_c1_92_343 | 78 |
| 701 | 3300050492 | nmdc:mga0yw44_198331_c1 | nmdc:mga0yw44_198331_c1_262_498 | 78 |
| 702 | 3300050492 | nmdc:mga0yw44_5528_c1 | nmdc:mga0yw44_5528_c1_1658_1918 | 78 |
| 703 | 3300050494 | nmdc:mga06z11_224830_c1 | nmdc:mga06z11_224830_c1_753_989 | 78 |
| 704 | 3300050494 | nmdc:mga06z11_73724_c1 | nmdc:mga06z11_73724_c1_782_1018 | 78 |
| 705 | 3300050494 | nmdc:mga06z11_78535_c1 | nmdc:mga06z11_78535_c1_428_664 | 78 |
| 706 | 3300050495 | nmdc:mga04h51_127934_c1 | nmdc:mga04h51_127934_c1_154_405 | 78 |
| 707 | 3300050495 | nmdc:mga04h51_143312_c1 | nmdc:mga04h51_143312_c1_237_473 | 78 |
| 708 | 3300050495 | nmdc:mga04h51_253272_c1 | nmdc:mga04h51_253272_c1_277_513 | 78 |
| 709 | 3300050496 | nmdc:mga07m45_110684_c1 | nmdc:mga07m45_110684_c1_309_545 | 78 |
| 710 | 3300050496 | nmdc:mga07m45_12019_c2 | nmdc:mga07m45_12019_c2_1460_1696 | 78 |
| 711 | 3300050496 | nmdc:mga07m45_189061_c1 | nmdc:mga07m45_189061_c1_240_476 | 78 |
| 712 | 3300050496 | nmdc:mga07m45_44078_c1 | nmdc:mga07m45_44078_c1_1477_1713 | 78 |
| 713 | 3300050496 | nmdc:mga07m45_47558_c1 | nmdc:mga07m45_47558_c1_1319_1555 | 78 |
| 714 | 3300050496 | nmdc:mga07m45_97324_c1 | nmdc:mga07m45_97324_c1_1134_1385 | 78 |
| 715 | 3300050507 | nmdc:mga05p37_95168_c1 | nmdc:mga05p37_95168_c1_1056_1292 | 78 |
| 716 | 3300050509 | nmdc:mga0qj67_28389_c1 | nmdc:mga0qj67_28389_c1_3754_3990 | 78 |
| 717 | 3300050509 | nmdc:mga0qj67_60357_c1 | nmdc:mga0qj67_60357_c1_1846_2082 | 78 |
| 718 | 3300050510 | nmdc:mga06r32_21217_c1 | nmdc:mga06r32_21217_c1_4410_4646 | 78 |
| 719 | 3300050511 | nmdc:mga08y16_384990_c1 | nmdc:mga08y16_384990_c1_13_255 | 78 |
| 720 | 3300050511 | nmdc:mga08y16_760618_c1 | nmdc:mga08y16_760618_c1_41_301 | 78 |
| 721 | 3300050512 | nmdc:mga0n895_794066_c1 | nmdc:mga0n895_794066_c1_486_722 | 78 |
| 722 | 3300050516 | nmdc:mga0sz30_14487_c1 | nmdc:mga0sz30_14487_c1_961_1197 | 78 |
| 723 | 3300050516 | nmdc:mga0sz30_14605_c1 | nmdc:mga0sz30_14605_c1_2469_2705 | 78 |
| 724 | 3300050516 | nmdc:mga0sz30_5539_c1 | nmdc:mga0sz30_5539_c1_3341_3577 | 78 |
| 725 | 3300050516 | nmdc:mga0sz30_63749_c1 | nmdc:mga0sz30_63749_c1_945_1181 | 78 |
| 726 | 3300053083 | Ga0495655_0152644 | Ga0495655_0152644_260_502 | 78 |
| 727 | 3300053085 | Ga0495619_1066477 | Ga0495619_1066477_180_416 | 78 |
| 728 | 3300053086 | Ga0500578_0093282 | Ga0500578_0093282_1573_1809 | 78 |
| 729 | 3300053130 | Ga0500642_0049190 | Ga0500642_0049190_1608_1844 | 78 |
| 730 | 3300053151 | Ga0500604_0228985 | Ga0500604_0228985_156_392 | 78 |
| 731 | 3300053155 | Ga0500620_106883 | Ga0500620_106883_575_811 | 78 |
| 732 | 3300061719 | Ga0466962_0149282 | Ga0466962_0149282_348_584 | 78 |
| 733 | 3300061719 | Ga0466962_0183455 | Ga0466962_0183455_769_1005 | 78 |
| 734 | 3300061719 | Ga0466962_0368541 | Ga0466962_0368541_348_584 | 78 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5csa-assembly1.cif.gz_A | crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase | 0.9421 | 5 | 77 |
| 5csa-assembly1.cif.gz_B | crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase | 0.94 | 5 | 77 |
| 2kcc-assembly1.cif.gz_A | solution structure of biotinoyl domain from human acetyl-coa carboxylase 2 | 0.9363 | 4 | 78 |
| 2pnr-assembly2.cif.gz_G | crystal structure of the asymmetric pdk3-l2 complex | 0.9331 | 6 | 78 |
| 6g2d-assembly1.cif.gz_D | citrate-induced acetyl-coa carboxylase (acc-cit) filament at 5.4 a resolution | 0.9328 | 4 | 77 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIS7_123_196_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9717 | 7 | 77 | 2.40.50.100 |
| af_A0A1D6KPB2_40_143_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9612 | 2 | 76 | 2.40.50.100 |
| af_Q2FYM2_1_102_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9597 | 5 | 78 | 2.40.50.100 |
| af_A4I3X3_25_102_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9591 | 4 | 78 | 2.40.50.100 |
| af_A0A0R0K6S7_676_747_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9571 | 16 | 78 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A031K6L3-F1-model_v4 | Biotin/lipoyl attachment domain-containing protein | 0.9967 | 3 | 77 |
GO:0005737
GO:0016407 GO:0031405 |
| AF-A0A1A2P3P7-F1-model_v4 | Dihydrolipoamide acyltransferase | 0.9944 | 1 | 78 |
GO:0016746
|
| AF-A0A6J7B039-F1-model_v4 | Unannotated protein | 0.9927 | 4 | 78 |
GO:0006086
GO:0045254 |
| AF-A0A2U3PG49-F1-model_v4 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | 0.9924 | 1 | 78 |
GO:0016746
|
| AF-A0A7C7Q232-F1-model_v4 | Lipoyl-binding domain-containing protein | 0.9923 | 2 | 77 |
GO:0006086
GO:0045254 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar