F478138

General Info

Members Datasets Scaffolds Average Seq Length
734 541 1468 465

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10004443|Ga0105239_1000444317
Length 527
Sequence MISPKHSVKRTNKMQMVRVPPYQAKSYLSARTSQTSPETELMLKPIIERPDKTEAGRMKAAPSIRWALASLSLSMLMPSLDTSIANVGLPTLAEAFGASFQQVQWIVLAYLLAITALIVSVGRLGDIVGRRRLLLAGIALFTLASLFCGIAPTLWLLIAARALQGLGAAMMMALTVAMVGETVPKERTGSAMGLLGTMSAIGTTLGPSLGGVLIAGFGWETLFLVNVPLGIANFLLAARFLPVDRPNRKAGQGRPDAIGTLLLALTLAAYALAMTMGHGSFGVLNIGLLLAAAFGTALFAFTEAKVKSPLVRLTMFRDSALSVGLAMSTLVSTVMMATLVVGPFYLSRALGLDAAHVGAVMSAGPLVAALTGVPAGRIVDRFGAHRMTITGLVAMIIGLFLVAAMQGRFGVVGYIGPLALVTANYALFQAANNTTIMTNIRPDQRGVISGMLSLSRNLGLITGASVMGAVFTLASGTTGITTARPEAIATGMQVTFAIAALLIVAALVVALTGFAIAKRTALSEQAS

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
58 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
68 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
69 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
81 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
82 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
83 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
84 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
85 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
86 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
88 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
124 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
128 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
131 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
132 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
140 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
150 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
151 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
152 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
153 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
154 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
155 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
156 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
157 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
158 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
159 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
163 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
169 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
170 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
176 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
182 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
183 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
186 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
187 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
190 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
197 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
205 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
206 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
209 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
212 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
215 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
216 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
232 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
233 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
234 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
237 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
238 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
239 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
240 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
241 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
242 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
243 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
255 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
258 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
265 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
266 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
267 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
268 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
269 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
270 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
271 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
272 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
273 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
274 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
275 2509276019 Ensifer aridi TW10 Isolate Nodule
276 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
277 2511231007 Pseudomonas sp. GM18 Isolate Nodule
278 2511231016 Pseudomonas sp. GM50 Isolate Nodule
279 2511231018 Pseudomonas sp. GM60 Isolate Nodule
280 2511231022 Pseudomonas sp. GM79 Isolate Nodule
281 2511231023 Pseudomonas sp. GM80 Isolate Nodule
282 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
283 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
284 2512875024
285 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
286 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
287 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
288 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
289 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
290 2516143018 Ensifer sp. BR816 Isolate Nodule
291 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
292 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
293 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
294 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
295 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
296 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
297 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
298 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
299 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
300 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
301 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
302 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
303 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
304 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
305 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
306 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
307 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
308 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
309 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
310 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
311 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
312 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
313 2643221585 Pelomonas sp. Root662 Isolate Unclassified
314 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
315 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
316 2643221610 Ensifer sp. Root74 Isolate Unclassified
317 2643221613 Oerskovia sp. Root22 Isolate Unclassified
318 2643221618 Ensifer sp. Root231 Isolate Unclassified
319 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
320 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
321 2643221655 Ensifer sp. Root1252 Isolate Unclassified
322 2643221656 Pelomonas sp. Root405 Isolate Unclassified
323 2643221659 Ensifer sp. Root127 Isolate Unclassified
324 2643221675 Ensifer sp. Root1298 Isolate Unclassified
325 2643221680 Ensifer sp. Root1312 Isolate Unclassified
326 2643221698 Ensifer sp. Root142 Isolate Unclassified
327 2643221712 Ensifer sp. Root258 Isolate Unclassified
328 2643221721 Oerskovia sp. Root918 Isolate Unclassified
329 2643221726 Ensifer sp. Root954 Isolate Unclassified
330 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
331 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
332 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
333 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
334 2721755523 Delftia sp. HK171 Isolate Unclassified
335 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
336 2738543030 Massilia sp. GV097 Isolate Unclassified
337 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
338 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
339 2773857925 Microvirga vignae BR3299 Isolate Unclassified
340 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
341 2784132072 Pseudomonas sp. 460 Isolate Unclassified
342 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
343 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
344 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
345 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
346 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
347 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
348 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
349 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
350 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
351 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
352 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
353 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
354 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
355 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
356 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
357 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
358 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
359 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
360 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
361 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
362 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
363 2844163670 Ensifer sp. 1H6 Isolate Unclassified
364 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
365 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
366 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
367 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
368 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
369 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
370 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
371 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
372 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
373 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
374 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
375 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
376 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
377 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
378 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
379 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
380 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
381 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
382 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
383 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
384 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
385 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
386 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
387 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
388 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
389 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
390 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
391 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
392 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
393 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
394 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
395 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
396 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
397 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
398 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
399 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
400 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
401 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
402 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
403 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
404 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
405 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
406 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
407 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
408 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
409 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
410 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
411 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
412 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
413 2904424332 Duganella sp. 1411 Isolate Rhizosphere
414 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
415 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
416 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
417 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
418 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
419 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
420 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
421 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
422 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
423 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
424 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
425 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
426 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
427 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
428 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
429 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
430 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
431 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
432 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
433 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
434 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
435 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
436 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
437 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
438 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
439 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
440 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
441 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
442 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
443 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
444 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
445 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
446 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
447 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
448 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
449 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
450 2941479691
451 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
452 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
453 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
454 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
455 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
456 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
457 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
458 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
459 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
460 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
461 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
462 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
463 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
464 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
465 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
466 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
467 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
468 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
469 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
470 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
471 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
472 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
473 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
474 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
475 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
476 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
477 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
478 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
479 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
480 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
481 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
482 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
483 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
484 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
485 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
486 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
487 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
488 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
489 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
490 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
491 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
492 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
493 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
494 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
495 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
496 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
497 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
498 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
499 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
500 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
501 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
502 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
503 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
504 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
505 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
506 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
507 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
508 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
509 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
510 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
511 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
512 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
513 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
514 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
515 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
516 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
517 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
518 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
519 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
520 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
521 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
522 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
523 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
524 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
525 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
526 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
527 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
528 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
529 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
530 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
531 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
532 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
533 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
534 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
535 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
536 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
537 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
538 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
539 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
540 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
541 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 63.35
Metatranscriptomes 0
Isolates 36.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.54
Nodule 25.61
Rhizoplane 4.63
Rhizosphere 48.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10004443 3300010375 Bacteria 16762
2 MRS2a_Contig_222 2124908027 Bacteria 16053
3 JGI24740J21852_10000004 3300001979 Bacteria 91019
4 JGI24737J22298_10004055 3300001990 Bacteria 5122
5 JGI25155J39150_1000004 3300002704 Bacteria 269098
6 JGI25156J39149_1000014 3300002705 Bacteria 189257
7 JGI25162J39368_1000670 3300002737 Bacteria 24190
8 JGI25162J39368_1001910 3300002737 Bacteria 9544
9 JGI25154J39366_1000096 3300002738 Bacteria 79168
10 JGI25157J39369_1000005 3300002741 Bacteria 269089
11 JGI25151J46595_10015201 3300003187 Bacteria 3404
12 JGI25165J46597_1001403 3300003214 Bacteria 13115
13 JGI25165J46597_1001922 3300003214 Bacteria 8293
14 JGI25153J46596_10001939 3300003215 Bacteria 12282
15 JGI25153J46596_10006633 3300003215 Bacteria 5825
16 rootH1_10083839 3300003316 Bacteria 2851
17 rootH2_10033048 3300003320 Bacteria 10091
18 rootL2_10123289 3300003322 Bacteria 2261
19 rootH1_10063462 3300003323 Bacteria 6542
20 Ga0055542_1000839 3300003762 Bacteria 21795
21 Ga0065165_1007717 3300005262 Bacteria 5209
22 Ga0065714_10000305 3300005288 Bacteria 11964
23 Ga0065714_10006583 3300005288 Bacteria 7426
24 Ga0065714_10076125 3300005288 Bacteria 2826
25 Ga0065714_10088436 3300005288 Bacteria 2017
26 Ga0065715_10002056 3300005293 Bacteria 5661
27 Ga0070658_10011003 3300005327 Bacteria 7252
28 Ga0070658_10041052 3300005327 Bacteria 3733
29 Ga0070658_10114001 3300005327 Bacteria 2241
30 Ga0070683_100042696 3300005329 Bacteria 4176
31 Ga0070670_100060006 3300005331 Bacteria 3265
32 Ga0070660_100046034 3300005339 Bacteria 3343
33 Ga0070687_100006936 3300005343 Bacteria 4682
34 Ga0070661_100015245 3300005344 Bacteria 5425
35 Ga0070661_100093086 3300005344 Bacteria 2233
36 Ga0070671_100035995 3300005355 Bacteria 4103
37 Ga0070714_100034145 3300005435 Bacteria 4258
38 Ga0070714_100060880 3300005435 Bacteria 3241
39 Ga0070663_100010866 3300005455 Bacteria 5687
40 Ga0070663_100045377 3300005455 Bacteria 3104
41 Ga0070681_10090096 3300005458 Bacteria 3018
42 Ga0070679_100066453 3300005530 Bacteria 3594
43 Ga0070684_100017827 3300005535 Bacteria 5836
44 Ga0068853_100000769 3300005539 Bacteria 22243
45 Ga0068853_100025427 3300005539 Bacteria 4967
46 Ga0068853_100030296 3300005539 Bacteria 4569
47 Ga0068853_100037371 3300005539 Bacteria 4131
48 Ga0068853_100117831 3300005539 Bacteria 2366
49 Ga0070672_100000700 3300005543 Bacteria 19849
50 Ga0070665_100010800 3300005548 Bacteria 9235
51 Ga0070665_100104702 3300005548 Bacteria 2831
52 Ga0068855_100003263 3300005563 Bacteria 19852
53 Ga0068855_100010532 3300005563 Bacteria 11152
54 Ga0068855_100013519 3300005563 Bacteria 9842
55 Ga0068855_100018293 3300005563 Bacteria 8417
56 Ga0068855_100085765 3300005563 Bacteria 3643
57 Ga0068855_100119141 3300005563 Bacteria 3022
58 Ga0068855_100194899 3300005563 Bacteria 2283
59 Ga0070664_100045925 3300005564 Bacteria 3689
60 Ga0068857_100000436 3300005577 Bacteria 29551
61 Ga0068857_100053343 3300005577 Bacteria 3587
62 Ga0068857_100060748 3300005577 Bacteria 3357
63 Ga0068854_100000056 3300005578 Bacteria 82924
64 Ga0068854_100014066 3300005578 Bacteria 5269
65 Ga0068854_100097767 3300005578 Bacteria 2195
66 Ga0068856_100304891 3300005614 Bacteria 1610
67 Ga0068852_100139096 3300005616 Bacteria 2245
68 Ga0068859_100208336 3300005617 Bacteria 2041
69 Ga0068859_100284352 3300005617 Bacteria 1747
70 Ga0068864_100065800 3300005618 Bacteria 3144
71 Ga0068861_100180889 3300005719 Bacteria 1755
72 Ga0068851_10001004 3300005834 Bacteria 12245
73 Ga0068851_10004431 3300005834 Bacteria 6331
74 Ga0068863_100010114 3300005841 Bacteria 9174
75 Ga0068863_100226920 3300005841 Bacteria 1801
76 Ga0081539_10005268 3300005985 Bacteria 13337
77 Ga0075365_10008710 3300006038 Bacteria 5781
78 Ga0075365_10016144 3300006038 Bacteria 4534
79 Ga0075363_100005206 3300006048 Bacteria 5761
80 Ga0075362_10000003 3300006177 Bacteria 171099
81 Ga0075367_10002906 3300006178 Bacteria 7980
82 Ga0075369_10001406 3300006186 Bacteria 8191
83 Ga0075369_10004715 3300006186 Bacteria 5059
84 Ga0097621_100033411 3300006237 Bacteria 4097
85 Ga0075370_10001512 3300006353 Bacteria 10167
86 Ga0068865_100022643 3300006881 Bacteria 4102
87 Ga0097620_100208335 3300006931 Bacteria 2041
88 Ga0097620_100284355 3300006931 Bacteria 1747
89 Ga0079104_1000007 3300006946 Bacteria 390531
90 Ga0079104_1003920 3300006946 Bacteria 6646
91 Ga0105244_10007446 3300009036 Bacteria 6959
92 Ga0105240_10000013 3300009093 Bacteria 483458
93 Ga0105240_10065614 3300009093 Bacteria 4506
94 Ga0111539_10000100 3300009094 Bacteria 91427
95 Ga0111539_10041691 3300009094 Bacteria 5517
96 Ga0114129_10037370 3300009147 Bacteria 6856
97 Ga0105243_10001488 3300009148 Bacteria 20504
98 Ga0105241_10010112 3300009174 Bacteria 6927
99 Ga0105237_10000023 3300009545 Bacteria 226144
100 Ga0105237_10005220 3300009545 Bacteria 14694
101 Ga0105237_10130343 3300009545 Bacteria 2509
102 Ga0105237_10177669 3300009545 Bacteria 2129
103 Ga0105238_10049578 3300009551 Bacteria 4227
104 Ga0105238_10176236 3300009551 Bacteria 2115
105 Ga0105249_10055894 3300009553 Bacteria 3613
106 Ga0123342_1000455 3300009766 Bacteria 64500
107 Ga0099796_10006581 3300010159 Bacteria 2985
108 Ga0105239_10003240 3300010375 Bacteria 20106
109 Ga0105239_10045237 3300010375 Bacteria 4824
110 Ga0105239_10205152 3300010375 Bacteria 2209
111 Ga0157314_1000522 3300012500 Bacteria 3627
112 Ga0157373_10016254 3300013100 Bacteria 5431
113 Ga0157373_10021379 3300013100 Bacteria 4700
114 Ga0157371_10001861 3300013102 Bacteria 21161
115 Ga0157371_10078920 3300013102 Bacteria 2332
116 Ga0157370_10003433 3300013104 Bacteria 18605
117 Ga0157370_10006851 3300013104 Bacteria 12477
118 Ga0157370_10111199 3300013104 Bacteria 2561
119 Ga0163162_10307152 3300013306 Bacteria 1718
120 Ga0157375_10000034 3300013308 Bacteria 184385
121 Ga0163163_10069987 3300014325 Bacteria 3494
122 Ga0182008_10015402 3300014497 Bacteria 3989
123 Ga0182006_1001162 3300015261 Bacteria 16594
124 Ga0182007_10000898 3300015262 Bacteria 16505
125 Ga0182007_10002371 3300015262 Bacteria 9423
126 Ga0163161_10025204 3300017792 Bacteria 4208
127 Ga0214542_1010266 3300021321 Bacteria 13792
128 Ga0214543_1000156 3300021327 Bacteria 96889
129 Ga0213876_10003348 3300021384 Bacteria 9178
130 Ga0228711_1000006 3300022739 Bacteria 202437
131 Ga0228710_1000004 3300022740 Bacteria 250560
132 Ga0209435_100009 3300025206 Bacteria 476614
133 Ga0209760_100936 3300025207 Bacteria 3586
134 Ga0209437_100057 3300025233 Bacteria 362922
135 Ga0209437_100107 3300025233 Bacteria 218656
136 Ga0209646_1000018 3300025246 Bacteria 476716
137 Ga0209646_1004842 3300025246 Bacteria 2414
138 Ga0209026_1000043 3300025250 Bacteria 269142
139 Ga0209677_100382 3300025253 Bacteria 27101
140 Ga0209148_1000050 3300025254 Bacteria 413178
141 Ga0209148_1006050 3300025254 Bacteria 2669
142 Ga0209759_1000007 3300025256 Bacteria 476614
143 Ga0209759_1008451 3300025256 Bacteria 3202
144 Ga0209129_1010251 3300025258 Bacteria 2362
145 Ga0209233_1000130 3300025261 Bacteria 205687
146 Ga0209233_1000178 3300025261 Bacteria 140956
147 Ga0209233_1000358 3300025261 Bacteria 41919
148 Ga0209455_1000183 3300025272 Bacteria 99952
149 Ga0209676_1000065 3300025292 Bacteria 318605
150 Ga0209025_1000216 3300025294 Bacteria 138307
151 Ga0209025_1011346 3300025294 Bacteria 5886
152 Ga0209758_1000188 3300025297 Bacteria 138749
153 Ga0209758_1000537 3300025297 Bacteria 60204
154 Ga0209050_1014585 3300025298 Bacteria 3370
155 Ga0207655_1001260 3300025728 Bacteria 24152
156 Ga0207705_10005324 3300025909 Bacteria 9625
157 Ga0207705_10011361 3300025909 Bacteria 6448
158 Ga0207707_10025476 3300025912 Bacteria 5173
159 Ga0207695_10000044 3300025913 Bacteria 440819
160 Ga0207695_10012305 3300025913 Bacteria 10280
161 Ga0207695_10013689 3300025913 Bacteria 9655
162 Ga0207695_10033043 3300025913 Bacteria 5652
163 Ga0207695_10119767 3300025913 Bacteria 2602
164 Ga0207671_10000020 3300025914 Bacteria 309636
165 Ga0207671_10000033 3300025914 Bacteria 245869
166 Ga0207671_10000400 3300025914 Bacteria 60604
167 Ga0207660_10011068 3300025917 Bacteria 5867
168 Ga0207662_10013471 3300025918 Bacteria 4573
169 Ga0207657_10007495 3300025919 Bacteria 11184
170 Ga0207657_10019888 3300025919 Bacteria 6361
171 Ga0207649_10069631 3300025920 Bacteria 2241
172 Ga0207652_10020020 3300025921 Bacteria 5509
173 Ga0207694_10180774 3300025924 Bacteria 1710
174 Ga0207650_10037522 3300025925 Bacteria 3532
175 Ga0207664_10079101 3300025929 Bacteria 2668
176 Ga0207709_10000172 3300025935 Bacteria 86654
177 Ga0207691_10002020 3300025940 Bacteria 19862
178 Ga0207679_10040382 3300025945 Bacteria 3340
179 Ga0207667_10000094 3300025949 Bacteria 145771
180 Ga0207667_10000238 3300025949 Bacteria 76840
181 Ga0207667_10003694 3300025949 Bacteria 18862
182 Ga0207667_10020552 3300025949 Bacteria 7338
183 Ga0207640_10000043 3300025981 Bacteria 102669
184 Ga0207640_10000277 3300025981 Bacteria 34453
185 Ga0207639_10001206 3300026041 Bacteria 17558
186 Ga0207639_10050301 3300026041 Bacteria 3165
187 Ga0207678_10008151 3300026067 Bacteria 9239
188 Ga0207678_10031845 3300026067 Bacteria 4598
189 Ga0207702_10086814 3300026078 Bacteria 2729
190 Ga0207641_10062147 3300026088 Bacteria 3186
191 Ga0207641_10117943 3300026088 Bacteria 2364
192 Ga0207674_10000074 3300026116 Bacteria 105369
193 Ga0207674_10002846 3300026116 Bacteria 21521
194 Ga0207674_10021913 3300026116 Bacteria 6873
195 Ga0207674_10064094 3300026116 Bacteria 3707
196 Ga0209281_1000020 3300027111 Bacteria 575972
197 Ga0209281_1000102 3300027111 Bacteria 221665
198 Ga0209282_1000013 3300027666 Bacteria 215053
199 Ga0207428_10000096 3300027907 Bacteria 123081
200 Ga0207428_10092959 3300027907 Bacteria 2340
201 Ga0268266_10019839 3300028379 Bacteria 5730
202 Ga0268266_10044597 3300028379 Bacteria 3791
203 Ga0307515_10000011 3300028794 Bacteria 633903
204 Ga0307515_10001041 3300028794 Bacteria 63402
205 Ga0307515_10001245 3300028794 Bacteria 58063
206 Ga0307515_10014858 3300028794 Bacteria 14393
207 Ga0307515_10099050 3300028794 Bacteria 3543
208 Ga0268256_1011759 3300030500 Bacteria 2747
209 Ga0307513_10000004 3300031456 Bacteria 558931
210 Ga0307513_10000011 3300031456 Bacteria 354929
211 Ga0307513_10021757 3300031456 Bacteria 7564
212 Ga0307508_10001284 3300031616 Bacteria 28530
213 Ga0307514_10000722 3300031649 Bacteria 57107
214 Ga0307514_10002190 3300031649 Bacteria 20986
215 Ga0307516_10000046 3300031730 Bacteria 130851
216 Ga0307413_10057325 3300031824 Bacteria 2381
217 Ga0307407_10000948 3300031903 Bacteria 9860
218 Ga0315914_1000004 3300031967 Bacteria 288534
219 Ga0307414_10001606 3300032004 Bacteria 11747
220 Ga0307415_100007608 3300032126 Bacteria 5938
221 Ga0307507_10116268 3300033179 Bacteria 2161
222 Ga0315913_1000011 3300033430 Bacteria 140532
223 Ga0315915_1000003 3300033464 Bacteria 407996
224 Ga0316574_0016352 3300035398 Bacteria 4322
225 Ga0373935_0061307 3300035692 Bacteria 2408
226 Ga0373927_0000048 3300035695 Bacteria 86106
227 Ga0373925_0001567 3300037068 Bacteria 19370
228 Ga0395900_0012611 3300037418 Bacteria 8643
229 Ga0395905_0001527 3300037471 Bacteria 27687
230 Ga0395905_0002046 3300037471 Bacteria 23048
231 Ga0395905_0007463 3300037471 Bacteria 10872
232 Ga0395905_0189005 3300037471 Bacteria 1932
233 Ga0395901_0001188 3300038443 Bacteria 27720
234 Ga0436365_0120529 3300039437 Bacteria 8359
235 Ga0439438_003703 3300041405 Bacteria 6082
236 Ga0439447_000014 3300041407 Bacteria 72178
237 Ga0439466_0002142 3300041411 Bacteria 7738
238 Ga0439451_000635 3300042009 Bacteria 6668
239 Ga0439451_001281 3300042009 Bacteria 4958
240 Ga0439451_007886 3300042009 Bacteria 2161
241 Ga0439452_004214 3300042010 Bacteria 4872
242 Ga0439452_006400 3300042010 Bacteria 3689
243 Ga0439463_004121 3300042016 Bacteria 3651
244 Ga0450919_003654 3300042121 Bacteria 1909
245 Ga0450905_000726 3300042142 Bacteria 4029
246 Ga0450907_000146 3300042146 Bacteria 26937
247 Ga0450909_000154 3300042185 Bacteria 7356
248 Ga0450909_006941 3300042185 Bacteria 1633
249 Ga0439434_0000153 3300042435 Bacteria 18390
250 Ga0439464_0000460 3300042439 Bacteria 8157
251 Ga0439460_0002759 3300042461 Bacteria 4226
252 Ga0450918_000060 3300042531 Bacteria 21957
253 Ga0439440_0011138 3300042993 Bacteria 1892
254 Ga0466961_0006453 3300044693 Bacteria 7447
255 Ga0466959_0066038 3300045049 Bacteria 2624
256 Ga0451576_0147559 3300045051 Bacteria 2453
257 Ga0495617_002636 3300046452 Bacteria 7008
258 Ga0495603_0000930 3300046455 Bacteria 16822
259 Ga0495590_0015385 3300046457 Bacteria 2777
260 Ga0495638_0035873 3300046460 Bacteria 3159
261 Ga0495638_0053280 3300046460 Bacteria 2518
262 Ga0495651_0106528 3300046462 Bacteria 2078
263 Ga0495650_0001441 3300046471 Bacteria 22950
264 Ga0495650_0012043 3300046471 Bacteria 4680
265 Ga0495650_0018092 3300046471 Bacteria 3513
266 Ga0495605_0000114 3300046474 Bacteria 103834
267 Ga0495605_0003571 3300046474 Bacteria 9216
268 Ga0495605_0026142 3300046474 Bacteria 3036
269 Ga0495639_0000001 3300046475 Bacteria 204442
270 Ga0495584_0000086 3300046491 Bacteria 64500
271 Ga0495584_0001610 3300046491 Bacteria 13285
272 Ga0495584_0004386 3300046491 Bacteria 7599
273 Ga0495585_0000756 3300046492 Bacteria 28639
274 Ga0495585_0000811 3300046492 Bacteria 27233
275 Ga0495585_0001747 3300046492 Bacteria 16555
276 Ga0495585_0001985 3300046492 Bacteria 15206
277 Ga0495594_0004250 3300046499 Bacteria 7356
278 Ga0495607_0002550 3300046501 Bacteria 14728
279 Ga0495607_0007673 3300046501 Bacteria 7434
280 Ga0495607_0053905 3300046501 Bacteria 2320
281 Ga0495607_0087746 3300046501 Bacteria 1692
282 Ga0495583_0000959 3300046506 Bacteria 33478
283 Ga0495583_0007862 3300046506 Bacteria 6620
284 Ga0495583_0011682 3300046506 Bacteria 5029
285 Ga0495583_0038363 3300046506 Bacteria 2263
286 Ga0495606_0004670 3300046507 Bacteria 13535
287 Ga0495606_0013066 3300046507 Bacteria 6596
288 Ga0495606_0075194 3300046507 Bacteria 2114
289 Ga0495610_0000813 3300046512 Bacteria 29272
290 Ga0495610_0008005 3300046512 Bacteria 6926
291 Ga0495616_0000480 3300046513 Bacteria 30368
292 Ga0495616_0009080 3300046513 Bacteria 5832
293 Ga0495616_0025257 3300046513 Bacteria 3176
294 Ga0495631_0008437 3300046518 Bacteria 5192
295 Ga0495632_0000455 3300046519 Bacteria 38969
296 Ga0495632_0001698 3300046519 Bacteria 17954
297 Ga0495632_0007967 3300046519 Bacteria 6579
298 Ga0495637_0001301 3300046520 Bacteria 14990
299 Ga0495637_0010096 3300046520 Bacteria 4580
300 Ga0495643_0005726 3300046522 Bacteria 8315
301 Ga0495643_0012472 3300046522 Bacteria 5127
302 Ga0495643_0028814 3300046522 Bacteria 3110
303 Ga0495643_0046678 3300046522 Bacteria 2347
304 Ga0495648_0009876 3300046524 Bacteria 7333
305 Ga0495648_0022911 3300046524 Bacteria 4287
306 Ga0495663_0001725 3300046525 Bacteria 6785
307 Ga0495642_0000162 3300046528 Bacteria 38956
308 Ga0495654_0001192 3300046530 Bacteria 18488
309 Ga0495654_0016938 3300046530 Bacteria 3838
310 Ga0495609_0003974 3300046538 Bacteria 8270
311 Ga0495609_0033289 3300046538 Bacteria 2339
312 Ga0495597_0002955 3300046542 Bacteria 10301
313 Ga0495597_0017925 3300046542 Bacteria 3325
314 Ga0495597_0018415 3300046542 Bacteria 3277
315 Ga0495622_0000181 3300046557 Bacteria 51031
316 Ga0495622_0000202 3300046557 Bacteria 47328
317 Ga0495622_0058521 3300046557 Bacteria 1785
318 Ga0495633_0000031 3300046558 Bacteria 196727
319 Ga0495656_0000403 3300046615 Bacteria 14328
320 Ga0495656_0001604 3300046615 Bacteria 7402
321 Ga0495611_0001155 3300046648 Bacteria 13789
322 Ga0495625_0001903 3300046660 Bacteria 23588
323 Ga0495625_0016365 3300046660 Bacteria 5839
324 Ga0495659_0000507 3300046664 Bacteria 14341
325 Ga0495659_0035210 3300046664 Bacteria 1763
326 Ga0495661_0008104 3300046665 Bacteria 7288
327 Ga0495588_0002907 3300046674 Bacteria 7388
328 Ga0495669_0003306 3300046684 Bacteria 6633
329 Ga0495669_0028623 3300046684 Bacteria 2440
330 Ga0495670_0022507 3300046691 Bacteria 3111
331 Ga0495670_0033998 3300046691 Bacteria 2537
332 Ga0495670_0037742 3300046691 Bacteria 2408
333 Ga0495671_0000138 3300046692 Bacteria 64535
334 Ga0495671_0010358 3300046692 Bacteria 5168
335 Ga0495671_0013321 3300046692 Bacteria 4457
336 Ga0495649_0000013 3300046694 Bacteria 316013
337 Ga0495649_0000890 3300046694 Bacteria 23784
338 Ga0495649_0003006 3300046694 Bacteria 11575
339 Ga0495649_0014706 3300046694 Bacteria 4474
340 Ga0495649_0014886 3300046694 Bacteria 4445
341 Ga0495589_0000141 3300046794 Bacteria 66457
342 Ga0495589_0004061 3300046794 Bacteria 7843
343 Ga0495589_0015712 3300046794 Bacteria 3891
344 Ga0495660_0011537 3300046810 Bacteria 5126
345 Ga0495660_0020219 3300046810 Bacteria 3816
346 Ga0495660_0046209 3300046810 Bacteria 2388
347 Ga0495660_0061135 3300046810 Bacteria 2022
348 Ga0495636_0004061 3300047318 Bacteria 5724
349 Ga0495636_0073822 3300047318 Bacteria 1460
350 Ga0495672_0000419 3300047320 Bacteria 51114
351 Ga0495672_0006208 3300047320 Bacteria 9319
352 Ga0495672_0052794 3300047320 Bacteria 2385
353 Ga0495683_0043601 3300047323 Bacteria 2258
354 Ga0495683_0049957 3300047323 Bacteria 2093
355 Ga0495677_0000322 3300047445 Bacteria 20705
356 Ga0495679_000793 3300047446 Bacteria 20055
357 Ga0495679_015906 3300047446 Bacteria 2735
358 Ga0495673_0003032 3300047469 Bacteria 11314
359 Ga0495673_0003114 3300047469 Bacteria 11110
360 Ga0495673_0006252 3300047469 Bacteria 7036
361 Ga0495673_0013855 3300047469 Bacteria 4213
362 Ga0495673_0053931 3300047469 Bacteria 1750
363 Ga0495684_0021634 3300047471 Bacteria 4952
364 Ga0495593_0014775 3300047673 Bacteria 4436
365 Ga0495615_0001492 3300048090 Bacteria 3504
366 Ga0495626_0000329 3300048091 Bacteria 50091
367 Ga0495626_0000849 3300048091 Bacteria 27275
368 Ga0495626_0001572 3300048091 Bacteria 17894
369 Ga0495626_0009783 3300048091 Bacteria 5161
370 Ga0496100_0006646 3300048903 Bacteria 6322
371 Ga0496102_0014331 3300048905 Bacteria 6887
372 Ga0496102_0041392 3300048905 Bacteria 4171
373 Ga0496102_0245150 3300048905 Bacteria 1689
374 Ga0496103_0012713 3300048906 Bacteria 4993
375 Ga0496104_0002324 3300048907 Bacteria 16426
376 Ga0496104_0005274 3300048907 Bacteria 11296
377 Ga0496105_0038760 3300048908 Bacteria 3926
378 Ga0496106_0003149 3300048909 Bacteria 12312
379 Ga0496106_0040336 3300048909 Bacteria 3496
380 Ga0496108_0001103 3300048911 Bacteria 21100
381 Ga0496108_0003172 3300048911 Bacteria 13232
382 Ga0496109_0003718 3300048912 Bacteria 12748
383 Ga0496109_0051857 3300048912 Bacteria 3737
384 Ga0496110_0001272 3300048913 Bacteria 18044
385 Ga0496110_0095428 3300048913 Bacteria 2663
386 Ga0496111_0001613 3300048914 Bacteria 13053
387 Ga0496112_0004257 3300048915 Bacteria 12078
388 Ga0496112_0052446 3300048915 Bacteria 4003
389 Ga0496113_0000394 3300048916 Bacteria 21064
390 Ga0496113_0003078 3300048916 Bacteria 9903
391 Ga0496113_0059542 3300048916 Bacteria 2877
392 Ga0496114_0167313 3300048917 Bacteria 1915
393 Ga0496115_0016207 3300048918 Bacteria 5671
394 Ga0496115_0075286 3300048918 Bacteria 2742
395 Ga0496115_0240525 3300048918 Bacteria 1492
396 Ga0496116_0026740 3300048919 Bacteria 4209
397 Ga0496117_0011833 3300048920 Bacteria 7766
398 Ga0496118_0013506 3300048921 Bacteria 7716
399 Ga0496119_0026392 3300048922 Bacteria 4029
400 Ga0496120_0011566 3300048923 Bacteria 6060
401 Ga0496121_0000396 3300048924 Bacteria 87716
402 Ga0496121_0004070 3300048924 Bacteria 20079
403 Ga0496121_0006347 3300048924 Bacteria 14733
404 Ga0496121_0049280 3300048924 Bacteria 3572
405 Ga0496121_0050746 3300048924 Bacteria 3501
406 Ga0496122_0003392 3300048925 Bacteria 20972
407 Ga0496122_0016932 3300048925 Bacteria 6849
408 Ga0496122_0045378 3300048925 Bacteria 3416
409 Ga0496123_0014523 3300048926 Bacteria 6520
410 Ga0496123_0030307 3300048926 Bacteria 3962
411 Ga0496123_0032039 3300048926 Bacteria 3814
412 Ga0496124_0018862 3300048927 Bacteria 6442
413 Ga0496124_0133766 3300048927 Bacteria 1966
414 Ga0496125_0002729 3300048928 Bacteria 22402
415 Ga0496125_0019592 3300048928 Bacteria 6375
416 Ga0496125_0036060 3300048928 Bacteria 4325
417 Ga0496125_0041900 3300048928 Bacteria 3908
418 Ga0495678_000358 3300049459 Bacteria 46919
419 Ga0495678_000495 3300049459 Bacteria 38920
420 Ga0495678_011653 3300049459 Bacteria 4200
421 Ga0495682_0003805 3300049460 Bacteria 6632
422 Ga0495682_0010167 3300049460 Bacteria 3654
423 Ga0501033_0002268 3300049570 Bacteria 16450
424 Ga0501034_0010327 3300049571 Bacteria 9732
425 Ga0501034_0035051 3300049571 Bacteria 5089
426 Ga0501037_0031652 3300049573 Bacteria 3906
427 Ga0501043_0065552 3300049579 Bacteria 2852
428 Ga0501046_0000761 3300049580 Bacteria 31142
429 Ga0501046_0003012 3300049580 Bacteria 15574
430 Ga0501047_0006739 3300049581 Bacteria 10797
431 Ga0501047_0028558 3300049581 Bacteria 5380
432 Ga0501047_0043333 3300049581 Bacteria 4347
433 Ga0501047_0071315 3300049581 Bacteria 3344
434 Ga0501067_0044324 3300049583 Bacteria 2471
435 Ga0501070_0054546 3300049586 Bacteria 3315
436 Ga0501073_0099650 3300049589 Bacteria 2017
437 Ga0501074_0109341 3300049590 Bacteria 1978
438 Ga0501080_0088672 3300049742 Bacteria 2874
439 Ga0501080_0136870 3300049742 Bacteria 2266
440 Ga0501083_0037613 3300049744 Bacteria 3295
441 Ga0501083_0041093 3300049744 Bacteria 3137
442 Ga0501035_0106758 3300049822 Bacteria 2455
443 Ga0501044_0000764 3300049823 Bacteria 38944
444 Ga0501044_0002447 3300049823 Bacteria 21166
445 nmdc:mga03683_22_c1 3300050489 Bacteria 82016
446 nmdc:mga03n38_2422_c1 3300050490 Bacteria 5760
447 nmdc:mga0yw44_1058_c1 3300050492 Bacteria 5879
448 nmdc:mga0yw44_14127_c1 3300050492 Bacteria 4228
449 nmdc:mga07m45_3_c1 3300050496 Bacteria 421414
450 nmdc:mga08y16_248024_c1 3300050511 Bacteria 1840
451 nmdc:mga08y16_62_c1 3300050511 Bacteria 89583
452 nmdc:mga0rr50_115952_c1 3300050513 Bacteria 2126
453 nmdc:mga0sz30_2314_c2 3300050516 Bacteria 6485
454 nmdc:mga0sz30_39_c1 3300050516 Bacteria 12429
455 Ga0500610_0005577 3300053079 Bacteria 5176
456 Ga0500578_0000309 3300053086 Bacteria 59973
457 Ga0500593_021410 3300053117 Bacteria 2846
458 Ga0500594_0000141 3300053118 Bacteria 19985
459 Ga0500618_005740 3300053125 Bacteria 3740
460 Ga0500616_0002438 3300053153 Bacteria 15481
461 Ga0500627_0014604 3300053158 Bacteria 3013
462 Ga0501084_0095059 3300054114 Bacteria 2502
463 Ga0501082_0000027 3300060353 Bacteria 100915
464 Ga0501082_0000143 3300060353 Bacteria 59481
465 Ga0501082_0142097 3300060353 Bacteria 2083
466 2509111487 2508501122 Bacteria 6292184
467 2509371150 2509276018 Bacteria 6910194
468 2509379630 2509276019 Bacteria 6802256
469 2510313733 2510065059 Bacteria 6847884
470 2511270328 2511231007 Bacteria 6306603
471 2511328683 2511231016 Bacteria 6704427
472 2511337475 2511231018 Bacteria 6436256
473 2511362463 2511231022 Bacteria 6719296
474 2511368931 2511231023 Bacteria 6808468
475 2512325100 2512047018 Bacteria 6663241
476 2512931137 2512875016 Bacteria 6529530
477 2512958948 2512875024 Bacteria 7195110
478 2512973225 2512875026 Bacteria 6861065
479 2513603583 2513237089 Bacteria 6553624
480 2513983288 2513237156 Bacteria 6402557
481 2514005823 2513237160 Bacteria 6650282
482 2514420219 2513237305 Bacteria 7293571
483 2516206607 2516143018 Bacteria 6951533
484 2517571774 2517487022 Bacteria 7227575
485 2523107480 2522572158 Bacteria 6514390
486 2524452499 2524023207 Bacteria 6813453
487 2551700281 2551306087 Bacteria 7351905
488 2551738844 2551306092 Bacteria 6992595
489 2558866617 2558860100 Bacteria 8458965
490 2583791355 2582580891 Bacteria 6800976
491 2585146442 2582581279 Bacteria 4980720
492 2585280736 2582581308 Bacteria 7413247
493 2585326525 2582581315 Bacteria 7318924
494 2585334129 2582581316 Bacteria 7774528
495 2585531669 2585427527 Bacteria 7273426
496 2585551384 2585427530 Bacteria 7383882
497 2597859123 2597489887 Bacteria 6666321
498 2599487455 2599185185 Bacteria 6652270
499 2599806230 2599185257 Bacteria 6492581
500 2599906057 2599185292 Bacteria 6290804
501 2600195904 2599185352 Bacteria 7228948
502 2601667911 2600255292 Bacteria 6300551
503 2616306719 2615840626 Bacteria 7921970
504 2616557566 2615840698 Bacteria 7319877
505 2617386383 2617270742 Bacteria 6808054
506 2643935837 2643221585 Bacteria 5812563
507 2643986936 2643221595 Bacteria 6565519
508 2644039912 2643221605 Bacteria 4772303
509 2644063679 2643221610 Bacteria 7480339
510 2644083260 2643221613 Bacteria 4622396
511 2644104161 2643221618 Bacteria 7717186
512 2644158434 2643221627 Bacteria 6761570
513 2644247713 2643221644 Bacteria 6865017
514 2644307035 2643221655 Bacteria 7722067
515 2644317620 2643221656 Bacteria 5809961
516 2644331520 2643221659 Bacteria 7890716
517 2644414442 2643221675 Bacteria 7473456
518 2644447970 2643221680 Bacteria 7473610
519 2644540313 2643221698 Bacteria 7756764
520 2644619272 2643221712 Bacteria 7729434
521 2644666456 2643221721 Bacteria 4486924
522 2644690443 2643221726 Bacteria 7455827
523 2671113462 2667528174 Bacteria 6435400
524 2671772707 2671180172 Bacteria 6495783
525 2688598791 2687453392 Bacteria 6880454
526 2692318130 2690316117 Bacteria 6800650
527 2722883147 2721755523 Bacteria 6430384
528 2723575735 2721755686 Bacteria 7343952
529 2739341891 2738543030 Bacteria 6719714
530 2753072851 2751185734 Bacteria 8863695
531 2753461152 2751185821 Bacteria 6189929
532 2774870016 2773857925 Bacteria 6472445
533 2778178640 2775507266 Bacteria 7392367
534 2784312318 2784132072 Bacteria 6596533
535 2792643351 2791355094 Bacteria 7011481
536 2792749608 2791355123 Bacteria 8049106
537 2802720866 2802428858 Bacteria 6636079
538 2802724470 2802428859 Bacteria 6667919
539 2802737209 2802428861 Bacteria 6534206
540 2802746337 2802428862 Bacteria 6633353
541 2802751826 2802428863 Bacteria 6410669
542 2808930213 2808606377 Bacteria 6646337
543 2808952222 2808606381 Bacteria 6646461
544 2811842972 2808606982 Bacteria 7791042
545 2819241022 2818991272 Bacteria 4622173
546 2819611255 2818991448 Bacteria 6772224
547 2819638814 2818991453 Bacteria 7181617
548 2823424397 2823421272 Bacteria 5372474
549 2838030949 2838029111 Bacteria 6603031
550 2839143666 2839138175 Bacteria 6549354
551 2840764887 2840764183 Bacteria 6358399
552 2842477681 2842475841 Bacteria 6603183
553 2842484987 2842482326 Bacteria 7212537
554 2842504447 2842502639 Bacteria 6604161
555 2844014129 2844009547 Bacteria 6728125
556 2844169416 2844163670 Bacteria 7266046
557 2846040830 2846037992 Bacteria 4526407
558 2847423365 2847417321 Bacteria 6913799
559 2847687639 2847686936 Bacteria 6278406
560 2848997155 2848992105 Bacteria 6810864
561 2850079414 2850079185 Bacteria 6848280
562 2855875170 2855872281 Bacteria 6964271
563 2856331448 2856328259 Bacteria 6528202
564 2856335216 2856334872 Bacteria 7037011
565 2856358374 2856356410 Bacteria 6297484
566 2857369334 2857367948 Bacteria 6965560
567 2857550056 2857547612 Bacteria 6179999
568 2860342459 2860339153 Bacteria 6846989
569 2869172915 2869169390 Bacteria 6659796
570 2869235396 2869234852 Bacteria 6654993
571 2869246847 2869242130 Bacteria 6609239
572 2869262131 2869256925 Bacteria 6981691
573 2869270460 2869264136 Bacteria 6880765
574 2869271549 2869271264 Bacteria 6908218
575 2871486486 2871481445 Bacteria 6700002
576 2871491333 2871488783 Bacteria 6929816
577 2874110209 2874109183 Bacteria 6517025
578 2874118764 2874116593 Bacteria 6674494
579 2874127524 2874123672 Bacteria 7238285
580 2874136854 2874131515 Bacteria 6820270
581 2874174443 2874168670 Bacteria 8062617
582 2876365606 2876363079 Bacteria 6544991
583 2876387316 2876386047 Bacteria 6698674
584 2876405995 2876399893 Bacteria 6927900
585 2876410321 2876406927 Bacteria 6191900
586 2876421819 2876420981 Bacteria 6687741
587 2878757768 2878753008 Bacteria 6922523
588 2878778213 2878774303 Bacteria 6108671
589 2878787193 2878781027 Bacteria 6834456
590 2881155653 2881155292 Bacteria 6461656
591 2881851177 2881845957 Bacteria 6611900
592 2881864965 2881861095 Bacteria 7128710
593 2882461286 2882456835 Bacteria 6863978
594 2882635625 2882632389 Bacteria 8154593
595 2882915259 2882912400 Bacteria 6801539
596 2885321577 2885318864 Bacteria 6729568
597 2885346123 2885342637 Bacteria 7011821
598 2885357946 2885350715 Bacteria 6787678
599 2896385936 2896384573 Bacteria 7700774
600 2897809537 2897803580 Bacteria 7000062
601 2903455393 2903448605 Bacteria 7357801
602 2903506443 2903492973 Bacteria 13473544
603 2903519072 2903513507 Bacteria 6344008
604 2903523535 2903521522 Bacteria 6525694
605 2903534169 2903528002 Bacteria 6586099
606 2904427440 2904424332 Bacteria 7633521
607 2906332352 2906328253 Bacteria 6585166
608 2906367470 2906363423 Bacteria 6856682
609 2906373723 2906370794 Bacteria 6881062
610 2906382585 2906378014 Bacteria 6911440
611 2906388425 2906386501 Bacteria 5977019
612 2906398318 2906393657 Bacteria 6790866
613 2906405282 2906401398 Bacteria 6693206
614 2906412113 2906408224 Bacteria 6162342
615 2906432935 2906427513 Bacteria 6375796
616 2915982720 2915980308 Bacteria 6624279
617 2916063894 2916061851 Bacteria 6737736
618 2919411081 2919408235 Bacteria 6149349
619 2919701160 2919697872 Bacteria 6553725
620 2920824997 2920822456 Bacteria 6897201
621 2921256305 2921250672 Bacteria 6677771
622 2922151768 2922151315 Bacteria 6902399
623 2922162984 2922158528 Bacteria 6573167
624 2922174446 2922172374 Bacteria 6167644
625 2922180698 2922178524 Bacteria 6025201
626 2924727608 2924726620 Bacteria 6271473
627 2924746220 2924741084 Bacteria 6661321
628 2924750481 2924748358 Bacteria 6154725
629 2924785737 2924784321 Bacteria 7416538
630 2932418877 2932416698 Bacteria 6315112
631 2935890948 2935890801 Bacteria 4593001
632 2936998764 2936996657 Bacteria 6298727
633 2937030606 2937029754 Bacteria 6424026
634 2937039076 2937036028 Bacteria 6846469
635 2937083947 2937078374 Bacteria 6610289
636 2937090792 2937084907 Bacteria 6618516
637 2937824841 2937822353 Bacteria 7290551
638 2937855119 2937848649 Bacteria 6983481
639 2937864866 2937861824 Bacteria 6660327
640 2937872086 2937868953 Bacteria 6639878
641 2937894836 2937891427 Bacteria 6357007
642 2937983309 2937980651 Bacteria 6517427
643 2941479818
644 2957442450 2957437181 Bacteria 6568994
645 2958110516 2958108152 Bacteria 6681128
646 2958117382 2958115193 Bacteria 6923548
647 2958124743 2958122699 Bacteria 7280457
648 2958143535 2958137437 Bacteria 6050276
649 2958158978 2958158011 Bacteria 6058449
650 2960593144 2960591022 Bacteria 6622873
651 2960682680 2960680706 Bacteria 6624464
652 2960697551 2960693952 Bacteria 6749742
653 2961143391 2961136820 Bacteria 6775228
654 2961174311 2961170736 Bacteria 7072258
655 2961186397 2961183825 Bacteria 6688536
656 2963648081 2963644680 Bacteria 6530403
657 2965026507 2965025482 Bacteria 6532201
658 2965036813 2965032056 Bacteria 6887443
659 2965044552 2965040258 Bacteria 6855979
660 2965050020 2965047637 Bacteria 6623551
661 2965067217 2965062239 Bacteria 7412989
662 2965093984 2965089291 Bacteria 6866420
663 2965106369 2965102966 Bacteria 6800987
664 2965115023 2965110997 Bacteria 6693150
665 2967733837 2967728569 Bacteria 6641507
666 2968000258 2967996073 Bacteria 6787468
667 2968005470 2968003550 Bacteria 6929263
668 2968090903 2968083720 Bacteria 7351627
669 2968092901 2968091066 Bacteria 6052692
670 2968103185 2968097103 Bacteria 6107094
671 2968132496 2968128360 Bacteria 6270294
672 2970031984 2970026789 Bacteria 6785236
673 2970122801 2970122695 Bacteria 6625855
674 2970145326 2970143518 Bacteria 6446480
675 2970495695 2970489779 Bacteria 6517260
676 2970506898 2970503327 Bacteria 7099517
677 2970512814 2970510686 Bacteria 7006402
678 2970539868 2970532167 Bacteria 6553173
679 2970551317 2970547951 Bacteria 6931819
680 2970629398 2970627176 Bacteria 6680862
681 2977530877 2977530762 Bacteria 6951399
682 2977546905 2977544691 Bacteria 6875412
683 2977822300 2977821940 Bacteria 6906439
684 2977832020 2977828996 Bacteria 7007971
685 2977853666 2977851361 Bacteria 6694324
686 2977862061 2977858184 Bacteria 6215359
687 2977873582 2977872689 Bacteria 7270173
688 2977907610 2977907340 Bacteria 6577984
689 2977929212 2977922695 Bacteria 6956781
690 2977940891 2977935797 Bacteria 6252826
691 2977952867 2977950692 Bacteria 6893264
692 2977959437 2977957713 Bacteria 6877875
693 2977986799 2977986579 Bacteria 6581278
694 2979768864 2979764755 Bacteria 6610066
695 2979775216 2979772303 Bacteria 6618277
696 2979783612 2979779861 Bacteria 6219781
697 2979797742 2979793036 Bacteria 6808957
698 2979812093 2979808191 Bacteria 7179355
699 2987648119 2987645492 Bacteria 6117018
700 2987668880 2987666974 Bacteria 6509233
701 2987673712 2987673487 Bacteria 6884027
702 2989779533 2989776772 Bacteria 4843317
703 2996344928 2996341866 Bacteria 6643098
704 2996389358 2996386984 Bacteria 6978667
705 3000140249 3000135777 Bacteria 6891109
706 3004216322 3004211236 Bacteria 7417683
707 3004224072 3004218560 Bacteria 7421728
708 3004238935 3004232784 Bacteria 6662140
709 3004245866 3004239961 Bacteria 6892290
710 3004250814 3004248173 Bacteria 6563236
711 3004341337 3004334049 Bacteria 8449246
712 3005421607 3005416602 Bacteria 7064308
713 3007614796 3007614139 Bacteria 6053559
714 637074238 637000159 Bacteria 7596297
715 643822214 643692032 Bacteria 6891900
716 649873306 649633066 Bacteria 6690028
717 8004003443 8003999396 Bacteria 7063185
718 8004304504 8004300914 Bacteria 6132239
719 8004368187 8004361976 Bacteria 6858373
720 8004379279 8004374579 Bacteria 6898112
721 8004698876 8004695233 Bacteria 6731676
722 8004711267 8004703790 Bacteria 8006957
723 8004729110 8004727605 Bacteria 6643904
724 8005249859 8005246636 Bacteria 4933972
725 8005319688 8005314921 Bacteria 7072929
726 8005490312 8005484373 Bacteria 6297373
727 8005646965 8005645114 Bacteria 6950293
728 8005688115 8005682033 Bacteria 6726518
729 8019778240 8019775933 Bacteria 6858656
730 8024492453 8024486573 Bacteria 6540512
731 8055775047 8055770955 Bacteria 6827675
732 8056156868 8056155041 Bacteria 6486948
733 8056174894 8056172158 Bacteria 6133900
734 8056178628 8056177738 Bacteria 6748268
735 Ga0105239_10004443
736 MRS2a_Contig_222
737 JGI24740J21852_10000004
738 JGI24737J22298_10004055
739 JGI25155J39150_1000004
740 JGI25156J39149_1000014
741 JGI25162J39368_1000670
742 JGI25162J39368_1001910
743 JGI25154J39366_1000096
744 JGI25157J39369_1000005
745 JGI25151J46595_10015201
746 JGI25165J46597_1001403
747 JGI25165J46597_1001922
748 JGI25153J46596_10001939
749 JGI25153J46596_10006633
750 rootH1_10083839
751 rootH2_10033048
752 rootL2_10123289
753 rootH1_10063462
754 Ga0055542_1000839
755 Ga0065165_1007717
756 Ga0065714_10000305
757 Ga0065714_10006583
758 Ga0065714_10076125
759 Ga0065714_10088436
760 Ga0065715_10002056
761 Ga0070658_10011003
762 Ga0070658_10041052
763 Ga0070658_10114001
764 Ga0070683_100042696
765 Ga0070670_100060006
766 Ga0070660_100046034
767 Ga0070687_100006936
768 Ga0070661_100015245
769 Ga0070661_100093086
770 Ga0070671_100035995
771 Ga0070714_100034145
772 Ga0070714_100060880
773 Ga0070663_100010866
774 Ga0070663_100045377
775 Ga0070681_10090096
776 Ga0070679_100066453
777 Ga0070684_100017827
778 Ga0068853_100000769
779 Ga0068853_100025427
780 Ga0068853_100030296
781 Ga0068853_100037371
782 Ga0068853_100117831
783 Ga0070672_100000700
784 Ga0070665_100010800
785 Ga0070665_100104702
786 Ga0068855_100003263
787 Ga0068855_100010532
788 Ga0068855_100013519
789 Ga0068855_100018293
790 Ga0068855_100085765
791 Ga0068855_100119141
792 Ga0068855_100194899
793 Ga0070664_100045925
794 Ga0068857_100000436
795 Ga0068857_100053343
796 Ga0068857_100060748
797 Ga0068854_100000056
798 Ga0068854_100014066
799 Ga0068854_100097767
800 Ga0068856_100304891
801 Ga0068852_100139096
802 Ga0068859_100208336
803 Ga0068859_100284352
804 Ga0068864_100065800
805 Ga0068861_100180889
806 Ga0068851_10001004
807 Ga0068851_10004431
808 Ga0068863_100010114
809 Ga0068863_100226920
810 Ga0081539_10005268
811 Ga0075365_10008710
812 Ga0075365_10016144
813 Ga0075363_100005206
814 Ga0075362_10000003
815 Ga0075367_10002906
816 Ga0075369_10001406
817 Ga0075369_10004715
818 Ga0097621_100033411
819 Ga0075370_10001512
820 Ga0068865_100022643
821 Ga0097620_100208335
822 Ga0097620_100284355
823 Ga0079104_1000007
824 Ga0079104_1003920
825 Ga0105244_10007446
826 Ga0105240_10000013
827 Ga0105240_10065614
828 Ga0111539_10000100
829 Ga0111539_10041691
830 Ga0114129_10037370
831 Ga0105243_10001488
832 Ga0105241_10010112
833 Ga0105237_10000023
834 Ga0105237_10005220
835 Ga0105237_10130343
836 Ga0105237_10177669
837 Ga0105238_10049578
838 Ga0105238_10176236
839 Ga0105249_10055894
840 Ga0123342_1000455
841 Ga0099796_10006581
842 Ga0105239_10003240
843 Ga0105239_10045237
844 Ga0105239_10205152
845 Ga0157314_1000522
846 Ga0157373_10016254
847 Ga0157373_10021379
848 Ga0157371_10001861
849 Ga0157371_10078920
850 Ga0157370_10003433
851 Ga0157370_10006851
852 Ga0157370_10111199
853 Ga0163162_10307152
854 Ga0157375_10000034
855 Ga0163163_10069987
856 Ga0182008_10015402
857 Ga0182006_1001162
858 Ga0182007_10000898
859 Ga0182007_10002371
860 Ga0163161_10025204
861 Ga0214542_1010266
862 Ga0214543_1000156
863 Ga0213876_10003348
864 Ga0228711_1000006
865 Ga0228710_1000004
866 Ga0209435_100009
867 Ga0209760_100936
868 Ga0209437_100057
869 Ga0209437_100107
870 Ga0209646_1000018
871 Ga0209646_1004842
872 Ga0209026_1000043
873 Ga0209677_100382
874 Ga0209148_1000050
875 Ga0209148_1006050
876 Ga0209759_1000007
877 Ga0209759_1008451
878 Ga0209129_1010251
879 Ga0209233_1000130
880 Ga0209233_1000178
881 Ga0209233_1000358
882 Ga0209455_1000183
883 Ga0209676_1000065
884 Ga0209025_1000216
885 Ga0209025_1011346
886 Ga0209758_1000188
887 Ga0209758_1000537
888 Ga0209050_1014585
889 Ga0207655_1001260
890 Ga0207705_10005324
891 Ga0207705_10011361
892 Ga0207707_10025476
893 Ga0207695_10000044
894 Ga0207695_10012305
895 Ga0207695_10013689
896 Ga0207695_10033043
897 Ga0207695_10119767
898 Ga0207671_10000020
899 Ga0207671_10000033
900 Ga0207671_10000400
901 Ga0207660_10011068
902 Ga0207662_10013471
903 Ga0207657_10007495
904 Ga0207657_10019888
905 Ga0207649_10069631
906 Ga0207652_10020020
907 Ga0207694_10180774
908 Ga0207650_10037522
909 Ga0207664_10079101
910 Ga0207709_10000172
911 Ga0207691_10002020
912 Ga0207679_10040382
913 Ga0207667_10000094
914 Ga0207667_10000238
915 Ga0207667_10003694
916 Ga0207667_10020552
917 Ga0207640_10000043
918 Ga0207640_10000277
919 Ga0207639_10001206
920 Ga0207639_10050301
921 Ga0207678_10008151
922 Ga0207678_10031845
923 Ga0207702_10086814
924 Ga0207641_10062147
925 Ga0207641_10117943
926 Ga0207674_10000074
927 Ga0207674_10002846
928 Ga0207674_10021913
929 Ga0207674_10064094
930 Ga0209281_1000020
931 Ga0209281_1000102
932 Ga0209282_1000013
933 Ga0207428_10000096
934 Ga0207428_10092959
935 Ga0268266_10019839
936 Ga0268266_10044597
937 Ga0307515_10000011
938 Ga0307515_10001041
939 Ga0307515_10001245
940 Ga0307515_10014858
941 Ga0307515_10099050
942 Ga0268256_1011759
943 Ga0307513_10000004
944 Ga0307513_10000011
945 Ga0307513_10021757
946 Ga0307508_10001284
947 Ga0307514_10000722
948 Ga0307514_10002190
949 Ga0307516_10000046
950 Ga0307413_10057325
951 Ga0307407_10000948
952 Ga0315914_1000004
953 Ga0307414_10001606
954 Ga0307415_100007608
955 Ga0307507_10116268
956 Ga0315913_1000011
957 Ga0315915_1000003
958 Ga0316574_0016352
959 Ga0373935_0061307
960 Ga0373927_0000048
961 Ga0373925_0001567
962 Ga0395900_0012611
963 Ga0395905_0001527
964 Ga0395905_0002046
965 Ga0395905_0007463
966 Ga0395905_0189005
967 Ga0395901_0001188
968 Ga0436365_0120529
969 Ga0439438_003703
970 Ga0439447_000014
971 Ga0439466_0002142
972 Ga0439451_000635
973 Ga0439451_001281
974 Ga0439451_007886
975 Ga0439452_004214
976 Ga0439452_006400
977 Ga0439463_004121
978 Ga0450919_003654
979 Ga0450905_000726
980 Ga0450907_000146
981 Ga0450909_000154
982 Ga0450909_006941
983 Ga0439434_0000153
984 Ga0439464_0000460
985 Ga0439460_0002759
986 Ga0450918_000060
987 Ga0439440_0011138
988 Ga0466961_0006453
989 Ga0466959_0066038
990 Ga0451576_0147559
991 Ga0495617_002636
992 Ga0495603_0000930
993 Ga0495590_0015385
994 Ga0495638_0035873
995 Ga0495638_0053280
996 Ga0495651_0106528
997 Ga0495650_0001441
998 Ga0495650_0012043
999 Ga0495650_0018092
1000 Ga0495605_0000114
1001 Ga0495605_0003571
1002 Ga0495605_0026142
1003 Ga0495639_0000001
1004 Ga0495584_0000086
1005 Ga0495584_0001610
1006 Ga0495584_0004386
1007 Ga0495585_0000756
1008 Ga0495585_0000811
1009 Ga0495585_0001747
1010 Ga0495585_0001985
1011 Ga0495594_0004250
1012 Ga0495607_0002550
1013 Ga0495607_0007673
1014 Ga0495607_0053905
1015 Ga0495607_0087746
1016 Ga0495583_0000959
1017 Ga0495583_0007862
1018 Ga0495583_0011682
1019 Ga0495583_0038363
1020 Ga0495606_0004670
1021 Ga0495606_0013066
1022 Ga0495606_0075194
1023 Ga0495610_0000813
1024 Ga0495610_0008005
1025 Ga0495616_0000480
1026 Ga0495616_0009080
1027 Ga0495616_0025257
1028 Ga0495631_0008437
1029 Ga0495632_0000455
1030 Ga0495632_0001698
1031 Ga0495632_0007967
1032 Ga0495637_0001301
1033 Ga0495637_0010096
1034 Ga0495643_0005726
1035 Ga0495643_0012472
1036 Ga0495643_0028814
1037 Ga0495643_0046678
1038 Ga0495648_0009876
1039 Ga0495648_0022911
1040 Ga0495663_0001725
1041 Ga0495642_0000162
1042 Ga0495654_0001192
1043 Ga0495654_0016938
1044 Ga0495609_0003974
1045 Ga0495609_0033289
1046 Ga0495597_0002955
1047 Ga0495597_0017925
1048 Ga0495597_0018415
1049 Ga0495622_0000181
1050 Ga0495622_0000202
1051 Ga0495622_0058521
1052 Ga0495633_0000031
1053 Ga0495656_0000403
1054 Ga0495656_0001604
1055 Ga0495611_0001155
1056 Ga0495625_0001903
1057 Ga0495625_0016365
1058 Ga0495659_0000507
1059 Ga0495659_0035210
1060 Ga0495661_0008104
1061 Ga0495588_0002907
1062 Ga0495669_0003306
1063 Ga0495669_0028623
1064 Ga0495670_0022507
1065 Ga0495670_0033998
1066 Ga0495670_0037742
1067 Ga0495671_0000138
1068 Ga0495671_0010358
1069 Ga0495671_0013321
1070 Ga0495649_0000013
1071 Ga0495649_0000890
1072 Ga0495649_0003006
1073 Ga0495649_0014706
1074 Ga0495649_0014886
1075 Ga0495589_0000141
1076 Ga0495589_0004061
1077 Ga0495589_0015712
1078 Ga0495660_0011537
1079 Ga0495660_0020219
1080 Ga0495660_0046209
1081 Ga0495660_0061135
1082 Ga0495636_0004061
1083 Ga0495636_0073822
1084 Ga0495672_0000419
1085 Ga0495672_0006208
1086 Ga0495672_0052794
1087 Ga0495683_0043601
1088 Ga0495683_0049957
1089 Ga0495677_0000322
1090 Ga0495679_000793
1091 Ga0495679_015906
1092 Ga0495673_0003032
1093 Ga0495673_0003114
1094 Ga0495673_0006252
1095 Ga0495673_0013855
1096 Ga0495673_0053931
1097 Ga0495684_0021634
1098 Ga0495593_0014775
1099 Ga0495615_0001492
1100 Ga0495626_0000329
1101 Ga0495626_0000849
1102 Ga0495626_0001572
1103 Ga0495626_0009783
1104 Ga0496100_0006646
1105 Ga0496102_0014331
1106 Ga0496102_0041392
1107 Ga0496102_0245150
1108 Ga0496103_0012713
1109 Ga0496104_0002324
1110 Ga0496104_0005274
1111 Ga0496105_0038760
1112 Ga0496106_0003149
1113 Ga0496106_0040336
1114 Ga0496108_0001103
1115 Ga0496108_0003172
1116 Ga0496109_0003718
1117 Ga0496109_0051857
1118 Ga0496110_0001272
1119 Ga0496110_0095428
1120 Ga0496111_0001613
1121 Ga0496112_0004257
1122 Ga0496112_0052446
1123 Ga0496113_0000394
1124 Ga0496113_0003078
1125 Ga0496113_0059542
1126 Ga0496114_0167313
1127 Ga0496115_0016207
1128 Ga0496115_0075286
1129 Ga0496115_0240525
1130 Ga0496116_0026740
1131 Ga0496117_0011833
1132 Ga0496118_0013506
1133 Ga0496119_0026392
1134 Ga0496120_0011566
1135 Ga0496121_0000396
1136 Ga0496121_0004070
1137 Ga0496121_0006347
1138 Ga0496121_0049280
1139 Ga0496121_0050746
1140 Ga0496122_0003392
1141 Ga0496122_0016932
1142 Ga0496122_0045378
1143 Ga0496123_0014523
1144 Ga0496123_0030307
1145 Ga0496123_0032039
1146 Ga0496124_0018862
1147 Ga0496124_0133766
1148 Ga0496125_0002729
1149 Ga0496125_0019592
1150 Ga0496125_0036060
1151 Ga0496125_0041900
1152 Ga0495678_000358
1153 Ga0495678_000495
1154 Ga0495678_011653
1155 Ga0495682_0003805
1156 Ga0495682_0010167
1157 Ga0501033_0002268
1158 Ga0501034_0010327
1159 Ga0501034_0035051
1160 Ga0501037_0031652
1161 Ga0501043_0065552
1162 Ga0501046_0000761
1163 Ga0501046_0003012
1164 Ga0501047_0006739
1165 Ga0501047_0028558
1166 Ga0501047_0043333
1167 Ga0501047_0071315
1168 Ga0501067_0044324
1169 Ga0501070_0054546
1170 Ga0501073_0099650
1171 Ga0501074_0109341
1172 Ga0501080_0088672
1173 Ga0501080_0136870
1174 Ga0501083_0037613
1175 Ga0501083_0041093
1176 Ga0501035_0106758
1177 Ga0501044_0000764
1178 Ga0501044_0002447
1179 nmdc:mga03683_22_c1
1180 nmdc:mga03n38_2422_c1
1181 nmdc:mga0yw44_1058_c1
1182 nmdc:mga0yw44_14127_c1
1183 nmdc:mga07m45_3_c1
1184 nmdc:mga08y16_248024_c1
1185 nmdc:mga08y16_62_c1
1186 nmdc:mga0rr50_115952_c1
1187 nmdc:mga0sz30_2314_c2
1188 nmdc:mga0sz30_39_c1
1189 Ga0500610_0005577
1190 Ga0500578_0000309
1191 Ga0500593_021410
1192 Ga0500594_0000141
1193 Ga0500618_005740
1194 Ga0500616_0002438
1195 Ga0500627_0014604
1196 Ga0501084_0095059
1197 Ga0501082_0000027
1198 Ga0501082_0000143
1199 Ga0501082_0142097
1200 2509111487
1201 2509371150
1202 2509379630
1203 2510313733
1204 2511270328
1205 2511328683
1206 2511337475
1207 2511362463
1208 2511368931
1209 2512325100
1210 2512931137
1211 2512958948
1212 2512973225
1213 2513603583
1214 2513983288
1215 2514005823
1216 2514420219
1217 2516206607
1218 2517571774
1219 2523107480
1220 2524452499
1221 2551700281
1222 2551738844
1223 2558866617
1224 2583791355
1225 2585146442
1226 2585280736
1227 2585326525
1228 2585334129
1229 2585531669
1230 2585551384
1231 2597859123
1232 2599487455
1233 2599806230
1234 2599906057
1235 2600195904
1236 2601667911
1237 2616306719
1238 2616557566
1239 2617386383
1240 2643935837
1241 2643986936
1242 2644039912
1243 2644063679
1244 2644083260
1245 2644104161
1246 2644158434
1247 2644247713
1248 2644307035
1249 2644317620
1250 2644331520
1251 2644414442
1252 2644447970
1253 2644540313
1254 2644619272
1255 2644666456
1256 2644690443
1257 2671113462
1258 2671772707
1259 2688598791
1260 2692318130
1261 2722883147
1262 2723575735
1263 2739341891
1264 2753072851
1265 2753461152
1266 2774870016
1267 2778178640
1268 2784312318
1269 2792643351
1270 2792749608
1271 2802720866
1272 2802724470
1273 2802737209
1274 2802746337
1275 2802751826
1276 2808930213
1277 2808952222
1278 2811842972
1279 2819241022
1280 2819611255
1281 2819638814
1282 2823424397
1283 2838030949
1284 2839143666
1285 2840764887
1286 2842477681
1287 2842484987
1288 2842504447
1289 2844014129
1290 2844169416
1291 2846040830
1292 2847423365
1293 2847687639
1294 2848997155
1295 2850079414
1296 2855875170
1297 2856331448
1298 2856335216
1299 2856358374
1300 2857369334
1301 2857550056
1302 2860342459
1303 2869172915
1304 2869235396
1305 2869246847
1306 2869262131
1307 2869270460
1308 2869271549
1309 2871486486
1310 2871491333
1311 2874110209
1312 2874118764
1313 2874127524
1314 2874136854
1315 2874174443
1316 2876365606
1317 2876387316
1318 2876405995
1319 2876410321
1320 2876421819
1321 2878757768
1322 2878778213
1323 2878787193
1324 2881155653
1325 2881851177
1326 2881864965
1327 2882461286
1328 2882635625
1329 2882915259
1330 2885321577
1331 2885346123
1332 2885357946
1333 2896385936
1334 2897809537
1335 2903455393
1336 2903506443
1337 2903519072
1338 2903523535
1339 2903534169
1340 2904427440
1341 2906332352
1342 2906367470
1343 2906373723
1344 2906382585
1345 2906388425
1346 2906398318
1347 2906405282
1348 2906412113
1349 2906432935
1350 2915982720
1351 2916063894
1352 2919411081
1353 2919701160
1354 2920824997
1355 2921256305
1356 2922151768
1357 2922162984
1358 2922174446
1359 2922180698
1360 2924727608
1361 2924746220
1362 2924750481
1363 2924785737
1364 2932418877
1365 2935890948
1366 2936998764
1367 2937030606
1368 2937039076
1369 2937083947
1370 2937090792
1371 2937824841
1372 2937855119
1373 2937864866
1374 2937872086
1375 2937894836
1376 2937983309
1377 2941479818
1378 2957442450
1379 2958110516
1380 2958117382
1381 2958124743
1382 2958143535
1383 2958158978
1384 2960593144
1385 2960682680
1386 2960697551
1387 2961143391
1388 2961174311
1389 2961186397
1390 2963648081
1391 2965026507
1392 2965036813
1393 2965044552
1394 2965050020
1395 2965067217
1396 2965093984
1397 2965106369
1398 2965115023
1399 2967733837
1400 2968000258
1401 2968005470
1402 2968090903
1403 2968092901
1404 2968103185
1405 2968132496
1406 2970031984
1407 2970122801
1408 2970145326
1409 2970495695
1410 2970506898
1411 2970512814
1412 2970539868
1413 2970551317
1414 2970629398
1415 2977530877
1416 2977546905
1417 2977822300
1418 2977832020
1419 2977853666
1420 2977862061
1421 2977873582
1422 2977907610
1423 2977929212
1424 2977940891
1425 2977952867
1426 2977959437
1427 2977986799
1428 2979768864
1429 2979775216
1430 2979783612
1431 2979797742
1432 2979812093
1433 2987648119
1434 2987668880
1435 2987673712
1436 2989779533
1437 2996344928
1438 2996389358
1439 3000140249
1440 3004216322
1441 3004224072
1442 3004238935
1443 3004245866
1444 3004250814
1445 3004341337
1446 3005421607
1447 3007614796
1448 637074238
1449 643822214
1450 649873306
1451 8004003443
1452 8004304504
1453 8004368187
1454 8004379279
1455 8004698876
1456 8004711267
1457 8004729110
1458 8005249859
1459 8005319688
1460 8005490312
1461 8005646965
1462 8005688115
1463 8019778240
1464 8024492453
1465 8055775047
1466 8056156868
1467 8056174894
1468 8056178628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

71

464

0.93

PF05977

MFS_3

Transmembrane secretion effector

59

248

0.91

PF00083

Sugar_tr

Sugar (and other) transporter

65

243

0.9

PF12832

MFS_1_like

MFS_1 like family

92

225

0.87

PF07690

MFS_1

Major Facilitator Superfamily

321

525

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.9137 20 425
8pnl-assembly2.cif.gz_C outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8993 16 426
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8973 16 426
7d5p-assembly1.cif.gz_A structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8738 19 442
7d5p-assembly2.cif.gz_B structure of norc transporter in an outward-open conformation in complex with a single-chain indian camelid antibody 0.8665 20 442
ID Description Score Start End Superfamily
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9535 22 203 1.20.1250.20
af_Q04301_34_211_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9521 20 191 1.20.1250.20
af_P76269_18_258_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9492 21 259 1.20.1250.20
af_P9WJX3_18_194_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9478 19 193 1.20.1250.20
af_Q9HE13_92_349_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9396 23 268 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A257QZJ3-F1-model_v4 EmrB/QacA family drug resistance transporter 0.9744 16 189 GO:0005886
GO:0022857
AF-A0A537NMT5-F1-model_v4 MFS transporter 0.9657 19 169 GO:0005886
GO:0022857
AF-A0A3S1U0X0-F1-model_v4 MFS transporter 0.956 25 161 GO:0005886
GO:0022857
AF-A0A242MTR8-F1-model_v4 MFS permease 0.9547 19 167 GO:0016020
GO:0022857
AF-A0A1S4CMP2-F1-model_v4 Monosaccharide-sensing protein 1-like 0.9403 14 136 GO:0016020
GO:0022857

Map