F478140
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 734 | 302 | 1468 | 187 |
Family's Representative Sequence
| Representative Sequence | 3300013307|Ga0157372_10338726|Ga0157372_103387262 |
| Length | 230 |
| Sequence | MARKSAPIKSRKNHAARQKHIRLFSYVTGKSKFFFVTLRKLIGMIRKLTGEVWKPLQFPGWKQLRKKYALSSLGRVASYSEDVLADGKLLNGSLTTGYKTLNLHRPGNNGTLYIHREIARLFLPKSSLKHKYVIHQNHNKLDNASKNLKWATLEEMIDHQQKSPAKIAYKKVQANRTVGLKLTASQVKSIKKTLSSKNRQLTIKKLAEKYKVSEMTMYRIKSGENWGRIK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 104 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 166 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 167 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 168 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 169 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 172 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 180 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 184 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 185 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 186 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 187 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 188 | 3300041445 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaT | Metatranscriptome | Rhizoplane |
| 189 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041461 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT | Metatranscriptome | Rhizoplane |
| 192 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 193 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 194 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 195 | 3300041506 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT | Metatranscriptome | Unclassified |
| 196 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 197 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 198 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 199 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 200 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 201 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 202 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 203 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 204 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 205 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 206 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 214 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 226 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 230 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 231 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 234 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 235 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 236 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 237 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 238 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 249 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 250 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 251 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 252 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 253 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 254 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 255 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 256 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 257 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 258 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 259 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 261 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 263 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 264 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 267 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 270 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 271 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 272 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 273 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 274 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 275 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 276 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 277 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 278 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 279 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 280 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 281 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 282 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 283 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 284 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 285 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 286 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 287 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 288 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 289 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 290 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 291 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300060246 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.73 |
| Metatranscriptomes | 3.27 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.95 |
| Nodule | 0 |
| Rhizoplane | 1.36 |
| Rhizosphere | 91.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 18.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157372_10338726 | 3300013307 | Bacteria | 1752 |
| 2 | rootH1_10148307 | 3300003316 | Bacteria | 1166 |
| 3 | rootH2_10007161 | 3300003320 | Bacteria | 44535 |
| 4 | rootH2_10022399 | 3300003320 | Bacteria | 6465 |
| 5 | rootL2_10140308 | 3300003322 | Unclassified | 1719 |
| 6 | rootL2_10142273 | 3300003322 | Bacteria | 4235 |
| 7 | rootH1_10215893 | 3300003323 | Unclassified | 1302 |
| 8 | Ga0065714_10142361 | 3300005288 | Unclassified | 1162 |
| 9 | Ga0065715_10494551 | 3300005293 | Bacteria | 785 |
| 10 | Ga0070676_10002584 | 3300005328 | Bacteria | 9312 |
| 11 | Ga0070676_10314517 | 3300005328 | Bacteria | 1066 |
| 12 | Ga0070676_10441621 | 3300005328 | Unclassified | 913 |
| 13 | Ga0070683_100019393 | 3300005329 | Bacteria | 6039 |
| 14 | Ga0070683_100127576 | 3300005329 | Bacteria | 2405 |
| 15 | Ga0070690_100034920 | 3300005330 | Bacteria | 3153 |
| 16 | Ga0070670_100050768 | 3300005331 | Bacteria | 3564 |
| 17 | Ga0070670_100081061 | 3300005331 | Unclassified | 2788 |
| 18 | Ga0070670_100770020 | 3300005331 | Unclassified | 868 |
| 19 | Ga0070677_10026720 | 3300005333 | Bacteria | 2167 |
| 20 | Ga0070677_10052363 | 3300005333 | Bacteria | 1656 |
| 21 | Ga0068869_100059858 | 3300005334 | Bacteria | 2789 |
| 22 | Ga0068869_100093585 | 3300005334 | Bacteria | 2265 |
| 23 | Ga0068869_100194019 | 3300005334 | Bacteria | 1598 |
| 24 | Ga0070666_10000064 | 3300005335 | Bacteria | 79823 |
| 25 | Ga0070666_10038711 | 3300005335 | Bacteria | 3174 |
| 26 | Ga0070666_10051154 | 3300005335 | Bacteria | 2781 |
| 27 | Ga0070680_100080612 | 3300005336 | Unclassified | 2684 |
| 28 | Ga0068868_100007677 | 3300005338 | Bacteria | 7694 |
| 29 | Ga0068868_100010379 | 3300005338 | Bacteria | 6740 |
| 30 | Ga0070660_100039611 | 3300005339 | Bacteria | 3583 |
| 31 | Ga0070660_100131668 | 3300005339 | Bacteria | 2002 |
| 32 | Ga0070660_100196720 | 3300005339 | Bacteria | 1634 |
| 33 | Ga0070660_100244187 | 3300005339 | Unclassified | 1463 |
| 34 | Ga0070660_100800973 | 3300005339 | Unclassified | 792 |
| 35 | Ga0070689_100083123 | 3300005340 | Unclassified | 2516 |
| 36 | Ga0070689_100146411 | 3300005340 | Bacteria | 1903 |
| 37 | Ga0070689_100448810 | 3300005340 | Bacteria | 1097 |
| 38 | Ga0070689_100577830 | 3300005340 | Bacteria | 971 |
| 39 | Ga0070691_10264916 | 3300005341 | Bacteria | 926 |
| 40 | Ga0070687_100010996 | 3300005343 | Bacteria | 3942 |
| 41 | Ga0070661_100086783 | 3300005344 | Bacteria | 2314 |
| 42 | Ga0070661_100397628 | 3300005344 | Bacteria | 1089 |
| 43 | Ga0070661_100731109 | 3300005344 | Unclassified | 808 |
| 44 | Ga0070692_10096976 | 3300005345 | Bacteria | 1611 |
| 45 | Ga0070668_100061399 | 3300005347 | Bacteria | 2911 |
| 46 | Ga0070668_100119474 | 3300005347 | Bacteria | 2105 |
| 47 | Ga0070668_100124361 | 3300005347 | Bacteria | 2065 |
| 48 | Ga0070669_100135403 | 3300005353 | Bacteria | 1894 |
| 49 | Ga0070669_100375292 | 3300005353 | Bacteria | 1159 |
| 50 | Ga0070669_100403196 | 3300005353 | Bacteria | 1119 |
| 51 | Ga0070669_100510620 | 3300005353 | Bacteria | 998 |
| 52 | Ga0070675_100007473 | 3300005354 | Bacteria | 8443 |
| 53 | Ga0070675_100020329 | 3300005354 | Bacteria | 5298 |
| 54 | Ga0070675_100100489 | 3300005354 | Bacteria | 2436 |
| 55 | Ga0070675_100383148 | 3300005354 | Bacteria | 1252 |
| 56 | Ga0070671_100008963 | 3300005355 | Bacteria | 8026 |
| 57 | Ga0070671_100125143 | 3300005355 | Bacteria | 2164 |
| 58 | Ga0070671_100135819 | 3300005355 | Bacteria | 2073 |
| 59 | Ga0070671_100227586 | 3300005355 | Bacteria | 1582 |
| 60 | Ga0070674_100381068 | 3300005356 | Bacteria | 1147 |
| 61 | Ga0070673_100018983 | 3300005364 | Unclassified | 4929 |
| 62 | Ga0070673_100045734 | 3300005364 | Bacteria | 3396 |
| 63 | Ga0070673_100160576 | 3300005364 | Bacteria | 1911 |
| 64 | Ga0070673_100408699 | 3300005364 | Bacteria | 1215 |
| 65 | Ga0070673_100946510 | 3300005364 | Bacteria | 800 |
| 66 | Ga0070688_100103413 | 3300005365 | Unclassified | 1882 |
| 67 | Ga0070688_100203423 | 3300005365 | Unclassified | 1387 |
| 68 | Ga0070659_100011442 | 3300005366 | Bacteria | 6563 |
| 69 | Ga0070659_100019182 | 3300005366 | Bacteria | 5176 |
| 70 | Ga0070659_100047005 | 3300005366 | Bacteria | 3384 |
| 71 | Ga0070659_100252499 | 3300005366 | Bacteria | 1462 |
| 72 | Ga0070659_100377818 | 3300005366 | Unclassified | 1193 |
| 73 | Ga0070659_100531182 | 3300005366 | Bacteria | 1005 |
| 74 | Ga0070667_100011187 | 3300005367 | Bacteria | 7423 |
| 75 | Ga0070667_100033497 | 3300005367 | Bacteria | 4294 |
| 76 | Ga0070667_100034808 | 3300005367 | Bacteria | 4217 |
| 77 | Ga0070667_100069470 | 3300005367 | Bacteria | 2998 |
| 78 | Ga0070667_100242915 | 3300005367 | Bacteria | 1608 |
| 79 | Ga0070667_100244245 | 3300005367 | Bacteria | 1604 |
| 80 | Ga0070713_100490799 | 3300005436 | Unclassified | 1158 |
| 81 | Ga0070705_100468982 | 3300005440 | Bacteria | 949 |
| 82 | Ga0070700_101238320 | 3300005441 | Bacteria | 625 |
| 83 | Ga0070708_100414349 | 3300005445 | Bacteria | 1270 |
| 84 | Ga0070663_100073450 | 3300005455 | Bacteria | 2495 |
| 85 | Ga0070678_100006906 | 3300005456 | Bacteria | 6695 |
| 86 | Ga0070678_100045196 | 3300005456 | Bacteria | 3149 |
| 87 | Ga0070678_100181858 | 3300005456 | Bacteria | 1722 |
| 88 | Ga0070678_100265992 | 3300005456 | Bacteria | 1444 |
| 89 | Ga0070662_101067069 | 3300005457 | Bacteria | 693 |
| 90 | Ga0070681_10109579 | 3300005458 | Unclassified | 2701 |
| 91 | Ga0070681_10178456 | 3300005458 | Bacteria | 2045 |
| 92 | Ga0070681_10289231 | 3300005458 | Bacteria | 1549 |
| 93 | Ga0068867_100029629 | 3300005459 | Bacteria | 3944 |
| 94 | Ga0068867_100036451 | 3300005459 | Bacteria | 3570 |
| 95 | Ga0068867_100061121 | 3300005459 | Bacteria | 2796 |
| 96 | Ga0068867_100152366 | 3300005459 | Unclassified | 1817 |
| 97 | Ga0070685_10122612 | 3300005466 | Unclassified | 1616 |
| 98 | Ga0070685_10156362 | 3300005466 | Bacteria | 1449 |
| 99 | Ga0070707_100299458 | 3300005468 | Bacteria | 1563 |
| 100 | Ga0070699_100597896 | 3300005518 | Bacteria | 1006 |
| 101 | Ga0070699_100780244 | 3300005518 | Bacteria | 874 |
| 102 | Ga0070679_100155068 | 3300005530 | Bacteria | 2265 |
| 103 | Ga0070679_100634391 | 3300005530 | Bacteria | 1011 |
| 104 | Ga0070684_100010278 | 3300005535 | Bacteria | 7408 |
| 105 | Ga0070684_100126678 | 3300005535 | Unclassified | 2301 |
| 106 | Ga0070684_100160370 | 3300005535 | Unclassified | 2040 |
| 107 | Ga0068853_100019279 | 3300005539 | Bacteria | 5654 |
| 108 | Ga0068853_100024928 | 3300005539 | Bacteria | 5018 |
| 109 | Ga0068853_100052022 | 3300005539 | Bacteria | 3527 |
| 110 | Ga0068853_100077511 | 3300005539 | Bacteria | 2903 |
| 111 | Ga0068853_100190439 | 3300005539 | Unclassified | 1863 |
| 112 | Ga0068853_100608342 | 3300005539 | Bacteria | 1038 |
| 113 | Ga0070672_100015769 | 3300005543 | Bacteria | 5395 |
| 114 | Ga0070672_100042923 | 3300005543 | Bacteria | 3483 |
| 115 | Ga0070672_100062607 | 3300005543 | Bacteria | 2936 |
| 116 | Ga0070672_100343483 | 3300005543 | Bacteria | 1271 |
| 117 | Ga0070672_100678587 | 3300005543 | Bacteria | 901 |
| 118 | Ga0070686_100032168 | 3300005544 | Bacteria | 3214 |
| 119 | Ga0070686_100054825 | 3300005544 | Bacteria | 2551 |
| 120 | Ga0070686_100587872 | 3300005544 | Bacteria | 876 |
| 121 | Ga0070665_100551597 | 3300005548 | Bacteria | 1165 |
| 122 | Ga0070665_101184131 | 3300005548 | Bacteria | 775 |
| 123 | Ga0068855_100012109 | 3300005563 | Bacteria | 10421 |
| 124 | Ga0068855_100088858 | 3300005563 | Bacteria | 3568 |
| 125 | Ga0068855_100278449 | 3300005563 | Bacteria | 1858 |
| 126 | Ga0068855_101488340 | 3300005563 | Unclassified | 695 |
| 127 | Ga0068857_100002898 | 3300005577 | Bacteria | 14123 |
| 128 | Ga0068857_100121848 | 3300005577 | Bacteria | 2349 |
| 129 | Ga0068857_100571820 | 3300005577 | Bacteria | 1066 |
| 130 | Ga0068854_100009648 | 3300005578 | Bacteria | 6235 |
| 131 | Ga0068854_100198279 | 3300005578 | Unclassified | 1576 |
| 132 | Ga0068854_100533459 | 3300005578 | Unclassified | 993 |
| 133 | Ga0068856_100040323 | 3300005614 | Bacteria | 4586 |
| 134 | Ga0068856_100408987 | 3300005614 | Bacteria | 1376 |
| 135 | Ga0068852_100001591 | 3300005616 | Bacteria | 15446 |
| 136 | Ga0068852_100012585 | 3300005616 | Bacteria | 6429 |
| 137 | Ga0068852_100023322 | 3300005616 | Bacteria | 4979 |
| 138 | Ga0068852_100034352 | 3300005616 | Bacteria | 4218 |
| 139 | Ga0068852_100099067 | 3300005616 | Bacteria | 2626 |
| 140 | Ga0068852_100426099 | 3300005616 | Bacteria | 1309 |
| 141 | Ga0068859_100000003 | 3300005617 | Bacteria | 479218 |
| 142 | Ga0068859_100041491 | 3300005617 | Unclassified | 4621 |
| 143 | Ga0068859_100194990 | 3300005617 | Bacteria | 2110 |
| 144 | Ga0068859_100906867 | 3300005617 | Unclassified | 966 |
| 145 | Ga0068864_100005097 | 3300005618 | Bacteria | 10764 |
| 146 | Ga0068864_100126246 | 3300005618 | Unclassified | 2293 |
| 147 | Ga0068864_100767837 | 3300005618 | Unclassified | 945 |
| 148 | Ga0068864_101641445 | 3300005618 | Bacteria | 647 |
| 149 | Ga0068866_10279966 | 3300005718 | Bacteria | 1033 |
| 150 | Ga0068861_100079736 | 3300005719 | Bacteria | 2560 |
| 151 | Ga0068861_100983883 | 3300005719 | Bacteria | 804 |
| 152 | Ga0068851_10021781 | 3300005834 | Bacteria | 3114 |
| 153 | Ga0068851_10116076 | 3300005834 | Bacteria | 1434 |
| 154 | Ga0068851_10278214 | 3300005834 | Bacteria | 956 |
| 155 | Ga0068851_10297199 | 3300005834 | Bacteria | 927 |
| 156 | Ga0068870_10021248 | 3300005840 | Bacteria | 3172 |
| 157 | Ga0068870_10111411 | 3300005840 | Bacteria | 1563 |
| 158 | Ga0068863_100046454 | 3300005841 | Unclassified | 4121 |
| 159 | Ga0068863_100057340 | 3300005841 | Unclassified | 3686 |
| 160 | Ga0068863_100058046 | 3300005841 | Bacteria | 3663 |
| 161 | Ga0068863_101599000 | 3300005841 | Bacteria | 661 |
| 162 | Ga0068858_100002247 | 3300005842 | Bacteria | 19511 |
| 163 | Ga0068858_100477571 | 3300005842 | Bacteria | 1203 |
| 164 | Ga0068858_101157739 | 3300005842 | Bacteria | 760 |
| 165 | Ga0068860_100000003 | 3300005843 | Bacteria | 575741 |
| 166 | Ga0068860_100000922 | 3300005843 | Bacteria | 32651 |
| 167 | Ga0068860_100003440 | 3300005843 | Bacteria | 16286 |
| 168 | Ga0068860_100023100 | 3300005843 | Bacteria | 6013 |
| 169 | Ga0068860_100027499 | 3300005843 | Bacteria | 5478 |
| 170 | Ga0068860_100593900 | 3300005843 | Bacteria | 1112 |
| 171 | Ga0068862_100351733 | 3300005844 | Bacteria | 1367 |
| 172 | Ga0068862_101203640 | 3300005844 | Bacteria | 756 |
| 173 | Ga0075366_10091763 | 3300006195 | Bacteria | 1819 |
| 174 | Ga0097621_100026591 | 3300006237 | Bacteria | 4542 |
| 175 | Ga0097621_100138287 | 3300006237 | Unclassified | 2079 |
| 176 | Ga0097621_100158346 | 3300006237 | Bacteria | 1945 |
| 177 | Ga0097621_100211027 | 3300006237 | Bacteria | 1689 |
| 178 | Ga0097621_100219110 | 3300006237 | Bacteria | 1658 |
| 179 | Ga0097621_100242133 | 3300006237 | Bacteria | 1577 |
| 180 | Ga0097621_100409435 | 3300006237 | Bacteria | 1215 |
| 181 | Ga0068871_100013185 | 3300006358 | Bacteria | 6129 |
| 182 | Ga0068871_100018561 | 3300006358 | Bacteria | 5290 |
| 183 | Ga0068871_100026836 | 3300006358 | Bacteria | 4498 |
| 184 | Ga0068871_100113278 | 3300006358 | Bacteria | 2284 |
| 185 | Ga0068871_100276411 | 3300006358 | Bacteria | 1468 |
| 186 | Ga0068871_100346534 | 3300006358 | Bacteria | 1313 |
| 187 | Ga0075428_100083609 | 3300006844 | Bacteria | 3483 |
| 188 | Ga0075428_100588646 | 3300006844 | Bacteria | 1188 |
| 189 | Ga0075431_100005333 | 3300006847 | Bacteria | 12682 |
| 190 | Ga0068865_100017354 | 3300006881 | Bacteria | 4629 |
| 191 | Ga0068865_100167870 | 3300006881 | Unclassified | 1679 |
| 192 | Ga0068865_100168017 | 3300006881 | Bacteria | 1679 |
| 193 | Ga0068865_100410993 | 3300006881 | Bacteria | 1110 |
| 194 | Ga0068865_100644082 | 3300006881 | Unclassified | 900 |
| 195 | Ga0097620_100000003 | 3300006931 | Bacteria | 479218 |
| 196 | Ga0097620_100041490 | 3300006931 | Unclassified | 4621 |
| 197 | Ga0097620_100194970 | 3300006931 | Bacteria | 2110 |
| 198 | Ga0097620_100906832 | 3300006931 | Unclassified | 966 |
| 199 | Ga0105240_10005046 | 3300009093 | Bacteria | 19803 |
| 200 | Ga0105240_10010802 | 3300009093 | Bacteria | 12790 |
| 201 | Ga0105240_10037254 | 3300009093 | Bacteria | 6252 |
| 202 | Ga0105240_10074008 | 3300009093 | Bacteria | 4206 |
| 203 | Ga0105240_10116116 | 3300009093 | Bacteria | 3230 |
| 204 | Ga0111539_10030751 | 3300009094 | Bacteria | 6526 |
| 205 | Ga0111539_10452587 | 3300009094 | Bacteria | 1495 |
| 206 | Ga0105245_10265262 | 3300009098 | Unclassified | 1673 |
| 207 | Ga0105247_10094094 | 3300009101 | Bacteria | 1906 |
| 208 | Ga0105247_10120246 | 3300009101 | Bacteria | 1701 |
| 209 | Ga0114129_10053458 | 3300009147 | Bacteria | 5664 |
| 210 | Ga0105243_10209203 | 3300009148 | Bacteria | 1716 |
| 211 | Ga0105241_10000543 | 3300009174 | Bacteria | 28453 |
| 212 | Ga0105241_10005905 | 3300009174 | Bacteria | 9035 |
| 213 | Ga0105241_10058013 | 3300009174 | Bacteria | 2972 |
| 214 | Ga0105241_10162841 | 3300009174 | Bacteria | 1835 |
| 215 | Ga0105242_10055664 | 3300009176 | Bacteria | 3236 |
| 216 | Ga0105242_10178068 | 3300009176 | Unclassified | 1874 |
| 217 | Ga0105242_10244250 | 3300009176 | Bacteria | 1615 |
| 218 | Ga0105242_10696219 | 3300009176 | Bacteria | 994 |
| 219 | Ga0105242_10818356 | 3300009176 | Bacteria | 924 |
| 220 | Ga0105248_10025753 | 3300009177 | Bacteria | 6543 |
| 221 | Ga0105248_10200253 | 3300009177 | Unclassified | 2250 |
| 222 | Ga0105237_10000144 | 3300009545 | Bacteria | 100105 |
| 223 | Ga0105237_10001993 | 3300009545 | Bacteria | 25973 |
| 224 | Ga0105237_10006883 | 3300009545 | Bacteria | 12532 |
| 225 | Ga0105237_10009632 | 3300009545 | Bacteria | 10342 |
| 226 | Ga0105237_10028528 | 3300009545 | Bacteria | 5683 |
| 227 | Ga0105237_10044226 | 3300009545 | Bacteria | 4484 |
| 228 | Ga0105237_10194909 | 3300009545 | Bacteria | 2025 |
| 229 | Ga0105237_10462293 | 3300009545 | Bacteria | 1275 |
| 230 | Ga0105237_10545364 | 3300009545 | Bacteria | 1166 |
| 231 | Ga0105237_10730935 | 3300009545 | Bacteria | 996 |
| 232 | Ga0105237_11271910 | 3300009545 | Unclassified | 742 |
| 233 | Ga0105238_10114132 | 3300009551 | Unclassified | 2681 |
| 234 | Ga0105238_10319511 | 3300009551 | Bacteria | 1538 |
| 235 | Ga0105238_10642642 | 3300009551 | Bacteria | 1071 |
| 236 | Ga0105238_10860636 | 3300009551 | Bacteria | 924 |
| 237 | Ga0105249_10011114 | 3300009553 | Bacteria | 7908 |
| 238 | Ga0105249_10058402 | 3300009553 | Unclassified | 3536 |
| 239 | Ga0105249_10261905 | 3300009553 | Bacteria | 1719 |
| 240 | Ga0105239_10000488 | 3300010375 | Bacteria | 57554 |
| 241 | Ga0105239_10000925 | 3300010375 | Bacteria | 41596 |
| 242 | Ga0105239_10024627 | 3300010375 | Bacteria | 6630 |
| 243 | Ga0105239_10091051 | 3300010375 | Unclassified | 3365 |
| 244 | Ga0105239_10099620 | 3300010375 | Unclassified | 3213 |
| 245 | Ga0105239_10173973 | 3300010375 | Unclassified | 2408 |
| 246 | Ga0105239_10427139 | 3300010375 | Bacteria | 1502 |
| 247 | Ga0105239_10739892 | 3300010375 | Bacteria | 1125 |
| 248 | Ga0105246_10006531 | 3300011119 | Bacteria | 7120 |
| 249 | Ga0105246_10059895 | 3300011119 | Bacteria | 2643 |
| 250 | Ga0105246_10696054 | 3300011119 | Bacteria | 890 |
| 251 | Ga0157373_10050446 | 3300013100 | Bacteria | 2963 |
| 252 | Ga0157373_10136394 | 3300013100 | Bacteria | 1725 |
| 253 | Ga0157373_10424115 | 3300013100 | Unclassified | 955 |
| 254 | Ga0157373_10538270 | 3300013100 | Unclassified | 846 |
| 255 | Ga0157371_10035183 | 3300013102 | Bacteria | 3589 |
| 256 | Ga0157371_10102061 | 3300013102 | Unclassified | 2035 |
| 257 | Ga0157371_10385346 | 3300013102 | Bacteria | 1024 |
| 258 | Ga0157371_10430149 | 3300013102 | Bacteria | 968 |
| 259 | Ga0157370_10021933 | 3300013104 | Bacteria | 6360 |
| 260 | Ga0157370_10023822 | 3300013104 | Bacteria | 6073 |
| 261 | Ga0157370_10065454 | 3300013104 | Bacteria | 3439 |
| 262 | Ga0157370_10166787 | 3300013104 | Bacteria | 2048 |
| 263 | Ga0157370_10353171 | 3300013104 | Unclassified | 1355 |
| 264 | Ga0157370_10389553 | 3300013104 | Bacteria | 1283 |
| 265 | Ga0157370_10674300 | 3300013104 | Unclassified | 944 |
| 266 | Ga0157369_10015498 | 3300013105 | Bacteria | 8589 |
| 267 | Ga0157369_10027496 | 3300013105 | Bacteria | 6305 |
| 268 | Ga0157369_10115382 | 3300013105 | Bacteria | 2852 |
| 269 | Ga0157369_10520744 | 3300013105 | Bacteria | 1230 |
| 270 | Ga0157374_10000013 | 3300013296 | Bacteria | 461240 |
| 271 | Ga0157374_10017547 | 3300013296 | Bacteria | 6305 |
| 272 | Ga0157374_10110213 | 3300013296 | Bacteria | 2647 |
| 273 | Ga0157374_10145499 | 3300013296 | Bacteria | 2302 |
| 274 | Ga0157374_10332914 | 3300013296 | Unclassified | 1506 |
| 275 | Ga0157378_10034604 | 3300013297 | Bacteria | 4467 |
| 276 | Ga0157378_10038252 | 3300013297 | Unclassified | 4251 |
| 277 | Ga0157378_10150594 | 3300013297 | Bacteria | 2167 |
| 278 | Ga0157378_12084047 | 3300013297 | Unclassified | 618 |
| 279 | Ga0163162_10000253 | 3300013306 | Bacteria | 48450 |
| 280 | Ga0163162_10001229 | 3300013306 | Bacteria | 23943 |
| 281 | Ga0163162_10007984 | 3300013306 | Bacteria | 10321 |
| 282 | Ga0163162_10009127 | 3300013306 | Bacteria | 9644 |
| 283 | Ga0163162_10024760 | 3300013306 | Bacteria | 5928 |
| 284 | Ga0163162_10314484 | 3300013306 | Bacteria | 1699 |
| 285 | Ga0163162_11185762 | 3300013306 | Bacteria | 866 |
| 286 | Ga0157372_10004419 | 3300013307 | Bacteria | 14994 |
| 287 | Ga0157372_10004778 | 3300013307 | Bacteria | 14389 |
| 288 | Ga0157372_10029858 | 3300013307 | Bacteria | 5957 |
| 289 | Ga0157372_10050322 | 3300013307 | Bacteria | 4635 |
| 290 | Ga0157372_10055189 | 3300013307 | Unclassified | 4436 |
| 291 | Ga0157372_10109539 | 3300013307 | Unclassified | 3163 |
| 292 | Ga0157372_10286395 | 3300013307 | Bacteria | 1916 |
| 293 | Ga0157372_10371445 | 3300013307 | Unclassified | 1666 |
| 294 | Ga0157372_10698759 | 3300013307 | Bacteria | 1180 |
| 295 | Ga0157372_10771460 | 3300013307 | Unclassified | 1118 |
| 296 | Ga0157372_10836045 | 3300013307 | Bacteria | 1069 |
| 297 | Ga0157372_10903328 | 3300013307 | Bacteria | 1025 |
| 298 | Ga0157372_11125747 | 3300013307 | Unclassified | 908 |
| 299 | Ga0157372_11583697 | 3300013307 | Unclassified | 754 |
| 300 | Ga0157375_10000422 | 3300013308 | Bacteria | 38347 |
| 301 | Ga0157375_10031081 | 3300013308 | Bacteria | 5041 |
| 302 | Ga0157375_10075044 | 3300013308 | Bacteria | 3405 |
| 303 | Ga0157375_10218582 | 3300013308 | Unclassified | 2064 |
| 304 | Ga0157375_10347506 | 3300013308 | Bacteria | 1649 |
| 305 | Ga0157375_10348819 | 3300013308 | Bacteria | 1646 |
| 306 | Ga0157375_10367677 | 3300013308 | Bacteria | 1604 |
| 307 | Ga0163163_10001496 | 3300014325 | Bacteria | 19803 |
| 308 | Ga0163163_10004119 | 3300014325 | Bacteria | 12386 |
| 309 | Ga0163163_10028299 | 3300014325 | Bacteria | 5379 |
| 310 | Ga0163163_10065372 | 3300014325 | Bacteria | 3610 |
| 311 | Ga0163163_10310861 | 3300014325 | Bacteria | 1629 |
| 312 | Ga0163163_10404031 | 3300014325 | Unclassified | 1424 |
| 313 | Ga0163163_10803621 | 3300014325 | Bacteria | 1004 |
| 314 | Ga0163163_10970266 | 3300014325 | Unclassified | 913 |
| 315 | Ga0163163_11168118 | 3300014325 | Bacteria | 832 |
| 316 | Ga0157380_10001771 | 3300014326 | Bacteria | 14268 |
| 317 | Ga0157380_10011391 | 3300014326 | Bacteria | 6426 |
| 318 | Ga0157380_10046227 | 3300014326 | Unclassified | 3418 |
| 319 | Ga0157380_10629489 | 3300014326 | Unclassified | 1066 |
| 320 | Ga0157380_11049558 | 3300014326 | Bacteria | 851 |
| 321 | Ga0157380_11433910 | 3300014326 | Bacteria | 742 |
| 322 | Ga0157377_10010186 | 3300014745 | Bacteria | 4641 |
| 323 | Ga0157377_10095251 | 3300014745 | Unclassified | 1764 |
| 324 | Ga0157377_10438605 | 3300014745 | Bacteria | 899 |
| 325 | Ga0157379_10006012 | 3300014968 | Bacteria | 10464 |
| 326 | Ga0157379_10013492 | 3300014968 | Bacteria | 7160 |
| 327 | Ga0157379_10050043 | 3300014968 | Bacteria | 3729 |
| 328 | Ga0157379_10080957 | 3300014968 | Bacteria | 2909 |
| 329 | Ga0157379_10181170 | 3300014968 | Bacteria | 1903 |
| 330 | Ga0157376_10001313 | 3300014969 | Bacteria | 16384 |
| 331 | Ga0157376_10018142 | 3300014969 | Bacteria | 5387 |
| 332 | Ga0157376_10018439 | 3300014969 | Bacteria | 5351 |
| 333 | Ga0157376_10033468 | 3300014969 | Bacteria | 4138 |
| 334 | Ga0157376_10350619 | 3300014969 | Bacteria | 1412 |
| 335 | Ga0157376_11362639 | 3300014969 | Unclassified | 740 |
| 336 | Ga0163161_10002701 | 3300017792 | Bacteria | 12608 |
| 337 | Ga0163161_10036635 | 3300017792 | Bacteria | 3514 |
| 338 | Ga0163161_10153052 | 3300017792 | Bacteria | 1754 |
| 339 | Ga0163161_10288247 | 3300017792 | Bacteria | 1290 |
| 340 | Ga0163161_10354781 | 3300017792 | Bacteria | 1167 |
| 341 | Ga0197907_10511360 | 3300020069 | Unclassified | 1145 |
| 342 | Ga0206352_11004656 | 3300020078 | Unclassified | 1241 |
| 343 | Ga0206350_10162210 | 3300020080 | Unclassified | 1016 |
| 344 | Ga0209646_1007831 | 3300025246 | Bacteria | 1733 |
| 345 | Ga0207666_1042856 | 3300025271 | Bacteria | 709 |
| 346 | Ga0207697_10032830 | 3300025315 | Bacteria | 2125 |
| 347 | Ga0207697_10075258 | 3300025315 | Bacteria | 1419 |
| 348 | Ga0207656_10047186 | 3300025321 | Unclassified | 1851 |
| 349 | Ga0207682_10006837 | 3300025893 | Bacteria | 4577 |
| 350 | Ga0207682_10063915 | 3300025893 | Bacteria | 1546 |
| 351 | Ga0207682_10075863 | 3300025893 | Bacteria | 1432 |
| 352 | Ga0207682_10152211 | 3300025893 | Unclassified | 1044 |
| 353 | Ga0207642_10250461 | 3300025899 | Bacteria | 1005 |
| 354 | Ga0207710_10054535 | 3300025900 | Bacteria | 1800 |
| 355 | Ga0207710_10070967 | 3300025900 | Bacteria | 1597 |
| 356 | Ga0207688_10034169 | 3300025901 | Bacteria | 2815 |
| 357 | Ga0207688_10079716 | 3300025901 | Bacteria | 1868 |
| 358 | Ga0207680_10000054 | 3300025903 | Bacteria | 54305 |
| 359 | Ga0207680_10099815 | 3300025903 | Bacteria | 1863 |
| 360 | Ga0207680_10141780 | 3300025903 | Bacteria | 1594 |
| 361 | Ga0207680_10248323 | 3300025903 | Bacteria | 1228 |
| 362 | Ga0207647_10000064 | 3300025904 | Bacteria | 82970 |
| 363 | Ga0207647_10003263 | 3300025904 | Bacteria | 12181 |
| 364 | Ga0207647_10008387 | 3300025904 | Bacteria | 7412 |
| 365 | Ga0207647_10174890 | 3300025904 | Bacteria | 1249 |
| 366 | Ga0207645_10000352 | 3300025907 | Bacteria | 38310 |
| 367 | Ga0207645_10112575 | 3300025907 | Bacteria | 1763 |
| 368 | Ga0207643_10027738 | 3300025908 | Bacteria | 3141 |
| 369 | Ga0207643_10113336 | 3300025908 | Unclassified | 1599 |
| 370 | Ga0207705_10065461 | 3300025909 | Unclassified | 2627 |
| 371 | Ga0207654_10001121 | 3300025911 | Bacteria | 14469 |
| 372 | Ga0207654_10003601 | 3300025911 | Bacteria | 7823 |
| 373 | Ga0207654_10232166 | 3300025911 | Bacteria | 1229 |
| 374 | Ga0207654_10348665 | 3300025911 | Bacteria | 1019 |
| 375 | Ga0207707_10088343 | 3300025912 | Unclassified | 2707 |
| 376 | Ga0207707_10181623 | 3300025912 | Bacteria | 1837 |
| 377 | Ga0207695_10000056 | 3300025913 | Bacteria | 382433 |
| 378 | Ga0207695_10001122 | 3300025913 | Bacteria | 46534 |
| 379 | Ga0207695_10001317 | 3300025913 | Bacteria | 42084 |
| 380 | Ga0207695_10001383 | 3300025913 | Bacteria | 41051 |
| 381 | Ga0207695_10015819 | 3300025913 | Bacteria | 8863 |
| 382 | Ga0207695_10054760 | 3300025913 | Bacteria | 4162 |
| 383 | Ga0207695_10071354 | 3300025913 | Bacteria | 3547 |
| 384 | Ga0207695_10079185 | 3300025913 | Unclassified | 3332 |
| 385 | Ga0207671_10001689 | 3300025914 | Bacteria | 25015 |
| 386 | Ga0207671_10002585 | 3300025914 | Bacteria | 19130 |
| 387 | Ga0207671_10003111 | 3300025914 | Bacteria | 16871 |
| 388 | Ga0207671_10012969 | 3300025914 | Bacteria | 6668 |
| 389 | Ga0207671_10016185 | 3300025914 | Bacteria | 5806 |
| 390 | Ga0207671_10044863 | 3300025914 | Unclassified | 3268 |
| 391 | Ga0207671_10061597 | 3300025914 | Bacteria | 2784 |
| 392 | Ga0207671_10429961 | 3300025914 | Unclassified | 1051 |
| 393 | Ga0207660_10096729 | 3300025917 | Bacteria | 2199 |
| 394 | Ga0207662_10070492 | 3300025918 | Bacteria | 2114 |
| 395 | Ga0207657_10033042 | 3300025919 | Bacteria | 4667 |
| 396 | Ga0207657_10198499 | 3300025919 | Unclassified | 1615 |
| 397 | Ga0207657_10378679 | 3300025919 | Bacteria | 1115 |
| 398 | Ga0207649_10095654 | 3300025920 | Bacteria | 1955 |
| 399 | Ga0207649_10172496 | 3300025920 | Bacteria | 1508 |
| 400 | Ga0207649_10651184 | 3300025920 | Unclassified | 814 |
| 401 | Ga0207652_10226420 | 3300025921 | Bacteria | 1685 |
| 402 | Ga0207652_10680372 | 3300025921 | Bacteria | 919 |
| 403 | Ga0207681_10077005 | 3300025923 | Bacteria | 2343 |
| 404 | Ga0207681_10536743 | 3300025923 | Unclassified | 961 |
| 405 | Ga0207681_10837024 | 3300025923 | Bacteria | 769 |
| 406 | Ga0207694_10060486 | 3300025924 | Unclassified | 2948 |
| 407 | Ga0207694_10119359 | 3300025924 | Unclassified | 2104 |
| 408 | Ga0207694_11052315 | 3300025924 | Bacteria | 689 |
| 409 | Ga0207650_10018897 | 3300025925 | Bacteria | 4842 |
| 410 | Ga0207650_10067533 | 3300025925 | Bacteria | 2683 |
| 411 | Ga0207650_10204764 | 3300025925 | Unclassified | 1582 |
| 412 | Ga0207650_10276199 | 3300025925 | Bacteria | 1367 |
| 413 | Ga0207650_10579361 | 3300025925 | Unclassified | 942 |
| 414 | Ga0207659_10013556 | 3300025926 | Bacteria | 5226 |
| 415 | Ga0207659_10184807 | 3300025926 | Bacteria | 1654 |
| 416 | Ga0207659_10332966 | 3300025926 | Unclassified | 1256 |
| 417 | Ga0207659_10780781 | 3300025926 | Unclassified | 820 |
| 418 | Ga0207659_11346805 | 3300025926 | Bacteria | 612 |
| 419 | Ga0207687_10315357 | 3300025927 | Bacteria | 1264 |
| 420 | Ga0207644_10049783 | 3300025931 | Bacteria | 3001 |
| 421 | Ga0207644_10085796 | 3300025931 | Unclassified | 2336 |
| 422 | Ga0207644_10193366 | 3300025931 | Bacteria | 1601 |
| 423 | Ga0207644_10194340 | 3300025931 | Bacteria | 1597 |
| 424 | Ga0207644_10282153 | 3300025931 | Bacteria | 1334 |
| 425 | Ga0207690_10015227 | 3300025932 | Bacteria | 4657 |
| 426 | Ga0207690_10141315 | 3300025932 | Bacteria | 1774 |
| 427 | Ga0207690_10159314 | 3300025932 | Unclassified | 1681 |
| 428 | Ga0207706_10617107 | 3300025933 | Bacteria | 930 |
| 429 | Ga0207686_10079447 | 3300025934 | Bacteria | 2136 |
| 430 | Ga0207686_10178649 | 3300025934 | Unclassified | 1503 |
| 431 | Ga0207686_10704682 | 3300025934 | Bacteria | 803 |
| 432 | Ga0207670_10035867 | 3300025936 | Bacteria | 3221 |
| 433 | Ga0207669_10185902 | 3300025937 | Bacteria | 1494 |
| 434 | Ga0207669_10225503 | 3300025937 | Bacteria | 1378 |
| 435 | Ga0207669_10460782 | 3300025937 | Bacteria | 1009 |
| 436 | Ga0207704_10036624 | 3300025938 | Bacteria | 2824 |
| 437 | Ga0207704_10056617 | 3300025938 | Bacteria | 2403 |
| 438 | Ga0207691_10005099 | 3300025940 | Bacteria | 12675 |
| 439 | Ga0207691_10017616 | 3300025940 | Bacteria | 6768 |
| 440 | Ga0207691_10024317 | 3300025940 | Bacteria | 5696 |
| 441 | Ga0207691_10171699 | 3300025940 | Unclassified | 1899 |
| 442 | Ga0207691_10529598 | 3300025940 | Bacteria | 1000 |
| 443 | Ga0207691_10561829 | 3300025940 | Bacteria | 967 |
| 444 | Ga0207691_10814508 | 3300025940 | Bacteria | 784 |
| 445 | Ga0207691_11211432 | 3300025940 | Bacteria | 626 |
| 446 | Ga0207689_10000337 | 3300025942 | Bacteria | 43636 |
| 447 | Ga0207689_10003324 | 3300025942 | Bacteria | 14720 |
| 448 | Ga0207689_10059536 | 3300025942 | Bacteria | 3141 |
| 449 | Ga0207661_10083293 | 3300025944 | Unclassified | 2646 |
| 450 | Ga0207661_10305716 | 3300025944 | Bacteria | 1427 |
| 451 | Ga0207679_10170845 | 3300025945 | Bacteria | 1790 |
| 452 | Ga0207667_10004402 | 3300025949 | Bacteria | 17256 |
| 453 | Ga0207667_10010335 | 3300025949 | Bacteria | 10916 |
| 454 | Ga0207667_10206295 | 3300025949 | Bacteria | 2015 |
| 455 | Ga0207667_10227636 | 3300025949 | Unclassified | 1910 |
| 456 | Ga0207651_10009029 | 3300025960 | Bacteria | 5423 |
| 457 | Ga0207651_10052009 | 3300025960 | Unclassified | 2791 |
| 458 | Ga0207651_10071439 | 3300025960 | Bacteria | 2460 |
| 459 | Ga0207651_10209932 | 3300025960 | Bacteria | 1566 |
| 460 | Ga0207651_10316254 | 3300025960 | Bacteria | 1304 |
| 461 | Ga0207712_10005606 | 3300025961 | Bacteria | 7914 |
| 462 | Ga0207712_10078718 | 3300025961 | Bacteria | 2393 |
| 463 | Ga0207668_10466938 | 3300025972 | Bacteria | 1080 |
| 464 | Ga0207668_10538802 | 3300025972 | Bacteria | 1009 |
| 465 | Ga0207640_10030773 | 3300025981 | Bacteria | 3309 |
| 466 | Ga0207640_10043608 | 3300025981 | Bacteria | 2868 |
| 467 | Ga0207640_10064775 | 3300025981 | Unclassified | 2435 |
| 468 | Ga0207640_10543385 | 3300025981 | Bacteria | 975 |
| 469 | Ga0207640_10846660 | 3300025981 | Unclassified | 795 |
| 470 | Ga0207658_10016928 | 3300025986 | Bacteria | 5018 |
| 471 | Ga0207658_10085598 | 3300025986 | Unclassified | 2428 |
| 472 | Ga0207658_10120149 | 3300025986 | Unclassified | 2094 |
| 473 | Ga0207658_10182831 | 3300025986 | Bacteria | 1736 |
| 474 | Ga0207658_10756524 | 3300025986 | Unclassified | 880 |
| 475 | Ga0207677_10001184 | 3300026023 | Bacteria | 14185 |
| 476 | Ga0207677_10020347 | 3300026023 | Bacteria | 4028 |
| 477 | Ga0207677_10047442 | 3300026023 | Bacteria | 2884 |
| 478 | Ga0207677_10147398 | 3300026023 | Bacteria | 1811 |
| 479 | Ga0207703_10018354 | 3300026035 | Bacteria | 5462 |
| 480 | Ga0207639_10003376 | 3300026041 | Bacteria | 10738 |
| 481 | Ga0207639_10005516 | 3300026041 | Bacteria | 8551 |
| 482 | Ga0207639_10012234 | 3300026041 | Bacteria | 5972 |
| 483 | Ga0207639_10047321 | 3300026041 | Unclassified | 3250 |
| 484 | Ga0207639_10049107 | 3300026041 | Bacteria | 3197 |
| 485 | Ga0207639_10092994 | 3300026041 | Bacteria | 2417 |
| 486 | Ga0207639_10145648 | 3300026041 | Bacteria | 1978 |
| 487 | Ga0207639_10194828 | 3300026041 | Bacteria | 1733 |
| 488 | Ga0207639_10549310 | 3300026041 | Unclassified | 1060 |
| 489 | Ga0207639_10565444 | 3300026041 | Bacteria | 1045 |
| 490 | Ga0207678_10163164 | 3300026067 | Bacteria | 1903 |
| 491 | Ga0207678_10163319 | 3300026067 | Bacteria | 1902 |
| 492 | Ga0207678_10189342 | 3300026067 | Bacteria | 1758 |
| 493 | Ga0207678_10853090 | 3300026067 | Bacteria | 805 |
| 494 | Ga0207702_10020706 | 3300026078 | Bacteria | 5440 |
| 495 | Ga0207702_10028278 | 3300026078 | Bacteria | 4659 |
| 496 | Ga0207702_10920178 | 3300026078 | Unclassified | 867 |
| 497 | Ga0207641_10000026 | 3300026088 | Bacteria | 245091 |
| 498 | Ga0207648_10001428 | 3300026089 | Bacteria | 26300 |
| 499 | Ga0207648_10087264 | 3300026089 | Bacteria | 2723 |
| 500 | Ga0207648_10209801 | 3300026089 | Unclassified | 1729 |
| 501 | Ga0207648_10304236 | 3300026089 | Bacteria | 1430 |
| 502 | Ga0207648_10418865 | 3300026089 | Unclassified | 1216 |
| 503 | Ga0207676_10023052 | 3300026095 | Unclassified | 4586 |
| 504 | Ga0207676_10123693 | 3300026095 | Unclassified | 2186 |
| 505 | Ga0207676_10171220 | 3300026095 | Bacteria | 1892 |
| 506 | Ga0207676_10409887 | 3300026095 | Bacteria | 1269 |
| 507 | Ga0207676_10507695 | 3300026095 | Bacteria | 1146 |
| 508 | Ga0207676_10586145 | 3300026095 | Unclassified | 1069 |
| 509 | Ga0207674_10012728 | 3300026116 | Bacteria | 9402 |
| 510 | Ga0207674_10036451 | 3300026116 | Bacteria | 5125 |
| 511 | Ga0207674_10107502 | 3300026116 | Bacteria | 2767 |
| 512 | Ga0207675_100039383 | 3300026118 | Bacteria | 4411 |
| 513 | Ga0207675_100446592 | 3300026118 | Unclassified | 1281 |
| 514 | Ga0207675_101092334 | 3300026118 | Bacteria | 817 |
| 515 | Ga0207683_10001458 | 3300026121 | Bacteria | 21328 |
| 516 | Ga0207683_10065455 | 3300026121 | Bacteria | 3205 |
| 517 | Ga0207683_10172343 | 3300026121 | Bacteria | 1960 |
| 518 | Ga0207683_10183521 | 3300026121 | Unclassified | 1898 |
| 519 | Ga0207683_10211141 | 3300026121 | Bacteria | 1767 |
| 520 | Ga0207698_10004047 | 3300026142 | Bacteria | 8902 |
| 521 | Ga0207698_10016155 | 3300026142 | Bacteria | 5023 |
| 522 | Ga0207698_10023910 | 3300026142 | Bacteria | 4278 |
| 523 | Ga0207698_10038711 | 3300026142 | Bacteria | 3526 |
| 524 | Ga0207698_10073503 | 3300026142 | Bacteria | 2723 |
| 525 | Ga0209984_1011145 | 3300027424 | Bacteria | 1162 |
| 526 | Ga0209995_1014031 | 3300027471 | Unclassified | 1314 |
| 527 | Ga0210002_1020593 | 3300027617 | Bacteria | 1062 |
| 528 | Ga0209974_10049027 | 3300027876 | Unclassified | 1416 |
| 529 | Ga0209974_10145073 | 3300027876 | Bacteria | 854 |
| 530 | Ga0268266_10000169 | 3300028379 | Bacteria | 119437 |
| 531 | Ga0268266_10101400 | 3300028379 | Bacteria | 2537 |
| 532 | Ga0268264_10000063 | 3300028381 | Bacteria | 301702 |
| 533 | Ga0268264_10001200 | 3300028381 | Bacteria | 25018 |
| 534 | Ga0268264_10004205 | 3300028381 | Bacteria | 12288 |
| 535 | Ga0268264_10006017 | 3300028381 | Bacteria | 10265 |
| 536 | Ga0268264_10041768 | 3300028381 | Bacteria | 3794 |
| 537 | Ga0268264_10079293 | 3300028381 | Bacteria | 2801 |
| 538 | Ga0268264_10290277 | 3300028381 | Bacteria | 1536 |
| 539 | Ga0268264_10375142 | 3300028381 | Unclassified | 1361 |
| 540 | Ga0307517_10139002 | 3300028786 | Bacteria | 1714 |
| 541 | Ga0307515_10001389 | 3300028794 | Bacteria | 54743 |
| 542 | Ga0307511_10000409 | 3300030521 | Bacteria | 45829 |
| 543 | Ga0265327_10006319 | 3300031251 | Bacteria | 9518 |
| 544 | Ga0307513_10085521 | 3300031456 | Bacteria | 3236 |
| 545 | Ga0307513_10475437 | 3300031456 | Unclassified | 970 |
| 546 | Ga0307509_10131040 | 3300031507 | Bacteria | 2463 |
| 547 | Ga0307509_10411529 | 3300031507 | Bacteria | 1056 |
| 548 | Ga0307508_10000485 | 3300031616 | Bacteria | 47975 |
| 549 | Ga0307508_10318065 | 3300031616 | Bacteria | 1148 |
| 550 | Ga0307516_10003090 | 3300031730 | Bacteria | 21666 |
| 551 | Ga0307516_10093156 | 3300031730 | Bacteria | 2839 |
| 552 | Ga0307516_10199285 | 3300031730 | Bacteria | 1723 |
| 553 | Ga0307410_10435550 | 3300031852 | Bacteria | 1066 |
| 554 | Ga0307406_10112818 | 3300031901 | Bacteria | 1875 |
| 555 | Ga0307416_100110558 | 3300032002 | Bacteria | 2420 |
| 556 | Ga0307416_100914187 | 3300032002 | Bacteria | 978 |
| 557 | Ga0307414_10374611 | 3300032004 | Bacteria | 1229 |
| 558 | Ga0307414_10664091 | 3300032004 | Bacteria | 941 |
| 559 | Ga0307411_10204649 | 3300032005 | Bacteria | 1519 |
| 560 | Ga0307411_10687572 | 3300032005 | Bacteria | 890 |
| 561 | Ga0307415_100093430 | 3300032126 | Bacteria | 2184 |
| 562 | Ga0307415_100571597 | 3300032126 | Bacteria | 1001 |
| 563 | Ga0307415_100763073 | 3300032126 | Bacteria | 879 |
| 564 | Ga0307510_10000156 | 3300033180 | Bacteria | 56919 |
| 565 | Ga0373939_0241877 | 3300035114 | Bacteria | 699 |
| 566 | Ga0373927_0143992 | 3300035695 | Bacteria | 1560 |
| 567 | Ga0373925_0301651 | 3300037068 | Bacteria | 1293 |
| 568 | Ga0395900_0040184 | 3300037418 | Bacteria | 4821 |
| 569 | Ga0395898_0320103 | 3300037466 | Viruses | 1480 |
| 570 | Ga0395901_0111267 | 3300038443 | Bacteria | 2876 |
| 571 | Ga0439436_0038066 | 3300041404 | Bacteria | 1384 |
| 572 | Ga0439439_0126279 | 3300041406 | Bacteria | 716 |
| 573 | Ga0451792_09039 | 3300041445 | Bacteria | 595 |
| 574 | Ga0451791_0594761 | 3300041451 | Bacteria | 911 |
| 575 | Ga0451800_1224414 | 3300041459 | Bacteria | 1972 |
| 576 | Ga0451805_092861 | 3300041461 | Bacteria | 646 |
| 577 | Ga0451833_0563121 | 3300041491 | Bacteria | 1165 |
| 578 | Ga0451841_0486093 | 3300041498 | Bacteria | 996 |
| 579 | Ga0451849_0231858 | 3300041505 | Unclassified | 1499 |
| 580 | Ga0451849_0981161 | 3300041505 | Bacteria | 1617 |
| 581 | Ga0451850_60345 | 3300041506 | Bacteria | 720 |
| 582 | Ga0451853_3832616 | 3300041512 | Bacteria | 894 |
| 583 | Ga0439433_0016269 | 3300041999 | Unclassified | 1647 |
| 584 | Ga0439445_0045264 | 3300042004 | Bacteria | 1177 |
| 585 | Ga0439448_0149498 | 3300042005 | Bacteria | 810 |
| 586 | Ga0439449_0051924 | 3300042007 | Bacteria | 1516 |
| 587 | Ga0439449_0146400 | 3300042007 | Bacteria | 880 |
| 588 | Ga0439457_000945 | 3300042014 | Bacteria | 8724 |
| 589 | Ga0451577_0001932 | 3300042876 | Bacteria | 26161 |
| 590 | Ga0451577_0106051 | 3300042876 | Bacteria | 2512 |
| 591 | Ga0466969_0168597 | 3300044656 | Bacteria | 1004 |
| 592 | Ga0466972_0001713 | 3300044658 | Bacteria | 10754 |
| 593 | Ga0466972_0019149 | 3300044658 | Bacteria | 3423 |
| 594 | Ga0466972_0049494 | 3300044658 | Bacteria | 2030 |
| 595 | Ga0466972_0242982 | 3300044658 | Unclassified | 842 |
| 596 | Ga0453683_0245289 | 3300044673 | Bacteria | 1141 |
| 597 | Ga0453683_0337265 | 3300044673 | Unclassified | 967 |
| 598 | Ga0466965_0096230 | 3300044683 | Bacteria | 1510 |
| 599 | Ga0466961_0053887 | 3300044693 | Bacteria | 2566 |
| 600 | Ga0453684_0023709 | 3300044712 | Bacteria | 9015 |
| 601 | Ga0453684_0024719 | 3300044712 | Bacteria | 8759 |
| 602 | Ga0453684_0226048 | 3300044712 | Unclassified | 2164 |
| 603 | Ga0453684_0923574 | 3300044712 | Unclassified | 933 |
| 604 | Ga0466971_0065433 | 3300044719 | Bacteria | 1646 |
| 605 | Ga0466968_0024154 | 3300044735 | Bacteria | 2482 |
| 606 | Ga0466968_0053392 | 3300044735 | Bacteria | 1731 |
| 607 | Ga0466970_0074443 | 3300044765 | Bacteria | 1828 |
| 608 | Ga0466970_0116658 | 3300044765 | Bacteria | 1460 |
| 609 | Ga0466957_0001412 | 3300044842 | Bacteria | 12519 |
| 610 | Ga0466957_0072732 | 3300044842 | Bacteria | 2129 |
| 611 | Ga0466959_0054555 | 3300045049 | Bacteria | 2919 |
| 612 | Ga0451576_0313597 | 3300045051 | Unclassified | 1641 |
| 613 | Ga0466958_0165347 | 3300045836 | Bacteria | 1400 |
| 614 | Ga0495638_0042798 | 3300046460 | Bacteria | 2860 |
| 615 | Ga0495638_0118921 | 3300046460 | Bacteria | 1563 |
| 616 | Ga0495606_0008396 | 3300046507 | Bacteria | 8987 |
| 617 | Ga0495630_0970953 | 3300046517 | Bacteria | 646 |
| 618 | Ga0495648_0005427 | 3300046524 | Bacteria | 10592 |
| 619 | Ga0495611_0000061 | 3300046648 | Bacteria | 77533 |
| 620 | Ga0495635_0130120 | 3300046663 | Unclassified | 1716 |
| 621 | Ga0495672_0016954 | 3300047320 | Bacteria | 4882 |
| 622 | Ga0495672_0092833 | 3300047320 | Bacteria | 1654 |
| 623 | Ga0495672_0131956 | 3300047320 | Bacteria | 1313 |
| 624 | Ga0495687_001475 | 3300047443 | Bacteria | 21512 |
| 625 | Ga0495686_0000010 | 3300047472 | Bacteria | 573229 |
| 626 | Ga0496100_0188765 | 3300048903 | Bacteria | 1495 |
| 627 | Ga0496102_0941024 | 3300048905 | Bacteria | 785 |
| 628 | Ga0496104_0544376 | 3300048907 | Bacteria | 1072 |
| 629 | Ga0496106_0446598 | 3300048909 | Bacteria | 1039 |
| 630 | Ga0496114_0126267 | 3300048917 | Bacteria | 2205 |
| 631 | Ga0496115_0182577 | 3300048918 | Bacteria | 1734 |
| 632 | Ga0501308_043395 | 3300049128 | Bacteria | 639 |
| 633 | Ga0501308_054016 | 3300049128 | Bacteria | 594 |
| 634 | Ga0501304_024782 | 3300049160 | Bacteria | 612 |
| 635 | Ga0501305_075692 | 3300049161 | Bacteria | 598 |
| 636 | Ga0501298_076408 | 3300049521 | Bacteria | 730 |
| 637 | Ga0501317_045829 | 3300049533 | Bacteria | 681 |
| 638 | Ga0501327_08393 | 3300049543 | Bacteria | 656 |
| 639 | Ga0501335_008372 | 3300049551 | Bacteria | 971 |
| 640 | Ga0501032_0116661 | 3300049569 | Bacteria | 1765 |
| 641 | Ga0501033_0113933 | 3300049570 | Bacteria | 1966 |
| 642 | Ga0501033_0201368 | 3300049570 | Unclassified | 1422 |
| 643 | Ga0501034_0000007 | 3300049571 | Bacteria | 357805 |
| 644 | Ga0501034_0009847 | 3300049571 | Bacteria | 9994 |
| 645 | Ga0501034_0023022 | 3300049571 | Bacteria | 6348 |
| 646 | Ga0501034_0211523 | 3300049571 | Bacteria | 1894 |
| 647 | Ga0501036_0277678 | 3300049572 | Bacteria | 1402 |
| 648 | Ga0501036_0282605 | 3300049572 | Bacteria | 1389 |
| 649 | Ga0501036_0957360 | 3300049572 | Unclassified | 701 |
| 650 | Ga0501037_0089565 | 3300049573 | Unclassified | 2226 |
| 651 | Ga0501037_0182795 | 3300049573 | Bacteria | 1487 |
| 652 | Ga0501038_0004606 | 3300049574 | Bacteria | 12825 |
| 653 | Ga0501039_0022527 | 3300049575 | Unclassified | 4835 |
| 654 | Ga0501039_0023758 | 3300049575 | Bacteria | 4705 |
| 655 | Ga0501043_0013799 | 3300049579 | Bacteria | 6323 |
| 656 | Ga0501043_0024672 | 3300049579 | Bacteria | 4716 |
| 657 | Ga0501043_0030889 | 3300049579 | Bacteria | 4213 |
| 658 | Ga0501043_0033225 | 3300049579 | Bacteria | 4058 |
| 659 | Ga0501043_0049730 | 3300049579 | Bacteria | 3296 |
| 660 | Ga0501046_0156098 | 3300049580 | Bacteria | 1719 |
| 661 | Ga0501046_0210364 | 3300049580 | Unclassified | 1444 |
| 662 | Ga0501046_0241229 | 3300049580 | Bacteria | 1333 |
| 663 | Ga0501047_0058438 | 3300049581 | Bacteria | 3726 |
| 664 | Ga0501047_0535195 | 3300049581 | Bacteria | 997 |
| 665 | Ga0501047_0620678 | 3300049581 | Unclassified | 902 |
| 666 | Ga0501047_0695658 | 3300049581 | Unclassified | 834 |
| 667 | Ga0501201_008448 | 3300049651 | Bacteria | 995 |
| 668 | Ga0501202_014928 | 3300049652 | Bacteria | 1491 |
| 669 | Ga0501227_103046 | 3300049665 | Bacteria | 760 |
| 670 | Ga0501233_069478 | 3300049668 | Unclassified | 890 |
| 671 | Ga0501240_026182 | 3300049673 | Bacteria | 910 |
| 672 | Ga0501243_001398 | 3300049675 | Bacteria | 3449 |
| 673 | Ga0501252_007922 | 3300049682 | Bacteria | 1212 |
| 674 | Ga0501257_063921 | 3300049686 | Unclassified | 933 |
| 675 | Ga0501257_071849 | 3300049686 | Bacteria | 885 |
| 676 | Ga0501257_101105 | 3300049686 | Bacteria | 757 |
| 677 | Ga0501259_009713 | 3300049688 | Bacteria | 1564 |
| 678 | Ga0501261_030697 | 3300049690 | Bacteria | 812 |
| 679 | Ga0501221_017241 | 3300049704 | Bacteria | 1376 |
| 680 | Ga0501225_0001947 | 3300049705 | Bacteria | 6463 |
| 681 | Ga0501245_022368 | 3300049708 | Bacteria | 997 |
| 682 | Ga0501083_0411517 | 3300049744 | Unclassified | 880 |
| 683 | Ga0501083_0614166 | 3300049744 | Unclassified | 707 |
| 684 | Ga0501266_002322 | 3300049763 | Bacteria | 2407 |
| 685 | Ga0501270_045225 | 3300049767 | Bacteria | 780 |
| 686 | Ga0501035_0266957 | 3300049822 | Bacteria | 1449 |
| 687 | Ga0501044_0060496 | 3300049823 | Bacteria | 3878 |
| 688 | Ga0501044_0105210 | 3300049823 | Bacteria | 2835 |
| 689 | Ga0501044_0158560 | 3300049823 | Unclassified | 2241 |
| 690 | Ga0501044_0357018 | 3300049823 | Bacteria | 1380 |
| 691 | Ga0501284_00001 | 3300050005 | Bacteria | 261916 |
| 692 | nmdc:mga06r32_21132_c1 | 3300050510 | Bacteria | 6006 |
| 693 | nmdc:mga08y16_26956_c1 | 3300050511 | Bacteria | 6056 |
| 694 | Ga0500578_0001290 | 3300053086 | Bacteria | 25877 |
| 695 | Ga0500646_0003313 | 3300053090 | Bacteria | 4137 |
| 696 | Ga0500646_0253714 | 3300053090 | Unclassified | 620 |
| 697 | Ga0500647_0273419 | 3300053091 | Bacteria | 733 |
| 698 | Ga0500583_0000019 | 3300053092 | Bacteria | 130534 |
| 699 | Ga0500583_0013004 | 3300053092 | Bacteria | 3201 |
| 700 | Ga0500583_0031093 | 3300053092 | Bacteria | 2343 |
| 701 | Ga0500651_0449276 | 3300053093 | Bacteria | 717 |
| 702 | Ga0500554_126087 | 3300053102 | Bacteria | 864 |
| 703 | Ga0500555_061837 | 3300053103 | Bacteria | 1005 |
| 704 | Ga0500569_150637 | 3300053109 | Bacteria | 785 |
| 705 | Ga0500655_062479 | 3300053133 | Bacteria | 752 |
| 706 | Ga0500658_0238651 | 3300053134 | Bacteria | 835 |
| 707 | Ga0500559_0063794 | 3300053136 | Bacteria | 1647 |
| 708 | Ga0500568_0043964 | 3300053139 | Unclassified | 1784 |
| 709 | Ga0500573_0131318 | 3300053140 | Bacteria | 1387 |
| 710 | Ga0500588_0001676 | 3300053146 | Bacteria | 4291 |
| 711 | Ga0500588_0025075 | 3300053146 | Bacteria | 1653 |
| 712 | Ga0500589_168170 | 3300053147 | Bacteria | 874 |
| 713 | Ga0500590_251484 | 3300053148 | Bacteria | 702 |
| 714 | Ga0500604_0012513 | 3300053151 | Bacteria | 2291 |
| 715 | Ga0500604_0019789 | 3300053151 | Bacteria | 1889 |
| 716 | Ga0500616_0167768 | 3300053153 | Bacteria | 1000 |
| 717 | Ga0500616_0320113 | 3300053153 | Bacteria | 639 |
| 718 | Ga0500619_064314 | 3300053154 | Bacteria | 1212 |
| 719 | Ga0500636_0251058 | 3300053177 | Bacteria | 902 |
| 720 | Ga0500611_008861 | 3300053727 | Bacteria | 1573 |
| 721 | Ga0500661_048378 | 3300055283 | Bacteria | 758 |
| 722 | Ga0587073_0154144 | 3300059492 | Bacteria | 652 |
| 723 | Ga0587077_126219 | 3300059493 | Bacteria | 644 |
| 724 | Ga0587099_024505 | 3300059622 | Bacteria | 702 |
| 725 | Ga0587109_053307 | 3300059624 | Bacteria | 834 |
| 726 | Ga0587128_026935 | 3300059630 | Unclassified | 925 |
| 727 | Ga0587130_023913 | 3300059631 | Bacteria | 675 |
| 728 | Ga0587062_042940 | 3300059639 | Bacteria | 740 |
| 729 | Ga0587067_043997 | 3300059640 | Unclassified | 878 |
| 730 | Ga0587068_073042 | 3300059641 | Bacteria | 680 |
| 731 | Ga0587081_07056 | 3300060246 | Bacteria | 769 |
| 732 | Ga0587111_0077246 | 3300060346 | Bacteria | 789 |
| 733 | Ga0466962_0001581 | 3300061719 | Bacteria | 10654 |
| 734 | Ga0466962_0397283 | 3300061719 | Bacteria | 690 |
| 735 | Ga0157372_10338726 | |||
| 736 | rootH1_10148307 | |||
| 737 | rootH2_10007161 | |||
| 738 | rootH2_10022399 | |||
| 739 | rootL2_10140308 | |||
| 740 | rootL2_10142273 | |||
| 741 | rootH1_10215893 | |||
| 742 | Ga0065714_10142361 | |||
| 743 | Ga0065715_10494551 | |||
| 744 | Ga0070676_10002584 | |||
| 745 | Ga0070676_10314517 | |||
| 746 | Ga0070676_10441621 | |||
| 747 | Ga0070683_100019393 | |||
| 748 | Ga0070683_100127576 | |||
| 749 | Ga0070690_100034920 | |||
| 750 | Ga0070670_100050768 | |||
| 751 | Ga0070670_100081061 | |||
| 752 | Ga0070670_100770020 | |||
| 753 | Ga0070677_10026720 | |||
| 754 | Ga0070677_10052363 | |||
| 755 | Ga0068869_100059858 | |||
| 756 | Ga0068869_100093585 | |||
| 757 | Ga0068869_100194019 | |||
| 758 | Ga0070666_10000064 | |||
| 759 | Ga0070666_10038711 | |||
| 760 | Ga0070666_10051154 | |||
| 761 | Ga0070680_100080612 | |||
| 762 | Ga0068868_100007677 | |||
| 763 | Ga0068868_100010379 | |||
| 764 | Ga0070660_100039611 | |||
| 765 | Ga0070660_100131668 | |||
| 766 | Ga0070660_100196720 | |||
| 767 | Ga0070660_100244187 | |||
| 768 | Ga0070660_100800973 | |||
| 769 | Ga0070689_100083123 | |||
| 770 | Ga0070689_100146411 | |||
| 771 | Ga0070689_100448810 | |||
| 772 | Ga0070689_100577830 | |||
| 773 | Ga0070691_10264916 | |||
| 774 | Ga0070687_100010996 | |||
| 775 | Ga0070661_100086783 | |||
| 776 | Ga0070661_100397628 | |||
| 777 | Ga0070661_100731109 | |||
| 778 | Ga0070692_10096976 | |||
| 779 | Ga0070668_100061399 | |||
| 780 | Ga0070668_100119474 | |||
| 781 | Ga0070668_100124361 | |||
| 782 | Ga0070669_100135403 | |||
| 783 | Ga0070669_100375292 | |||
| 784 | Ga0070669_100403196 | |||
| 785 | Ga0070669_100510620 | |||
| 786 | Ga0070675_100007473 | |||
| 787 | Ga0070675_100020329 | |||
| 788 | Ga0070675_100100489 | |||
| 789 | Ga0070675_100383148 | |||
| 790 | Ga0070671_100008963 | |||
| 791 | Ga0070671_100125143 | |||
| 792 | Ga0070671_100135819 | |||
| 793 | Ga0070671_100227586 | |||
| 794 | Ga0070674_100381068 | |||
| 795 | Ga0070673_100018983 | |||
| 796 | Ga0070673_100045734 | |||
| 797 | Ga0070673_100160576 | |||
| 798 | Ga0070673_100408699 | |||
| 799 | Ga0070673_100946510 | |||
| 800 | Ga0070688_100103413 | |||
| 801 | Ga0070688_100203423 | |||
| 802 | Ga0070659_100011442 | |||
| 803 | Ga0070659_100019182 | |||
| 804 | Ga0070659_100047005 | |||
| 805 | Ga0070659_100252499 | |||
| 806 | Ga0070659_100377818 | |||
| 807 | Ga0070659_100531182 | |||
| 808 | Ga0070667_100011187 | |||
| 809 | Ga0070667_100033497 | |||
| 810 | Ga0070667_100034808 | |||
| 811 | Ga0070667_100069470 | |||
| 812 | Ga0070667_100242915 | |||
| 813 | Ga0070667_100244245 | |||
| 814 | Ga0070713_100490799 | |||
| 815 | Ga0070705_100468982 | |||
| 816 | Ga0070700_101238320 | |||
| 817 | Ga0070708_100414349 | |||
| 818 | Ga0070663_100073450 | |||
| 819 | Ga0070678_100006906 | |||
| 820 | Ga0070678_100045196 | |||
| 821 | Ga0070678_100181858 | |||
| 822 | Ga0070678_100265992 | |||
| 823 | Ga0070662_101067069 | |||
| 824 | Ga0070681_10109579 | |||
| 825 | Ga0070681_10178456 | |||
| 826 | Ga0070681_10289231 | |||
| 827 | Ga0068867_100029629 | |||
| 828 | Ga0068867_100036451 | |||
| 829 | Ga0068867_100061121 | |||
| 830 | Ga0068867_100152366 | |||
| 831 | Ga0070685_10122612 | |||
| 832 | Ga0070685_10156362 | |||
| 833 | Ga0070707_100299458 | |||
| 834 | Ga0070699_100597896 | |||
| 835 | Ga0070699_100780244 | |||
| 836 | Ga0070679_100155068 | |||
| 837 | Ga0070679_100634391 | |||
| 838 | Ga0070684_100010278 | |||
| 839 | Ga0070684_100126678 | |||
| 840 | Ga0070684_100160370 | |||
| 841 | Ga0068853_100019279 | |||
| 842 | Ga0068853_100024928 | |||
| 843 | Ga0068853_100052022 | |||
| 844 | Ga0068853_100077511 | |||
| 845 | Ga0068853_100190439 | |||
| 846 | Ga0068853_100608342 | |||
| 847 | Ga0070672_100015769 | |||
| 848 | Ga0070672_100042923 | |||
| 849 | Ga0070672_100062607 | |||
| 850 | Ga0070672_100343483 | |||
| 851 | Ga0070672_100678587 | |||
| 852 | Ga0070686_100032168 | |||
| 853 | Ga0070686_100054825 | |||
| 854 | Ga0070686_100587872 | |||
| 855 | Ga0070665_100551597 | |||
| 856 | Ga0070665_101184131 | |||
| 857 | Ga0068855_100012109 | |||
| 858 | Ga0068855_100088858 | |||
| 859 | Ga0068855_100278449 | |||
| 860 | Ga0068855_101488340 | |||
| 861 | Ga0068857_100002898 | |||
| 862 | Ga0068857_100121848 | |||
| 863 | Ga0068857_100571820 | |||
| 864 | Ga0068854_100009648 | |||
| 865 | Ga0068854_100198279 | |||
| 866 | Ga0068854_100533459 | |||
| 867 | Ga0068856_100040323 | |||
| 868 | Ga0068856_100408987 | |||
| 869 | Ga0068852_100001591 | |||
| 870 | Ga0068852_100012585 | |||
| 871 | Ga0068852_100023322 | |||
| 872 | Ga0068852_100034352 | |||
| 873 | Ga0068852_100099067 | |||
| 874 | Ga0068852_100426099 | |||
| 875 | Ga0068859_100000003 | |||
| 876 | Ga0068859_100041491 | |||
| 877 | Ga0068859_100194990 | |||
| 878 | Ga0068859_100906867 | |||
| 879 | Ga0068864_100005097 | |||
| 880 | Ga0068864_100126246 | |||
| 881 | Ga0068864_100767837 | |||
| 882 | Ga0068864_101641445 | |||
| 883 | Ga0068866_10279966 | |||
| 884 | Ga0068861_100079736 | |||
| 885 | Ga0068861_100983883 | |||
| 886 | Ga0068851_10021781 | |||
| 887 | Ga0068851_10116076 | |||
| 888 | Ga0068851_10278214 | |||
| 889 | Ga0068851_10297199 | |||
| 890 | Ga0068870_10021248 | |||
| 891 | Ga0068870_10111411 | |||
| 892 | Ga0068863_100046454 | |||
| 893 | Ga0068863_100057340 | |||
| 894 | Ga0068863_100058046 | |||
| 895 | Ga0068863_101599000 | |||
| 896 | Ga0068858_100002247 | |||
| 897 | Ga0068858_100477571 | |||
| 898 | Ga0068858_101157739 | |||
| 899 | Ga0068860_100000003 | |||
| 900 | Ga0068860_100000922 | |||
| 901 | Ga0068860_100003440 | |||
| 902 | Ga0068860_100023100 | |||
| 903 | Ga0068860_100027499 | |||
| 904 | Ga0068860_100593900 | |||
| 905 | Ga0068862_100351733 | |||
| 906 | Ga0068862_101203640 | |||
| 907 | Ga0075366_10091763 | |||
| 908 | Ga0097621_100026591 | |||
| 909 | Ga0097621_100138287 | |||
| 910 | Ga0097621_100158346 | |||
| 911 | Ga0097621_100211027 | |||
| 912 | Ga0097621_100219110 | |||
| 913 | Ga0097621_100242133 | |||
| 914 | Ga0097621_100409435 | |||
| 915 | Ga0068871_100013185 | |||
| 916 | Ga0068871_100018561 | |||
| 917 | Ga0068871_100026836 | |||
| 918 | Ga0068871_100113278 | |||
| 919 | Ga0068871_100276411 | |||
| 920 | Ga0068871_100346534 | |||
| 921 | Ga0075428_100083609 | |||
| 922 | Ga0075428_100588646 | |||
| 923 | Ga0075431_100005333 | |||
| 924 | Ga0068865_100017354 | |||
| 925 | Ga0068865_100167870 | |||
| 926 | Ga0068865_100168017 | |||
| 927 | Ga0068865_100410993 | |||
| 928 | Ga0068865_100644082 | |||
| 929 | Ga0097620_100000003 | |||
| 930 | Ga0097620_100041490 | |||
| 931 | Ga0097620_100194970 | |||
| 932 | Ga0097620_100906832 | |||
| 933 | Ga0105240_10005046 | |||
| 934 | Ga0105240_10010802 | |||
| 935 | Ga0105240_10037254 | |||
| 936 | Ga0105240_10074008 | |||
| 937 | Ga0105240_10116116 | |||
| 938 | Ga0111539_10030751 | |||
| 939 | Ga0111539_10452587 | |||
| 940 | Ga0105245_10265262 | |||
| 941 | Ga0105247_10094094 | |||
| 942 | Ga0105247_10120246 | |||
| 943 | Ga0114129_10053458 | |||
| 944 | Ga0105243_10209203 | |||
| 945 | Ga0105241_10000543 | |||
| 946 | Ga0105241_10005905 | |||
| 947 | Ga0105241_10058013 | |||
| 948 | Ga0105241_10162841 | |||
| 949 | Ga0105242_10055664 | |||
| 950 | Ga0105242_10178068 | |||
| 951 | Ga0105242_10244250 | |||
| 952 | Ga0105242_10696219 | |||
| 953 | Ga0105242_10818356 | |||
| 954 | Ga0105248_10025753 | |||
| 955 | Ga0105248_10200253 | |||
| 956 | Ga0105237_10000144 | |||
| 957 | Ga0105237_10001993 | |||
| 958 | Ga0105237_10006883 | |||
| 959 | Ga0105237_10009632 | |||
| 960 | Ga0105237_10028528 | |||
| 961 | Ga0105237_10044226 | |||
| 962 | Ga0105237_10194909 | |||
| 963 | Ga0105237_10462293 | |||
| 964 | Ga0105237_10545364 | |||
| 965 | Ga0105237_10730935 | |||
| 966 | Ga0105237_11271910 | |||
| 967 | Ga0105238_10114132 | |||
| 968 | Ga0105238_10319511 | |||
| 969 | Ga0105238_10642642 | |||
| 970 | Ga0105238_10860636 | |||
| 971 | Ga0105249_10011114 | |||
| 972 | Ga0105249_10058402 | |||
| 973 | Ga0105249_10261905 | |||
| 974 | Ga0105239_10000488 | |||
| 975 | Ga0105239_10000925 | |||
| 976 | Ga0105239_10024627 | |||
| 977 | Ga0105239_10091051 | |||
| 978 | Ga0105239_10099620 | |||
| 979 | Ga0105239_10173973 | |||
| 980 | Ga0105239_10427139 | |||
| 981 | Ga0105239_10739892 | |||
| 982 | Ga0105246_10006531 | |||
| 983 | Ga0105246_10059895 | |||
| 984 | Ga0105246_10696054 | |||
| 985 | Ga0157373_10050446 | |||
| 986 | Ga0157373_10136394 | |||
| 987 | Ga0157373_10424115 | |||
| 988 | Ga0157373_10538270 | |||
| 989 | Ga0157371_10035183 | |||
| 990 | Ga0157371_10102061 | |||
| 991 | Ga0157371_10385346 | |||
| 992 | Ga0157371_10430149 | |||
| 993 | Ga0157370_10021933 | |||
| 994 | Ga0157370_10023822 | |||
| 995 | Ga0157370_10065454 | |||
| 996 | Ga0157370_10166787 | |||
| 997 | Ga0157370_10353171 | |||
| 998 | Ga0157370_10389553 | |||
| 999 | Ga0157370_10674300 | |||
| 1000 | Ga0157369_10015498 | |||
| 1001 | Ga0157369_10027496 | |||
| 1002 | Ga0157369_10115382 | |||
| 1003 | Ga0157369_10520744 | |||
| 1004 | Ga0157374_10000013 | |||
| 1005 | Ga0157374_10017547 | |||
| 1006 | Ga0157374_10110213 | |||
| 1007 | Ga0157374_10145499 | |||
| 1008 | Ga0157374_10332914 | |||
| 1009 | Ga0157378_10034604 | |||
| 1010 | Ga0157378_10038252 | |||
| 1011 | Ga0157378_10150594 | |||
| 1012 | Ga0157378_12084047 | |||
| 1013 | Ga0163162_10000253 | |||
| 1014 | Ga0163162_10001229 | |||
| 1015 | Ga0163162_10007984 | |||
| 1016 | Ga0163162_10009127 | |||
| 1017 | Ga0163162_10024760 | |||
| 1018 | Ga0163162_10314484 | |||
| 1019 | Ga0163162_11185762 | |||
| 1020 | Ga0157372_10004419 | |||
| 1021 | Ga0157372_10004778 | |||
| 1022 | Ga0157372_10029858 | |||
| 1023 | Ga0157372_10050322 | |||
| 1024 | Ga0157372_10055189 | |||
| 1025 | Ga0157372_10109539 | |||
| 1026 | Ga0157372_10286395 | |||
| 1027 | Ga0157372_10371445 | |||
| 1028 | Ga0157372_10698759 | |||
| 1029 | Ga0157372_10771460 | |||
| 1030 | Ga0157372_10836045 | |||
| 1031 | Ga0157372_10903328 | |||
| 1032 | Ga0157372_11125747 | |||
| 1033 | Ga0157372_11583697 | |||
| 1034 | Ga0157375_10000422 | |||
| 1035 | Ga0157375_10031081 | |||
| 1036 | Ga0157375_10075044 | |||
| 1037 | Ga0157375_10218582 | |||
| 1038 | Ga0157375_10347506 | |||
| 1039 | Ga0157375_10348819 | |||
| 1040 | Ga0157375_10367677 | |||
| 1041 | Ga0163163_10001496 | |||
| 1042 | Ga0163163_10004119 | |||
| 1043 | Ga0163163_10028299 | |||
| 1044 | Ga0163163_10065372 | |||
| 1045 | Ga0163163_10310861 | |||
| 1046 | Ga0163163_10404031 | |||
| 1047 | Ga0163163_10803621 | |||
| 1048 | Ga0163163_10970266 | |||
| 1049 | Ga0163163_11168118 | |||
| 1050 | Ga0157380_10001771 | |||
| 1051 | Ga0157380_10011391 | |||
| 1052 | Ga0157380_10046227 | |||
| 1053 | Ga0157380_10629489 | |||
| 1054 | Ga0157380_11049558 | |||
| 1055 | Ga0157380_11433910 | |||
| 1056 | Ga0157377_10010186 | |||
| 1057 | Ga0157377_10095251 | |||
| 1058 | Ga0157377_10438605 | |||
| 1059 | Ga0157379_10006012 | |||
| 1060 | Ga0157379_10013492 | |||
| 1061 | Ga0157379_10050043 | |||
| 1062 | Ga0157379_10080957 | |||
| 1063 | Ga0157379_10181170 | |||
| 1064 | Ga0157376_10001313 | |||
| 1065 | Ga0157376_10018142 | |||
| 1066 | Ga0157376_10018439 | |||
| 1067 | Ga0157376_10033468 | |||
| 1068 | Ga0157376_10350619 | |||
| 1069 | Ga0157376_11362639 | |||
| 1070 | Ga0163161_10002701 | |||
| 1071 | Ga0163161_10036635 | |||
| 1072 | Ga0163161_10153052 | |||
| 1073 | Ga0163161_10288247 | |||
| 1074 | Ga0163161_10354781 | |||
| 1075 | Ga0197907_10511360 | |||
| 1076 | Ga0206352_11004656 | |||
| 1077 | Ga0206350_10162210 | |||
| 1078 | Ga0209646_1007831 | |||
| 1079 | Ga0207666_1042856 | |||
| 1080 | Ga0207697_10032830 | |||
| 1081 | Ga0207697_10075258 | |||
| 1082 | Ga0207656_10047186 | |||
| 1083 | Ga0207682_10006837 | |||
| 1084 | Ga0207682_10063915 | |||
| 1085 | Ga0207682_10075863 | |||
| 1086 | Ga0207682_10152211 | |||
| 1087 | Ga0207642_10250461 | |||
| 1088 | Ga0207710_10054535 | |||
| 1089 | Ga0207710_10070967 | |||
| 1090 | Ga0207688_10034169 | |||
| 1091 | Ga0207688_10079716 | |||
| 1092 | Ga0207680_10000054 | |||
| 1093 | Ga0207680_10099815 | |||
| 1094 | Ga0207680_10141780 | |||
| 1095 | Ga0207680_10248323 | |||
| 1096 | Ga0207647_10000064 | |||
| 1097 | Ga0207647_10003263 | |||
| 1098 | Ga0207647_10008387 | |||
| 1099 | Ga0207647_10174890 | |||
| 1100 | Ga0207645_10000352 | |||
| 1101 | Ga0207645_10112575 | |||
| 1102 | Ga0207643_10027738 | |||
| 1103 | Ga0207643_10113336 | |||
| 1104 | Ga0207705_10065461 | |||
| 1105 | Ga0207654_10001121 | |||
| 1106 | Ga0207654_10003601 | |||
| 1107 | Ga0207654_10232166 | |||
| 1108 | Ga0207654_10348665 | |||
| 1109 | Ga0207707_10088343 | |||
| 1110 | Ga0207707_10181623 | |||
| 1111 | Ga0207695_10000056 | |||
| 1112 | Ga0207695_10001122 | |||
| 1113 | Ga0207695_10001317 | |||
| 1114 | Ga0207695_10001383 | |||
| 1115 | Ga0207695_10015819 | |||
| 1116 | Ga0207695_10054760 | |||
| 1117 | Ga0207695_10071354 | |||
| 1118 | Ga0207695_10079185 | |||
| 1119 | Ga0207671_10001689 | |||
| 1120 | Ga0207671_10002585 | |||
| 1121 | Ga0207671_10003111 | |||
| 1122 | Ga0207671_10012969 | |||
| 1123 | Ga0207671_10016185 | |||
| 1124 | Ga0207671_10044863 | |||
| 1125 | Ga0207671_10061597 | |||
| 1126 | Ga0207671_10429961 | |||
| 1127 | Ga0207660_10096729 | |||
| 1128 | Ga0207662_10070492 | |||
| 1129 | Ga0207657_10033042 | |||
| 1130 | Ga0207657_10198499 | |||
| 1131 | Ga0207657_10378679 | |||
| 1132 | Ga0207649_10095654 | |||
| 1133 | Ga0207649_10172496 | |||
| 1134 | Ga0207649_10651184 | |||
| 1135 | Ga0207652_10226420 | |||
| 1136 | Ga0207652_10680372 | |||
| 1137 | Ga0207681_10077005 | |||
| 1138 | Ga0207681_10536743 | |||
| 1139 | Ga0207681_10837024 | |||
| 1140 | Ga0207694_10060486 | |||
| 1141 | Ga0207694_10119359 | |||
| 1142 | Ga0207694_11052315 | |||
| 1143 | Ga0207650_10018897 | |||
| 1144 | Ga0207650_10067533 | |||
| 1145 | Ga0207650_10204764 | |||
| 1146 | Ga0207650_10276199 | |||
| 1147 | Ga0207650_10579361 | |||
| 1148 | Ga0207659_10013556 | |||
| 1149 | Ga0207659_10184807 | |||
| 1150 | Ga0207659_10332966 | |||
| 1151 | Ga0207659_10780781 | |||
| 1152 | Ga0207659_11346805 | |||
| 1153 | Ga0207687_10315357 | |||
| 1154 | Ga0207644_10049783 | |||
| 1155 | Ga0207644_10085796 | |||
| 1156 | Ga0207644_10193366 | |||
| 1157 | Ga0207644_10194340 | |||
| 1158 | Ga0207644_10282153 | |||
| 1159 | Ga0207690_10015227 | |||
| 1160 | Ga0207690_10141315 | |||
| 1161 | Ga0207690_10159314 | |||
| 1162 | Ga0207706_10617107 | |||
| 1163 | Ga0207686_10079447 | |||
| 1164 | Ga0207686_10178649 | |||
| 1165 | Ga0207686_10704682 | |||
| 1166 | Ga0207670_10035867 | |||
| 1167 | Ga0207669_10185902 | |||
| 1168 | Ga0207669_10225503 | |||
| 1169 | Ga0207669_10460782 | |||
| 1170 | Ga0207704_10036624 | |||
| 1171 | Ga0207704_10056617 | |||
| 1172 | Ga0207691_10005099 | |||
| 1173 | Ga0207691_10017616 | |||
| 1174 | Ga0207691_10024317 | |||
| 1175 | Ga0207691_10171699 | |||
| 1176 | Ga0207691_10529598 | |||
| 1177 | Ga0207691_10561829 | |||
| 1178 | Ga0207691_10814508 | |||
| 1179 | Ga0207691_11211432 | |||
| 1180 | Ga0207689_10000337 | |||
| 1181 | Ga0207689_10003324 | |||
| 1182 | Ga0207689_10059536 | |||
| 1183 | Ga0207661_10083293 | |||
| 1184 | Ga0207661_10305716 | |||
| 1185 | Ga0207679_10170845 | |||
| 1186 | Ga0207667_10004402 | |||
| 1187 | Ga0207667_10010335 | |||
| 1188 | Ga0207667_10206295 | |||
| 1189 | Ga0207667_10227636 | |||
| 1190 | Ga0207651_10009029 | |||
| 1191 | Ga0207651_10052009 | |||
| 1192 | Ga0207651_10071439 | |||
| 1193 | Ga0207651_10209932 | |||
| 1194 | Ga0207651_10316254 | |||
| 1195 | Ga0207712_10005606 | |||
| 1196 | Ga0207712_10078718 | |||
| 1197 | Ga0207668_10466938 | |||
| 1198 | Ga0207668_10538802 | |||
| 1199 | Ga0207640_10030773 | |||
| 1200 | Ga0207640_10043608 | |||
| 1201 | Ga0207640_10064775 | |||
| 1202 | Ga0207640_10543385 | |||
| 1203 | Ga0207640_10846660 | |||
| 1204 | Ga0207658_10016928 | |||
| 1205 | Ga0207658_10085598 | |||
| 1206 | Ga0207658_10120149 | |||
| 1207 | Ga0207658_10182831 | |||
| 1208 | Ga0207658_10756524 | |||
| 1209 | Ga0207677_10001184 | |||
| 1210 | Ga0207677_10020347 | |||
| 1211 | Ga0207677_10047442 | |||
| 1212 | Ga0207677_10147398 | |||
| 1213 | Ga0207703_10018354 | |||
| 1214 | Ga0207639_10003376 | |||
| 1215 | Ga0207639_10005516 | |||
| 1216 | Ga0207639_10012234 | |||
| 1217 | Ga0207639_10047321 | |||
| 1218 | Ga0207639_10049107 | |||
| 1219 | Ga0207639_10092994 | |||
| 1220 | Ga0207639_10145648 | |||
| 1221 | Ga0207639_10194828 | |||
| 1222 | Ga0207639_10549310 | |||
| 1223 | Ga0207639_10565444 | |||
| 1224 | Ga0207678_10163164 | |||
| 1225 | Ga0207678_10163319 | |||
| 1226 | Ga0207678_10189342 | |||
| 1227 | Ga0207678_10853090 | |||
| 1228 | Ga0207702_10020706 | |||
| 1229 | Ga0207702_10028278 | |||
| 1230 | Ga0207702_10920178 | |||
| 1231 | Ga0207641_10000026 | |||
| 1232 | Ga0207648_10001428 | |||
| 1233 | Ga0207648_10087264 | |||
| 1234 | Ga0207648_10209801 | |||
| 1235 | Ga0207648_10304236 | |||
| 1236 | Ga0207648_10418865 | |||
| 1237 | Ga0207676_10023052 | |||
| 1238 | Ga0207676_10123693 | |||
| 1239 | Ga0207676_10171220 | |||
| 1240 | Ga0207676_10409887 | |||
| 1241 | Ga0207676_10507695 | |||
| 1242 | Ga0207676_10586145 | |||
| 1243 | Ga0207674_10012728 | |||
| 1244 | Ga0207674_10036451 | |||
| 1245 | Ga0207674_10107502 | |||
| 1246 | Ga0207675_100039383 | |||
| 1247 | Ga0207675_100446592 | |||
| 1248 | Ga0207675_101092334 | |||
| 1249 | Ga0207683_10001458 | |||
| 1250 | Ga0207683_10065455 | |||
| 1251 | Ga0207683_10172343 | |||
| 1252 | Ga0207683_10183521 | |||
| 1253 | Ga0207683_10211141 | |||
| 1254 | Ga0207698_10004047 | |||
| 1255 | Ga0207698_10016155 | |||
| 1256 | Ga0207698_10023910 | |||
| 1257 | Ga0207698_10038711 | |||
| 1258 | Ga0207698_10073503 | |||
| 1259 | Ga0209984_1011145 | |||
| 1260 | Ga0209995_1014031 | |||
| 1261 | Ga0210002_1020593 | |||
| 1262 | Ga0209974_10049027 | |||
| 1263 | Ga0209974_10145073 | |||
| 1264 | Ga0268266_10000169 | |||
| 1265 | Ga0268266_10101400 | |||
| 1266 | Ga0268264_10000063 | |||
| 1267 | Ga0268264_10001200 | |||
| 1268 | Ga0268264_10004205 | |||
| 1269 | Ga0268264_10006017 | |||
| 1270 | Ga0268264_10041768 | |||
| 1271 | Ga0268264_10079293 | |||
| 1272 | Ga0268264_10290277 | |||
| 1273 | Ga0268264_10375142 | |||
| 1274 | Ga0307517_10139002 | |||
| 1275 | Ga0307515_10001389 | |||
| 1276 | Ga0307511_10000409 | |||
| 1277 | Ga0265327_10006319 | |||
| 1278 | Ga0307513_10085521 | |||
| 1279 | Ga0307513_10475437 | |||
| 1280 | Ga0307509_10131040 | |||
| 1281 | Ga0307509_10411529 | |||
| 1282 | Ga0307508_10000485 | |||
| 1283 | Ga0307508_10318065 | |||
| 1284 | Ga0307516_10003090 | |||
| 1285 | Ga0307516_10093156 | |||
| 1286 | Ga0307516_10199285 | |||
| 1287 | Ga0307410_10435550 | |||
| 1288 | Ga0307406_10112818 | |||
| 1289 | Ga0307416_100110558 | |||
| 1290 | Ga0307416_100914187 | |||
| 1291 | Ga0307414_10374611 | |||
| 1292 | Ga0307414_10664091 | |||
| 1293 | Ga0307411_10204649 | |||
| 1294 | Ga0307411_10687572 | |||
| 1295 | Ga0307415_100093430 | |||
| 1296 | Ga0307415_100571597 | |||
| 1297 | Ga0307415_100763073 | |||
| 1298 | Ga0307510_10000156 | |||
| 1299 | Ga0373939_0241877 | |||
| 1300 | Ga0373927_0143992 | |||
| 1301 | Ga0373925_0301651 | |||
| 1302 | Ga0395900_0040184 | |||
| 1303 | Ga0395898_0320103 | |||
| 1304 | Ga0395901_0111267 | |||
| 1305 | Ga0439436_0038066 | |||
| 1306 | Ga0439439_0126279 | |||
| 1307 | Ga0451792_09039 | |||
| 1308 | Ga0451791_0594761 | |||
| 1309 | Ga0451800_1224414 | |||
| 1310 | Ga0451805_092861 | |||
| 1311 | Ga0451833_0563121 | |||
| 1312 | Ga0451841_0486093 | |||
| 1313 | Ga0451849_0231858 | |||
| 1314 | Ga0451849_0981161 | |||
| 1315 | Ga0451850_60345 | |||
| 1316 | Ga0451853_3832616 | |||
| 1317 | Ga0439433_0016269 | |||
| 1318 | Ga0439445_0045264 | |||
| 1319 | Ga0439448_0149498 | |||
| 1320 | Ga0439449_0051924 | |||
| 1321 | Ga0439449_0146400 | |||
| 1322 | Ga0439457_000945 | |||
| 1323 | Ga0451577_0001932 | |||
| 1324 | Ga0451577_0106051 | |||
| 1325 | Ga0466969_0168597 | |||
| 1326 | Ga0466972_0001713 | |||
| 1327 | Ga0466972_0019149 | |||
| 1328 | Ga0466972_0049494 | |||
| 1329 | Ga0466972_0242982 | |||
| 1330 | Ga0453683_0245289 | |||
| 1331 | Ga0453683_0337265 | |||
| 1332 | Ga0466965_0096230 | |||
| 1333 | Ga0466961_0053887 | |||
| 1334 | Ga0453684_0023709 | |||
| 1335 | Ga0453684_0024719 | |||
| 1336 | Ga0453684_0226048 | |||
| 1337 | Ga0453684_0923574 | |||
| 1338 | Ga0466971_0065433 | |||
| 1339 | Ga0466968_0024154 | |||
| 1340 | Ga0466968_0053392 | |||
| 1341 | Ga0466970_0074443 | |||
| 1342 | Ga0466970_0116658 | |||
| 1343 | Ga0466957_0001412 | |||
| 1344 | Ga0466957_0072732 | |||
| 1345 | Ga0466959_0054555 | |||
| 1346 | Ga0451576_0313597 | |||
| 1347 | Ga0466958_0165347 | |||
| 1348 | Ga0495638_0042798 | |||
| 1349 | Ga0495638_0118921 | |||
| 1350 | Ga0495606_0008396 | |||
| 1351 | Ga0495630_0970953 | |||
| 1352 | Ga0495648_0005427 | |||
| 1353 | Ga0495611_0000061 | |||
| 1354 | Ga0495635_0130120 | |||
| 1355 | Ga0495672_0016954 | |||
| 1356 | Ga0495672_0092833 | |||
| 1357 | Ga0495672_0131956 | |||
| 1358 | Ga0495687_001475 | |||
| 1359 | Ga0495686_0000010 | |||
| 1360 | Ga0496100_0188765 | |||
| 1361 | Ga0496102_0941024 | |||
| 1362 | Ga0496104_0544376 | |||
| 1363 | Ga0496106_0446598 | |||
| 1364 | Ga0496114_0126267 | |||
| 1365 | Ga0496115_0182577 | |||
| 1366 | Ga0501308_043395 | |||
| 1367 | Ga0501308_054016 | |||
| 1368 | Ga0501304_024782 | |||
| 1369 | Ga0501305_075692 | |||
| 1370 | Ga0501298_076408 | |||
| 1371 | Ga0501317_045829 | |||
| 1372 | Ga0501327_08393 | |||
| 1373 | Ga0501335_008372 | |||
| 1374 | Ga0501032_0116661 | |||
| 1375 | Ga0501033_0113933 | |||
| 1376 | Ga0501033_0201368 | |||
| 1377 | Ga0501034_0000007 | |||
| 1378 | Ga0501034_0009847 | |||
| 1379 | Ga0501034_0023022 | |||
| 1380 | Ga0501034_0211523 | |||
| 1381 | Ga0501036_0277678 | |||
| 1382 | Ga0501036_0282605 | |||
| 1383 | Ga0501036_0957360 | |||
| 1384 | Ga0501037_0089565 | |||
| 1385 | Ga0501037_0182795 | |||
| 1386 | Ga0501038_0004606 | |||
| 1387 | Ga0501039_0022527 | |||
| 1388 | Ga0501039_0023758 | |||
| 1389 | Ga0501043_0013799 | |||
| 1390 | Ga0501043_0024672 | |||
| 1391 | Ga0501043_0030889 | |||
| 1392 | Ga0501043_0033225 | |||
| 1393 | Ga0501043_0049730 | |||
| 1394 | Ga0501046_0156098 | |||
| 1395 | Ga0501046_0210364 | |||
| 1396 | Ga0501046_0241229 | |||
| 1397 | Ga0501047_0058438 | |||
| 1398 | Ga0501047_0535195 | |||
| 1399 | Ga0501047_0620678 | |||
| 1400 | Ga0501047_0695658 | |||
| 1401 | Ga0501201_008448 | |||
| 1402 | Ga0501202_014928 | |||
| 1403 | Ga0501227_103046 | |||
| 1404 | Ga0501233_069478 | |||
| 1405 | Ga0501240_026182 | |||
| 1406 | Ga0501243_001398 | |||
| 1407 | Ga0501252_007922 | |||
| 1408 | Ga0501257_063921 | |||
| 1409 | Ga0501257_071849 | |||
| 1410 | Ga0501257_101105 | |||
| 1411 | Ga0501259_009713 | |||
| 1412 | Ga0501261_030697 | |||
| 1413 | Ga0501221_017241 | |||
| 1414 | Ga0501225_0001947 | |||
| 1415 | Ga0501245_022368 | |||
| 1416 | Ga0501083_0411517 | |||
| 1417 | Ga0501083_0614166 | |||
| 1418 | Ga0501266_002322 | |||
| 1419 | Ga0501270_045225 | |||
| 1420 | Ga0501035_0266957 | |||
| 1421 | Ga0501044_0060496 | |||
| 1422 | Ga0501044_0105210 | |||
| 1423 | Ga0501044_0158560 | |||
| 1424 | Ga0501044_0357018 | |||
| 1425 | Ga0501284_00001 | |||
| 1426 | nmdc:mga06r32_21132_c1 | |||
| 1427 | nmdc:mga08y16_26956_c1 | |||
| 1428 | Ga0500578_0001290 | |||
| 1429 | Ga0500646_0003313 | |||
| 1430 | Ga0500646_0253714 | |||
| 1431 | Ga0500647_0273419 | |||
| 1432 | Ga0500583_0000019 | |||
| 1433 | Ga0500583_0013004 | |||
| 1434 | Ga0500583_0031093 | |||
| 1435 | Ga0500651_0449276 | |||
| 1436 | Ga0500554_126087 | |||
| 1437 | Ga0500555_061837 | |||
| 1438 | Ga0500569_150637 | |||
| 1439 | Ga0500655_062479 | |||
| 1440 | Ga0500658_0238651 | |||
| 1441 | Ga0500559_0063794 | |||
| 1442 | Ga0500568_0043964 | |||
| 1443 | Ga0500573_0131318 | |||
| 1444 | Ga0500588_0001676 | |||
| 1445 | Ga0500588_0025075 | |||
| 1446 | Ga0500589_168170 | |||
| 1447 | Ga0500590_251484 | |||
| 1448 | Ga0500604_0012513 | |||
| 1449 | Ga0500604_0019789 | |||
| 1450 | Ga0500616_0167768 | |||
| 1451 | Ga0500616_0320113 | |||
| 1452 | Ga0500619_064314 | |||
| 1453 | Ga0500636_0251058 | |||
| 1454 | Ga0500611_008861 | |||
| 1455 | Ga0500661_048378 | |||
| 1456 | Ga0587073_0154144 | |||
| 1457 | Ga0587077_126219 | |||
| 1458 | Ga0587099_024505 | |||
| 1459 | Ga0587109_053307 | |||
| 1460 | Ga0587128_026935 | |||
| 1461 | Ga0587130_023913 | |||
| 1462 | Ga0587062_042940 | |||
| 1463 | Ga0587067_043997 | |||
| 1464 | Ga0587068_073042 | |||
| 1465 | Ga0587081_07056 | |||
| 1466 | Ga0587111_0077246 | |||
| 1467 | Ga0466962_0001581 | |||
| 1468 | Ga0466962_0397283 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4nvs-assembly1.cif.gz_A | crystal structure of the q18cp6_clod6 protein from glyoxalase family. northeast structural genomics consortium target cfr3 | 0.748 | 144 | 179 |
| 1hlv-assembly1.cif.gz_A | crystal structure of cenp-b(1-129) complexed with the cenp-b box dna | 0.7353 | 135 | 181 |
| 8d9l-assembly1.cif.gz_B | cryoem structure of human mettl1-wdr4 in complex with lys-trna and sam | 0.7237 | 23 | 46 |
| 2a6c-assembly1.cif.gz_A | crystal structure of a putative transcriptional regulator (ne_1354) from nitrosomonas europaea at 1.90 a resolution | 0.7214 | 141 | 182 |
| 7cv2-assembly1.cif.gz_A | crystal structure of b. halodurans niar in niacin-bound form | 0.704 | 141 | 179 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1L164_121_266_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8187 | 139 | 179 | 1.10.10.10 |
| 3cloA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.7947 | 144 | 180 | 1.10.10.10 |
| af_Q55BX2_260_507_1.50.10.20 | Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; | 0.7814 | 158 | 183 | 1.50.10.20 |
| 5iydM02 | Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like | 0.7572 | 150 | 179 | 1.10.472.10 |
| 1u3eM01 | Alpha Beta;Alpha-Beta Complex;Homing Intron 3 (I-Ppo) Encoded Endonuclease; Chain A; | 0.7402 | 9 | 123 | 3.90.75.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A522E5Y1-F1-model_v4 | NUMOD4 domain-containing protein | 0.9421 | 1 | 70 |
GO:0016788
|
| AF-A0A522E5Y1-F1-model_v4 | NUMOD4 domain-containing protein | 0.9293 | 1 | 70 |
GO:0016788
|
| AF-A0A0F9FC16-F1-model_v4 | HNH nuclease domain-containing protein | 0.8856 | 25 | 118 |
|
| AF-A0A6P0ZHP4-F1-model_v4 | deleted | 0.8811 | 48 | 116 |
|
| AF-A0A3C1E2S7-F1-model_v4 | deleted | 0.8732 | 42 | 116 |
|