F478142

General Info

Members Datasets Scaffolds Average Seq Length
734 237 1468 492

Family's Representative Sequence

Representative Sequence 3300025292|Ga0209676_1000273|Ga0209676_100027381
Length 519
Sequence VSAAGAQRAGNEGHSSTILTGTTLLLAGVVLAVSNFMVVLDTTIANVSVAHIAGGLGISSSEGTWVITSYAVAEAICVPLTGWLSRRLGTVKLFAGGMLGFGIFSFLCGTATSLTMLIAFRIGQGICGGPLMALSQTLLLRVFPKDKHAMTMGIWAMTTLTAPIFGPILGGTISDSWGWHWIFFINVPVAAICAFTAWTVLRKAETEKVSEPVDGFGLVLLVLWVGALQLMLDLGREHDWFSADIIIQLAIIAIVGFASFLIWELTADKPVVDLRPFRHRGFTVSVIALVFAYGTFFASLVVIPQWLQGAMGYTATWAGYATAFNGVAAVLMAPIVAKRMTEVDPRRLVFIGVLWLAGTSLLRVFWWNSGSDFWTLALPQLIQGAGMPFFFVPLTTIALGAVDEEETASAAGVMNFLRTMAGAVAVAISTTLWYDGAQEKRDGLSGVLHGTQAAIDGMMAKGYSLEQARLIVSQMVDKEATALATGQTFVWAAFVFAAAASIIWLAPRPTRAVDTSSVH

Samples

Sample ID Description Type Environment
1 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
104 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
105 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
180 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
183 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
184 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
209 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
227 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
231 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3
Nodule 0
Rhizoplane 2.45
Rhizosphere 93.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209676_1000273 3300025292 Bacteria 107724
2 JGI24736J21556_1001268 3300001904 Bacteria 4640
3 JGI24736J21556_1002566 3300001904 Bacteria 3200
4 JGI24741J21665_1008183 3300001915 Bacteria 1985
5 JGI24740J21852_10000395 3300001979 Bacteria 18718
6 JGI24740J21852_10023866 3300001979 Bacteria 2082
7 JGI24740J21852_10025113 3300001979 Bacteria 2013
8 JGI24739J22299_10001257 3300001989 Bacteria 9505
9 JGI24739J22299_10015261 3300001989 Bacteria 2790
10 JGI24739J22299_10018892 3300001989 Bacteria 2472
11 JGI24737J22298_10000051 3300001990 Bacteria 34099
12 JGI24737J22298_10000165 3300001990 Bacteria 21156
13 JGI24737J22298_10004914 3300001990 Bacteria 4634
14 JGI24743J22301_10004952 3300001991 Bacteria 2197
15 JGI24735J21928_10002842 3300002067 Bacteria 5972
16 JGI24750J21931_1000372 3300002070 Bacteria 7592
17 JGI24748J21848_1000049 3300002074 Bacteria 56032
18 JGI24738J21930_10000027 3300002075 Bacteria 27178
19 JGI24738J21930_10004118 3300002075 Bacteria 3589
20 JGI24749J21850_1000068 3300002076 Bacteria 18789
21 JGI24744J21845_10002683 3300002077 Bacteria 3628
22 JGI24034J26672_10000033 3300002239 Bacteria 88341
23 JGI24751J29686_10000400 3300002459 Bacteria 14104
24 JGI24751J29686_10003332 3300002459 Bacteria 3239
25 rootH2_10040129 3300003320 Bacteria 3170
26 Ga0055531_10000021 3300003794 Bacteria 167213
27 Ga0065707_10082133 3300005295 Bacteria 21190
28 Ga0065707_10089113 3300005295 Bacteria 4466
29 Ga0065707_10096768 3300005295 Bacteria 3235
30 Ga0070658_10004633 3300005327 Bacteria 11178
31 Ga0070658_10033056 3300005327 Bacteria 4160
32 Ga0070658_10052651 3300005327 Bacteria 3302
33 Ga0070658_10055565 3300005327 Bacteria 3216
34 Ga0070658_10112571 3300005327 Bacteria 2256
35 Ga0070658_10131856 3300005327 Bacteria 2083
36 Ga0070676_10004834 3300005328 Bacteria 7128
37 Ga0070676_10043886 3300005328 Bacteria 2600
38 Ga0070683_100020582 3300005329 Bacteria 5871
39 Ga0070683_100206723 3300005329 Bacteria 1865
40 Ga0070690_100000014 3300005330 Bacteria 87494
41 Ga0070690_100013207 3300005330 Bacteria 4876
42 Ga0070670_100000047 3300005331 Bacteria 136625
43 Ga0070670_100006640 3300005331 Bacteria 9806
44 Ga0070670_100012044 3300005331 Bacteria 7399
45 Ga0070670_100117212 3300005331 Bacteria 2297
46 Ga0070670_100129327 3300005331 Bacteria 2180
47 Ga0070677_10000829 3300005333 Bacteria 10143
48 Ga0068869_100001996 3300005334 Bacteria 12259
49 Ga0070666_10000027 3300005335 Bacteria 151010
50 Ga0070666_10024010 3300005335 Bacteria 3970
51 Ga0070666_10053109 3300005335 Bacteria 2732
52 Ga0070666_10057578 3300005335 Bacteria 2626
53 Ga0070666_10059332 3300005335 Bacteria 2588
54 Ga0070680_100007272 3300005336 Bacteria 8438
55 Ga0070682_100016005 3300005337 Bacteria 4355
56 Ga0070682_100103904 3300005337 Bacteria 1881
57 Ga0068868_100020578 3300005338 Bacteria 4960
58 Ga0068868_100032545 3300005338 Bacteria 4012
59 Ga0070660_100000767 3300005339 Bacteria 21303
60 Ga0070660_100021183 3300005339 Bacteria 4790
61 Ga0070660_100023164 3300005339 Bacteria 4599
62 Ga0070660_100038535 3300005339 Bacteria 3629
63 Ga0070660_100075152 3300005339 Bacteria 2645
64 Ga0070689_100001657 3300005340 Bacteria 14241
65 Ga0070689_100050373 3300005340 Bacteria 3217
66 Ga0070691_10003231 3300005341 Bacteria 7305
67 Ga0070661_100006327 3300005344 Bacteria 8169
68 Ga0070661_100007808 3300005344 Bacteria 7385
69 Ga0070661_100014597 3300005344 Bacteria 5538
70 Ga0070661_100024568 3300005344 Bacteria 4322
71 Ga0070661_100032766 3300005344 Bacteria 3762
72 Ga0070661_100043650 3300005344 Bacteria 3275
73 Ga0070668_100006365 3300005347 Bacteria 8747
74 Ga0070668_100018826 3300005347 Bacteria 5187
75 Ga0070668_100033901 3300005347 Bacteria 3890
76 Ga0070668_100072193 3300005347 Bacteria 2689
77 Ga0070668_100123140 3300005347 Bacteria 2075
78 Ga0070669_100000099 3300005353 Bacteria 85328
79 Ga0070669_100000162 3300005353 Bacteria 58781
80 Ga0070669_100000699 3300005353 Bacteria 24602
81 Ga0070669_100005466 3300005353 Bacteria 9170
82 Ga0070669_100014681 3300005353 Bacteria 5575
83 Ga0070675_100003584 3300005354 Bacteria 11805
84 Ga0070675_100012015 3300005354 Bacteria 6788
85 Ga0070675_100149121 3300005354 Bacteria 2004
86 Ga0070671_100003886 3300005355 Bacteria 11743
87 Ga0070671_100007605 3300005355 Bacteria 8666
88 Ga0070671_100018586 3300005355 Bacteria 5647
89 Ga0070671_100018748 3300005355 Bacteria 5624
90 Ga0070671_100022038 3300005355 Bacteria 5204
91 Ga0070671_100022628 3300005355 Bacteria 5134
92 Ga0070671_100107298 3300005355 Bacteria 2345
93 Ga0070674_100003989 3300005356 Bacteria 8364
94 Ga0070674_100028068 3300005356 Bacteria 3694
95 Ga0070673_100003743 3300005364 Bacteria 9537
96 Ga0070673_100009898 3300005364 Bacteria 6423
97 Ga0070673_100072205 3300005364 Bacteria 2775
98 Ga0070659_100000753 3300005366 Bacteria 23494
99 Ga0070659_100027561 3300005366 Bacteria 4379
100 Ga0070659_100030220 3300005366 Bacteria 4191
101 Ga0070659_100036766 3300005366 Bacteria 3817
102 Ga0070659_100044578 3300005366 Bacteria 3473
103 Ga0070659_100051876 3300005366 Bacteria 3225
104 Ga0070667_100001558 3300005367 Bacteria 20556
105 Ga0070667_100001726 3300005367 Bacteria 19526
106 Ga0070667_100004197 3300005367 Bacteria 12165
107 Ga0070667_100006262 3300005367 Bacteria 9895
108 Ga0070667_100026747 3300005367 Bacteria 4800
109 Ga0070714_100041839 3300005435 Bacteria 3868
110 Ga0070714_100096013 3300005435 Bacteria 2604
111 Ga0070694_100041086 3300005444 Bacteria 3083
112 Ga0070663_100007411 3300005455 Bacteria 6676
113 Ga0070663_100048258 3300005455 Bacteria 3018
114 Ga0070663_100066749 3300005455 Bacteria 2607
115 Ga0070663_100083195 3300005455 Bacteria 2356
116 Ga0070678_100013659 3300005456 Bacteria 5101
117 Ga0070662_100002248 3300005457 Bacteria 11841
118 Ga0070662_100032902 3300005457 Bacteria 3648
119 Ga0070662_100034495 3300005457 Bacteria 3568
120 Ga0070662_100115658 3300005457 Bacteria 2049
121 Ga0068867_100011915 3300005459 Bacteria 6142
122 Ga0070685_10000101 3300005466 Bacteria 54043
123 Ga0068853_100006221 3300005539 Bacteria 9456
124 Ga0068853_100007344 3300005539 Bacteria 8818
125 Ga0068853_100036633 3300005539 Bacteria 4173
126 Ga0068853_100094723 3300005539 Bacteria 2631
127 Ga0070672_100000234 3300005543 Bacteria 31015
128 Ga0070672_100001207 3300005543 Bacteria 15822
129 Ga0070672_100155391 3300005543 Bacteria 1894
130 Ga0070686_100000010 3300005544 Bacteria 192116
131 Ga0070665_100000254 3300005548 Bacteria 88587
132 Ga0070665_100003744 3300005548 Bacteria 16104
133 Ga0070665_100011289 3300005548 Bacteria 9034
134 Ga0070665_100016958 3300005548 Bacteria 7303
135 Ga0070665_100018536 3300005548 Bacteria 6975
136 Ga0070665_100030502 3300005548 Bacteria 5424
137 Ga0070665_100097864 3300005548 Bacteria 2939
138 Ga0070665_100177255 3300005548 Bacteria 2132
139 Ga0068855_100001164 3300005563 Bacteria 32603
140 Ga0068855_100001723 3300005563 Bacteria 27344
141 Ga0068855_100003156 3300005563 Bacteria 20171
142 Ga0068855_100056306 3300005563 Bacteria 4614
143 Ga0070664_100002457 3300005564 Bacteria 14923
144 Ga0070664_100002747 3300005564 Bacteria 14203
145 Ga0070664_100007368 3300005564 Bacteria 8872
146 Ga0070664_100007907 3300005564 Bacteria 8589
147 Ga0070664_100040646 3300005564 Bacteria 3921
148 Ga0068857_100003650 3300005577 Bacteria 12902
149 Ga0068857_100004327 3300005577 Bacteria 11979
150 Ga0068857_100005444 3300005577 Bacteria 10855
151 Ga0068857_100007919 3300005577 Bacteria 9169
152 Ga0068857_100013071 3300005577 Bacteria 7233
153 Ga0068857_100037783 3300005577 Bacteria 4278
154 Ga0068857_100064545 3300005577 Bacteria 3256
155 Ga0068857_100084161 3300005577 Bacteria 2842
156 Ga0068854_100000061 3300005578 Bacteria 78663
157 Ga0068854_100001151 3300005578 Bacteria 15907
158 Ga0068854_100004904 3300005578 Bacteria 8442
159 Ga0068854_100005672 3300005578 Bacteria 7888
160 Ga0068854_100010327 3300005578 Bacteria 6050
161 Ga0068854_100025690 3300005578 Bacteria 4041
162 Ga0068854_100027723 3300005578 Bacteria 3907
163 Ga0068854_100076804 3300005578 Bacteria 2456
164 Ga0068856_100000449 3300005614 Bacteria 45445
165 Ga0068856_100004411 3300005614 Bacteria 14026
166 Ga0068856_100046595 3300005614 Bacteria 4270
167 Ga0068856_100058084 3300005614 Bacteria 3821
168 Ga0068856_100090626 3300005614 Bacteria 3041
169 Ga0068852_100000847 3300005616 Bacteria 20320
170 Ga0068852_100001197 3300005616 Bacteria 17227
171 Ga0068852_100013939 3300005616 Bacteria 6165
172 Ga0068852_100024513 3300005616 Bacteria 4877
173 Ga0068859_100000324 3300005617 Bacteria 47483
174 Ga0068859_100003001 3300005617 Bacteria 17114
175 Ga0068859_100011614 3300005617 Bacteria 8858
176 Ga0068859_100024123 3300005617 Bacteria 6104
177 Ga0068859_100024318 3300005617 Bacteria 6079
178 Ga0068859_100025027 3300005617 Bacteria 5992
179 Ga0068859_100037329 3300005617 Bacteria 4876
180 Ga0068859_100069451 3300005617 Bacteria 3558
181 Ga0068859_100086978 3300005617 Bacteria 3172
182 Ga0068859_100101242 3300005617 Bacteria 2938
183 Ga0068864_100000051 3300005618 Bacteria 136621
184 Ga0068864_100000743 3300005618 Bacteria 27310
185 Ga0068864_100002131 3300005618 Bacteria 16369
186 Ga0068864_100002488 3300005618 Bacteria 15223
187 Ga0068864_100007461 3300005618 Bacteria 9008
188 Ga0068864_100024966 3300005618 Bacteria 5029
189 Ga0068864_100118777 3300005618 Bacteria 2361
190 Ga0068861_100011286 3300005719 Bacteria 6204
191 Ga0068861_100023488 3300005719 Bacteria 4448
192 Ga0068861_100066733 3300005719 Bacteria 2774
193 Ga0068861_100072992 3300005719 Bacteria 2664
194 Ga0068851_10014735 3300005834 Bacteria 3716
195 Ga0068851_10019078 3300005834 Bacteria 3313
196 Ga0068851_10022284 3300005834 Bacteria 3083
197 Ga0068863_100000214 3300005841 Bacteria 62106
198 Ga0068863_100006673 3300005841 Bacteria 11329
199 Ga0068863_100007339 3300005841 Bacteria 10790
200 Ga0068863_100069572 3300005841 Bacteria 3328
201 Ga0068858_100001674 3300005842 Bacteria 22661
202 Ga0068858_100006175 3300005842 Bacteria 11685
203 Ga0068858_100006917 3300005842 Bacteria 11021
204 Ga0068858_100007137 3300005842 Bacteria 10853
205 Ga0068858_100007575 3300005842 Bacteria 10488
206 Ga0068858_100024881 3300005842 Bacteria 5574
207 Ga0068858_100037115 3300005842 Bacteria 4517
208 Ga0068858_100038487 3300005842 Bacteria 4436
209 Ga0068858_100040082 3300005842 Bacteria 4343
210 Ga0068858_100051634 3300005842 Bacteria 3804
211 Ga0068860_100000080 3300005843 Bacteria 170152
212 Ga0068860_100000353 3300005843 Bacteria 61803
213 Ga0068860_100009742 3300005843 Bacteria 9538
214 Ga0068860_100011757 3300005843 Bacteria 8626
215 Ga0068860_100014764 3300005843 Bacteria 7639
216 Ga0068860_100032025 3300005843 Bacteria 5055
217 Ga0068860_100059152 3300005843 Bacteria 3644
218 Ga0068860_100107896 3300005843 Bacteria 2661
219 Ga0068860_100222950 3300005843 Bacteria 1831
220 Ga0068862_100000036 3300005844 Bacteria 173453
221 Ga0068862_100000198 3300005844 Bacteria 66534
222 Ga0068862_100000357 3300005844 Bacteria 49510
223 Ga0068862_100018625 3300005844 Bacteria 5784
224 Ga0068862_100023491 3300005844 Bacteria 5167
225 Ga0068862_100028554 3300005844 Bacteria 4699
226 Ga0068862_100035008 3300005844 Bacteria 4250
227 Ga0068862_100048188 3300005844 Bacteria 3638
228 Ga0068862_100076145 3300005844 Bacteria 2904
229 Ga0081455_10000564 3300005937 Bacteria 48268
230 Ga0081455_10004231 3300005937 Bacteria 16183
231 Ga0081455_10065401 3300005937 Bacteria 3041
232 Ga0081539_10058522 3300005985 Bacteria 2126
233 Ga0075366_10007553 3300006195 Bacteria 6013
234 Ga0097621_100020152 3300006237 Bacteria 5135
235 Ga0097621_100034584 3300006237 Bacteria 4032
236 Ga0097621_100120820 3300006237 Bacteria 2222
237 Ga0097621_100123826 3300006237 Bacteria 2195
238 Ga0075370_10004706 3300006353 Bacteria 6665
239 Ga0075370_10007682 3300006353 Bacteria 5506
240 Ga0068871_100057229 3300006358 Bacteria 3171
241 Ga0075431_100123846 3300006847 Bacteria 2667
242 Ga0068865_100000434 3300006881 Bacteria 23266
243 Ga0068865_100011662 3300006881 Bacteria 5506
244 Ga0068865_100028784 3300006881 Bacteria 3680
245 Ga0097620_100000324 3300006931 Bacteria 47483
246 Ga0097620_100003001 3300006931 Bacteria 17114
247 Ga0097620_100011614 3300006931 Bacteria 8858
248 Ga0097620_100024122 3300006931 Bacteria 6104
249 Ga0097620_100024317 3300006931 Bacteria 6079
250 Ga0097620_100025028 3300006931 Bacteria 5992
251 Ga0097620_100037328 3300006931 Bacteria 4876
252 Ga0097620_100069449 3300006931 Bacteria 3558
253 Ga0097620_100086981 3300006931 Bacteria 3172
254 Ga0097620_100101251 3300006931 Bacteria 2938
255 Ga0105251_10043986 3300009011 Bacteria 2160
256 Ga0105240_10003880 3300009093 Bacteria 23090
257 Ga0105240_10066649 3300009093 Bacteria 4465
258 Ga0105240_10102679 3300009093 Bacteria 3474
259 Ga0105240_10184912 3300009093 Bacteria 2455
260 Ga0105240_10188228 3300009093 Bacteria 2429
261 Ga0105240_10200736 3300009093 Bacteria 2337
262 Ga0105240_10205940 3300009093 Bacteria 2303
263 Ga0105245_10000424 3300009098 Bacteria 39397
264 Ga0105245_10048655 3300009098 Bacteria 3793
265 Ga0105245_10222158 3300009098 Bacteria 1823
266 Ga0105247_10030004 3300009101 Bacteria 3297
267 Ga0105243_10031215 3300009148 Bacteria 4107
268 Ga0105241_10166782 3300009174 Bacteria 1815
269 Ga0105242_10083959 3300009176 Bacteria 2668
270 Ga0105248_10000123 3300009177 Bacteria 89301
271 Ga0105248_10000159 3300009177 Bacteria 78504
272 Ga0105248_10000407 3300009177 Bacteria 49981
273 Ga0105248_10024980 3300009177 Bacteria 6640
274 Ga0105248_10031334 3300009177 Bacteria 5943
275 Ga0105248_10105654 3300009177 Bacteria 3175
276 Ga0105248_10119460 3300009177 Bacteria 2973
277 Ga0105237_10003982 3300009545 Bacteria 17262
278 Ga0105237_10018540 3300009545 Bacteria 7202
279 Ga0105237_10144916 3300009545 Bacteria 2370
280 Ga0105237_10159970 3300009545 Bacteria 2250
281 Ga0105237_10225391 3300009545 Bacteria 1875
282 Ga0105238_10018232 3300009551 Bacteria 7139
283 Ga0105238_10052066 3300009551 Bacteria 4116
284 Ga0105238_10053533 3300009551 Bacteria 4055
285 Ga0105238_10069566 3300009551 Bacteria 3520
286 Ga0105238_10096252 3300009551 Bacteria 2946
287 Ga0105238_10145698 3300009551 Bacteria 2345
288 Ga0105249_10000015 3300009553 Bacteria 282138
289 Ga0105249_10000064 3300009553 Bacteria 151646
290 Ga0105249_10011234 3300009553 Bacteria 7862
291 Ga0105249_10019672 3300009553 Bacteria 6026
292 Ga0105239_10002388 3300010375 Bacteria 23941
293 Ga0105239_10019413 3300010375 Bacteria 7505
294 Ga0105239_10051754 3300010375 Bacteria 4502
295 Ga0105239_10114796 3300010375 Bacteria 2987
296 Ga0105239_10153247 3300010375 Bacteria 2573
297 Ga0105239_10265085 3300010375 Bacteria 1931
298 Ga0105246_10003940 3300011119 Bacteria 8995
299 Ga0157373_10012675 3300013100 Bacteria 6197
300 Ga0157371_10003598 3300013102 Bacteria 13964
301 Ga0157371_10013675 3300013102 Bacteria 6157
302 Ga0157370_10005586 3300013104 Bacteria 14085
303 Ga0157370_10014806 3300013104 Bacteria 7959
304 Ga0157370_10027355 3300013104 Bacteria 5624
305 Ga0157370_10030792 3300013104 Bacteria 5255
306 Ga0157370_10054688 3300013104 Bacteria 3805
307 Ga0157370_10092659 3300013104 Bacteria 2836
308 Ga0157370_10232362 3300013104 Bacteria 1706
309 Ga0157369_10000385 3300013105 Bacteria 58590
310 Ga0157369_10012084 3300013105 Bacteria 9804
311 Ga0157369_10016507 3300013105 Bacteria 8303
312 Ga0157369_10034107 3300013105 Bacteria 5588
313 Ga0157378_10000018 3300013297 Bacteria 134075
314 Ga0157378_10006264 3300013297 Bacteria 10415
315 Ga0157378_10022160 3300013297 Bacteria 5590
316 Ga0157378_10083214 3300013297 Bacteria 2895
317 Ga0163162_10002274 3300013306 Bacteria 18032
318 Ga0163162_10013200 3300013306 Bacteria 8067
319 Ga0163162_10058690 3300013306 Bacteria 3878
320 Ga0163162_10187894 3300013306 Bacteria 2193
321 Ga0157372_10061043 3300013307 Bacteria 4220
322 Ga0157372_10068118 3300013307 Bacteria 4002
323 Ga0157372_10099151 3300013307 Bacteria 3323
324 Ga0157372_10180763 3300013307 Bacteria 2442
325 Ga0157372_10188569 3300013307 Bacteria 2388
326 Ga0157375_10064297 3300013308 Bacteria 3653
327 Ga0157375_10081028 3300013308 Bacteria 3285
328 Ga0163163_10000265 3300014325 Bacteria 52453
329 Ga0163163_10013362 3300014325 Bacteria 7515
330 Ga0163163_10103722 3300014325 Bacteria 2868
331 Ga0157380_10000332 3300014326 Bacteria 28459
332 Ga0157379_10001201 3300014968 Bacteria 21082
333 Ga0157379_10015227 3300014968 Bacteria 6744
334 Ga0157376_10044100 3300014969 Bacteria 3664
335 Ga0163161_10000110 3300017792 Bacteria 78102
336 Ga0207672_1000729 3300025223 Bacteria 3662
337 Ga0209759_1011916 3300025256 Bacteria 2438
338 Ga0209676_1009644 3300025292 Bacteria 4137
339 Ga0209025_1020025 3300025294 Bacteria 3683
340 Ga0209051_1004538 3300025303 Bacteria 8511
341 Ga0209051_1009617 3300025303 Bacteria 4964
342 Ga0209257_1000032 3300025304 Bacteria 680354
343 Ga0209257_1000458 3300025304 Bacteria 75709
344 Ga0207697_10002358 3300025315 Bacteria 9839
345 Ga0207697_10002531 3300025315 Bacteria 9422
346 Ga0207656_10019188 3300025321 Bacteria 2703
347 Ga0207682_10003777 3300025893 Bacteria 6502
348 Ga0207710_10014589 3300025900 Bacteria 3316
349 Ga0207688_10000018 3300025901 Bacteria 51641
350 Ga0207688_10024275 3300025901 Bacteria 3324
351 Ga0207688_10026512 3300025901 Bacteria 3187
352 Ga0207680_10000009 3300025903 Bacteria 464571
353 Ga0207680_10012998 3300025903 Bacteria 4259
354 Ga0207647_10000232 3300025904 Bacteria 46114
355 Ga0207647_10000333 3300025904 Bacteria 38836
356 Ga0207647_10001648 3300025904 Bacteria 17173
357 Ga0207647_10013372 3300025904 Bacteria 5693
358 Ga0207647_10014933 3300025904 Bacteria 5336
359 Ga0207647_10021572 3300025904 Bacteria 4298
360 Ga0207647_10024185 3300025904 Bacteria 4007
361 Ga0207647_10033137 3300025904 Bacteria 3311
362 Ga0207647_10056231 3300025904 Bacteria 2414
363 Ga0207645_10008012 3300025907 Bacteria 7410
364 Ga0207645_10082577 3300025907 Bacteria 2060
365 Ga0207643_10055164 3300025908 Bacteria 2259
366 Ga0207705_10000059 3300025909 Bacteria 155683
367 Ga0207705_10001692 3300025909 Bacteria 17538
368 Ga0207705_10016137 3300025909 Bacteria 5360
369 Ga0207705_10089454 3300025909 Bacteria 2253
370 Ga0207654_10008896 3300025911 Bacteria 5093
371 Ga0207654_10027098 3300025911 Bacteria 3112
372 Ga0207654_10079171 3300025911 Bacteria 1974
373 Ga0207695_10011197 3300025913 Bacteria 10882
374 Ga0207695_10021396 3300025913 Bacteria 7378
375 Ga0207695_10048837 3300025913 Bacteria 4466
376 Ga0207671_10000841 3300025914 Bacteria 38929
377 Ga0207671_10033115 3300025914 Bacteria 3846
378 Ga0207671_10071063 3300025914 Bacteria 2596
379 Ga0207657_10003142 3300025919 Bacteria 17669
380 Ga0207657_10004185 3300025919 Bacteria 15290
381 Ga0207657_10008595 3300025919 Bacteria 10342
382 Ga0207657_10008817 3300025919 Bacteria 10202
383 Ga0207657_10009428 3300025919 Bacteria 9811
384 Ga0207657_10030517 3300025919 Bacteria 4892
385 Ga0207657_10051528 3300025919 Bacteria 3578
386 Ga0207657_10066083 3300025919 Bacteria 3080
387 Ga0207649_10004902 3300025920 Bacteria 7238
388 Ga0207649_10008761 3300025920 Bacteria 5523
389 Ga0207649_10017197 3300025920 Bacteria 4097
390 Ga0207649_10030987 3300025920 Bacteria 3174
391 Ga0207681_10000003 3300025923 Bacteria 713245
392 Ga0207681_10001180 3300025923 Bacteria 16821
393 Ga0207681_10001989 3300025923 Bacteria 13129
394 Ga0207694_10002118 3300025924 Bacteria 16344
395 Ga0207694_10005478 3300025924 Bacteria 9751
396 Ga0207694_10023373 3300025924 Bacteria 4692
397 Ga0207694_10038326 3300025924 Bacteria 3685
398 Ga0207694_10103667 3300025924 Bacteria 2256
399 Ga0207650_10000038 3300025925 Bacteria 206081
400 Ga0207650_10014405 3300025925 Bacteria 5497
401 Ga0207650_10032714 3300025925 Bacteria 3763
402 Ga0207650_10099346 3300025925 Bacteria 2237
403 Ga0207659_10007405 3300025926 Bacteria 6746
404 Ga0207687_10012203 3300025927 Bacteria 5619
405 Ga0207664_10033267 3300025929 Bacteria 3959
406 Ga0207644_10000512 3300025931 Bacteria 25021
407 Ga0207644_10007430 3300025931 Bacteria 7142
408 Ga0207644_10013409 3300025931 Bacteria 5462
409 Ga0207644_10016807 3300025931 Bacteria 4928
410 Ga0207644_10041587 3300025931 Bacteria 3252
411 Ga0207690_10014349 3300025932 Bacteria 4786
412 Ga0207706_10000171 3300025933 Bacteria 72122
413 Ga0207706_10002226 3300025933 Bacteria 18934
414 Ga0207706_10002480 3300025933 Bacteria 17985
415 Ga0207706_10006168 3300025933 Bacteria 11130
416 Ga0207706_10019005 3300025933 Bacteria 6181
417 Ga0207706_10046960 3300025933 Bacteria 3822
418 Ga0207706_10111062 3300025933 Bacteria 2412
419 Ga0207686_10071119 3300025934 Bacteria 2238
420 Ga0207709_10028961 3300025935 Bacteria 3206
421 Ga0207709_10054348 3300025935 Bacteria 2469
422 Ga0207670_10022219 3300025936 Bacteria 3929
423 Ga0207669_10050360 3300025937 Bacteria 2489
424 Ga0207704_10001207 3300025938 Bacteria 11520
425 Ga0207704_10067513 3300025938 Bacteria 2250
426 Ga0207691_10000070 3300025940 Bacteria 84000
427 Ga0207691_10000442 3300025940 Bacteria 41154
428 Ga0207691_10012078 3300025940 Bacteria 8282
429 Ga0207691_10034316 3300025940 Bacteria 4718
430 Ga0207711_10000100 3300025941 Bacteria 91024
431 Ga0207711_10000607 3300025941 Bacteria 36172
432 Ga0207711_10002610 3300025941 Bacteria 16002
433 Ga0207711_10009352 3300025941 Bacteria 8184
434 Ga0207711_10012993 3300025941 Bacteria 6918
435 Ga0207711_10059979 3300025941 Bacteria 3277
436 Ga0207711_10086011 3300025941 Bacteria 2756
437 Ga0207689_10000123 3300025942 Bacteria 64762
438 Ga0207689_10008724 3300025942 Bacteria 8822
439 Ga0207689_10017657 3300025942 Bacteria 6030
440 Ga0207679_10002516 3300025945 Bacteria 11298
441 Ga0207679_10017882 3300025945 Bacteria 4739
442 Ga0207679_10132261 3300025945 Bacteria 2003
443 Ga0207667_10000017 3300025949 Bacteria 390654
444 Ga0207667_10000503 3300025949 Bacteria 51606
445 Ga0207667_10011731 3300025949 Bacteria 10164
446 Ga0207667_10021710 3300025949 Bacteria 7112
447 Ga0207667_10030020 3300025949 Bacteria 5887
448 Ga0207667_10048962 3300025949 Bacteria 4466
449 Ga0207667_10094862 3300025949 Bacteria 3080
450 Ga0207651_10000332 3300025960 Bacteria 20079
451 Ga0207651_10033606 3300025960 Bacteria 3310
452 Ga0207651_10081205 3300025960 Bacteria 2336
453 Ga0207712_10000023 3300025961 Bacteria 282081
454 Ga0207712_10000044 3300025961 Bacteria 171240
455 Ga0207712_10000873 3300025961 Bacteria 21920
456 Ga0207668_10002284 3300025972 Bacteria 11190
457 Ga0207668_10006304 3300025972 Bacteria 7012
458 Ga0207668_10067676 3300025972 Bacteria 2536
459 Ga0207640_10002840 3300025981 Bacteria 9291
460 Ga0207640_10006873 3300025981 Bacteria 6257
461 Ga0207640_10034778 3300025981 Bacteria 3147
462 Ga0207640_10035086 3300025981 Bacteria 3136
463 Ga0207640_10048529 3300025981 Bacteria 2745
464 Ga0207640_10070849 3300025981 Bacteria 2346
465 Ga0207640_10099237 3300025981 Bacteria 2038
466 Ga0207640_10113553 3300025981 Bacteria 1925
467 Ga0207658_10000592 3300025986 Bacteria 32483
468 Ga0207658_10001131 3300025986 Bacteria 21482
469 Ga0207658_10001592 3300025986 Bacteria 17502
470 Ga0207658_10048397 3300025986 Bacteria 3117
471 Ga0207658_10052764 3300025986 Bacteria 3001
472 Ga0207677_10016237 3300026023 Bacteria 4403
473 Ga0207677_10070670 3300026023 Bacteria 2461
474 Ga0207703_10001186 3300026035 Bacteria 24509
475 Ga0207703_10002719 3300026035 Bacteria 15153
476 Ga0207703_10005654 3300026035 Bacteria 10038
477 Ga0207703_10006383 3300026035 Bacteria 9425
478 Ga0207703_10007545 3300026035 Bacteria 8625
479 Ga0207703_10017446 3300026035 Bacteria 5603
480 Ga0207639_10002215 3300026041 Bacteria 13090
481 Ga0207639_10021938 3300026041 Bacteria 4593
482 Ga0207639_10052430 3300026041 Bacteria 3109
483 Ga0207639_10085102 3300026041 Bacteria 2514
484 Ga0207639_10090113 3300026041 Bacteria 2452
485 Ga0207639_10121859 3300026041 Bacteria 2144
486 Ga0207678_10000198 3300026067 Bacteria 52573
487 Ga0207678_10014684 3300026067 Bacteria 6891
488 Ga0207678_10090619 3300026067 Bacteria 2613
489 Ga0207702_10000430 3300026078 Bacteria 48112
490 Ga0207702_10003048 3300026078 Bacteria 15571
491 Ga0207702_10005307 3300026078 Bacteria 11305
492 Ga0207702_10008058 3300026078 Bacteria 8912
493 Ga0207702_10017344 3300026078 Bacteria 5957
494 Ga0207702_10018151 3300026078 Bacteria 5821
495 Ga0207702_10020863 3300026078 Bacteria 5421
496 Ga0207702_10100994 3300026078 Bacteria 2546
497 Ga0207641_10000047 3300026088 Bacteria 179977
498 Ga0207641_10002327 3300026088 Bacteria 17629
499 Ga0207641_10003117 3300026088 Bacteria 14907
500 Ga0207641_10011082 3300026088 Bacteria 7394
501 Ga0207641_10012433 3300026088 Bacteria 6980
502 Ga0207641_10037126 3300026088 Bacteria 4068
503 Ga0207648_10000317 3300026089 Bacteria 52853
504 Ga0207648_10006135 3300026089 Bacteria 11982
505 Ga0207648_10027744 3300026089 Bacteria 5025
506 Ga0207648_10078277 3300026089 Bacteria 2884
507 Ga0207676_10000034 3300026095 Bacteria 206058
508 Ga0207676_10000378 3300026095 Bacteria 37895
509 Ga0207676_10001136 3300026095 Bacteria 20113
510 Ga0207676_10010624 3300026095 Bacteria 6563
511 Ga0207676_10048265 3300026095 Bacteria 3304
512 Ga0207676_10060871 3300026095 Bacteria 2988
513 Ga0207676_10160767 3300026095 Bacteria 1945
514 Ga0207674_10000937 3300026116 Bacteria 38029
515 Ga0207674_10001303 3300026116 Bacteria 32594
516 Ga0207674_10002718 3300026116 Bacteria 22070
517 Ga0207674_10006989 3300026116 Bacteria 13205
518 Ga0207674_10008395 3300026116 Bacteria 11939
519 Ga0207674_10012673 3300026116 Bacteria 9420
520 Ga0207674_10014814 3300026116 Bacteria 8600
521 Ga0207674_10031878 3300026116 Bacteria 5532
522 Ga0207674_10045622 3300026116 Bacteria 4507
523 Ga0207675_100003730 3300026118 Bacteria 14838
524 Ga0207675_100007062 3300026118 Bacteria 10611
525 Ga0207675_100021446 3300026118 Bacteria 6017
526 Ga0207675_100022045 3300026118 Bacteria 5929
527 Ga0207675_100038664 3300026118 Bacteria 4452
528 Ga0207675_100074463 3300026118 Bacteria 3177
529 Ga0207675_100098758 3300026118 Bacteria 2750
530 Ga0207683_10009217 3300026121 Bacteria 8411
531 Ga0207683_10207570 3300026121 Bacteria 1782
532 Ga0207698_10003405 3300026142 Bacteria 9573
533 Ga0207698_10005663 3300026142 Bacteria 7737
534 Ga0207698_10026840 3300026142 Bacteria 4079
535 Ga0207698_10057375 3300026142 Bacteria 3012
536 Ga0207698_10087331 3300026142 Bacteria 2540
537 Ga0268266_10000069 3300028379 Bacteria 239714
538 Ga0268266_10009139 3300028379 Bacteria 8747
539 Ga0268266_10021182 3300028379 Bacteria 5538
540 Ga0268266_10024362 3300028379 Bacteria 5147
541 Ga0268266_10039290 3300028379 Bacteria 4030
542 Ga0268265_10000021 3300028380 Bacteria 272292
543 Ga0268265_10000052 3300028380 Bacteria 174254
544 Ga0268265_10000197 3300028380 Bacteria 70306
545 Ga0268265_10004932 3300028380 Bacteria 9179
546 Ga0268265_10008194 3300028380 Bacteria 7059
547 Ga0268265_10010028 3300028380 Bacteria 6396
548 Ga0268265_10012793 3300028380 Bacteria 5697
549 Ga0268265_10015604 3300028380 Bacteria 5201
550 Ga0268265_10017401 3300028380 Bacteria 4959
551 Ga0268264_10000021 3300028381 Bacteria 481580
552 Ga0268264_10000131 3300028381 Bacteria 181459
553 Ga0268264_10000567 3300028381 Bacteria 45270
554 Ga0268264_10001814 3300028381 Bacteria 19523
555 Ga0268264_10002173 3300028381 Bacteria 17473
556 Ga0268264_10009033 3300028381 Bacteria 8270
557 Ga0268264_10023705 3300028381 Bacteria 5005
558 Ga0265327_10001003 3300031251 Bacteria 40039
559 Ga0307408_100006789 3300031548 Bacteria 7587
560 Ga0307508_10016531 3300031616 Bacteria 6718
561 Ga0307405_10002100 3300031731 Bacteria 8682
562 Ga0307406_10002601 3300031901 Bacteria 9832
563 Ga0307407_10058832 3300031903 Bacteria 2236
564 Ga0307412_10002490 3300031911 Bacteria 10252
565 Ga0307416_100013524 3300032002 Bacteria 5551
566 Ga0307415_100028341 3300032126 Bacteria 3561
567 Ga0373943_0011882 3300035170 Bacteria 3919
568 Ga0373942_0003470 3300035207 Bacteria 3703
569 Ga0373935_0016099 3300035692 Bacteria 4525
570 Ga0373927_0025861 3300035695 Bacteria 3837
571 Ga0395899_0000104 3300037312 Bacteria 147238
572 Ga0395899_0010084 3300037312 Bacteria 7243
573 Ga0395899_0013362 3300037312 Bacteria 6281
574 Ga0395899_0023792 3300037312 Bacteria 4635
575 Ga0395899_0030923 3300037312 Bacteria 4025
576 Ga0395899_0038373 3300037312 Bacteria 3588
577 Ga0395899_0039880 3300037312 Bacteria 3514
578 Ga0395899_0048079 3300037312 Bacteria 3175
579 Ga0395899_0064655 3300037312 Bacteria 2689
580 Ga0395899_0067646 3300037312 Bacteria 2621
581 Ga0395899_0068026 3300037312 Bacteria 2612
582 Ga0395899_0145899 3300037312 Bacteria 1681
583 Ga0395900_0000161 3300037418 Bacteria 110637
584 Ga0395900_0001979 3300037418 Bacteria 23128
585 Ga0395900_0002464 3300037418 Bacteria 20376
586 Ga0395900_0004869 3300037418 Bacteria 14150
587 Ga0395900_0033711 3300037418 Bacteria 5269
588 Ga0395900_0034176 3300037418 Bacteria 5235
589 Ga0395900_0037569 3300037418 Bacteria 4992
590 Ga0395900_0043596 3300037418 Bacteria 4624
591 Ga0395900_0056008 3300037418 Bacteria 4059
592 Ga0395900_0065428 3300037418 Bacteria 3735
593 Ga0395900_0066531 3300037418 Bacteria 3702
594 Ga0395900_0067047 3300037418 Bacteria 3688
595 Ga0395900_0090191 3300037418 Bacteria 3151
596 Ga0395900_0097049 3300037418 Bacteria 3028
597 Ga0395900_0134622 3300037418 Bacteria 2531
598 Ga0395900_0156766 3300037418 Bacteria 2325
599 Ga0395900_0164563 3300037418 Bacteria 2261
600 Ga0395898_0000169 3300037466 Bacteria 168667
601 Ga0395898_0006568 3300037466 Bacteria 12408
602 Ga0395898_0011480 3300037466 Bacteria 9199
603 Ga0395898_0024479 3300037466 Bacteria 6089
604 Ga0395898_0077624 3300037466 Bacteria 3206
605 Ga0395898_0080899 3300037466 Bacteria 3133
606 Ga0395898_0083517 3300037466 Bacteria 3078
607 Ga0395898_0090063 3300037466 Bacteria 2952
608 Ga0395898_0106979 3300037466 Bacteria 2682
609 Ga0395898_0129242 3300037466 Bacteria 2420
610 Ga0395898_0129678 3300037466 Bacteria 2415
611 Ga0395905_0000104 3300037471 Bacteria 141965
612 Ga0395905_0000120 3300037471 Bacteria 130865
613 Ga0395905_0002668 3300037471 Bacteria 19575
614 Ga0395905_0003971 3300037471 Bacteria 15563
615 Ga0395905_0011281 3300037471 Bacteria 8637
616 Ga0395905_0012663 3300037471 Bacteria 8115
617 Ga0395905_0023425 3300037471 Bacteria 5834
618 Ga0395905_0024005 3300037471 Bacteria 5757
619 Ga0395905_0025552 3300037471 Bacteria 5569
620 Ga0395905_0028768 3300037471 Bacteria 5236
621 Ga0395905_0037509 3300037471 Bacteria 4549
622 Ga0395905_0039312 3300037471 Bacteria 4438
623 Ga0395905_0040894 3300037471 Bacteria 4349
624 Ga0395905_0049225 3300037471 Bacteria 3949
625 Ga0395905_0077714 3300037471 Bacteria 3110
626 Ga0395905_0080011 3300037471 Bacteria 3063
627 Ga0395901_0000664 3300038443 Bacteria 39548
628 Ga0395901_0005588 3300038443 Bacteria 12729
629 Ga0395901_0014971 3300038443 Bacteria 7882
630 Ga0395901_0022137 3300038443 Bacteria 6512
631 Ga0395901_0024686 3300038443 Bacteria 6171
632 Ga0395901_0030692 3300038443 Bacteria 5538
633 Ga0395901_0059178 3300038443 Bacteria 3986
634 Ga0395901_0059393 3300038443 Bacteria 3978
635 Ga0395901_0062430 3300038443 Bacteria 3877
636 Ga0395901_0066271 3300038443 Bacteria 3761
637 Ga0395901_0077369 3300038443 Bacteria 3472
638 Ga0395901_0096271 3300038443 Bacteria 3102
639 Ga0395901_0123348 3300038443 Bacteria 2722
640 Ga0395901_0186020 3300038443 Bacteria 2178
641 Ga0436361_0200088 3300039447 Bacteria 5440
642 Ga0436361_0897280 3300039447 Bacteria 17229
643 Ga0439445_0002579 3300042004 Bacteria 4031
644 Ga0439448_0001144 3300042005 Bacteria 6711
645 Ga0439455_0000293 3300042012 Bacteria 6235
646 Ga0439458_0000011 3300042157 Bacteria 29034
647 Ga0439458_0000051 3300042157 Bacteria 19754
648 Ga0439458_0003106 3300042157 Bacteria 3949
649 Ga0439464_0000713 3300042439 Bacteria 7200
650 Ga0439464_0003431 3300042439 Bacteria 3997
651 Ga0451577_0039515 3300042876 Bacteria 4240
652 Ga0466969_0016598 3300044656 Bacteria 3851
653 Ga0466969_0048135 3300044656 Bacteria 2108
654 Ga0466972_0000786 3300044658 Bacteria 15066
655 Ga0466965_0031256 3300044683 Bacteria 2596
656 Ga0466966_0000052 3300044684 Bacteria 88472
657 Ga0466966_0002388 3300044684 Bacteria 12268
658 Ga0466961_0034809 3300044693 Bacteria 3233
659 Ga0466963_0000815 3300044694 Bacteria 15585
660 Ga0466963_0024046 3300044694 Bacteria 3875
661 Ga0466963_0038518 3300044694 Bacteria 3126
662 Ga0466963_0089749 3300044694 Bacteria 2091
663 Ga0466963_0103096 3300044694 Bacteria 1954
664 Ga0466964_0012472 3300044706 Bacteria 3215
665 Ga0466964_0024705 3300044706 Bacteria 2342
666 Ga0466971_0005602 3300044719 Bacteria 5460
667 Ga0466971_0012210 3300044719 Bacteria 3763
668 Ga0466968_0037164 3300044735 Bacteria 2042
669 Ga0466970_0018763 3300044765 Bacteria 3583
670 Ga0466970_0076593 3300044765 Bacteria 1802
671 Ga0466957_0001952 3300044842 Bacteria 10954
672 Ga0466957_0009863 3300044842 Bacteria 5461
673 Ga0466960_0003591 3300044901 Bacteria 5983
674 Ga0466960_0044746 3300044901 Bacteria 2111
675 Ga0466960_0045153 3300044901 Bacteria 2103
676 Ga0466960_0071728 3300044901 Bacteria 1726
677 Ga0451576_0004130 3300045051 Bacteria 19149
678 Ga0466958_0000611 3300045836 Bacteria 15263
679 Ga0466958_0007378 3300045836 Bacteria 6044
680 Ga0466958_0071292 3300045836 Bacteria 2127
681 Ga0466967_0002752 3300045976 Bacteria 11116
682 Ga0466967_0003933 3300045976 Bacteria 9871
683 Ga0466967_0044109 3300045976 Bacteria 3865
684 Ga0466967_0072847 3300045976 Bacteria 3080
685 Ga0495590_0002741 3300046457 Bacteria 7272
686 Ga0495638_0001102 3300046460 Bacteria 26299
687 Ga0495638_0009092 3300046460 Bacteria 6994
688 Ga0495625_0002352 3300046660 Bacteria 20624
689 Ga0495625_0014697 3300046660 Bacteria 6235
690 Ga0495669_0012674 3300046684 Bacteria 3590
691 Ga0495670_0000005 3300046691 Bacteria 289725
692 Ga0495687_000125 3300047443 Bacteria 118053
693 Ga0495686_0000063 3300047472 Bacteria 228575
694 Ga0495686_0001670 3300047472 Bacteria 23070
695 Ga0496100_0012996 3300048903 Bacteria 4791
696 Ga0496101_0002179 3300048904 Bacteria 11959
697 Ga0496101_0062635 3300048904 Bacteria 2705
698 Ga0496102_0016769 3300048905 Bacteria 6406
699 Ga0496102_0019775 3300048905 Bacteria 5935
700 Ga0496103_0000748 3300048906 Bacteria 23924
701 Ga0496104_0038950 3300048907 Bacteria 4449
702 Ga0496104_0067365 3300048907 Bacteria 3401
703 Ga0496105_0024060 3300048908 Bacteria 4947
704 Ga0496106_0067082 3300048909 Bacteria 2734
705 Ga0496107_0005708 3300048910 Bacteria 8521
706 Ga0496108_0015736 3300048911 Bacteria 6168
707 Ga0496109_0009291 3300048912 Bacteria 8377
708 Ga0496110_0003818 3300048913 Bacteria 11611
709 Ga0496110_0015846 3300048913 Bacteria 6285
710 Ga0496111_0020538 3300048914 Bacteria 4598
711 Ga0496112_0066085 3300048915 Bacteria 3568
712 Ga0496112_0215668 3300048915 Bacteria 1876
713 Ga0496116_0026563 3300048919 Bacteria 4232
714 Ga0496121_0001925 3300048924 Bacteria 33163
715 Ga0496125_0111856 3300048928 Bacteria 1975
716 Ga0495678_042987 3300049459 Bacteria 1798
717 Ga0501034_0200126 3300049571 Bacteria 1956
718 Ga0501083_0044244 3300049744 Bacteria 3014
719 nmdc:mga07m45_3124_c1 3300050496 Bacteria 7932
720 nmdc:mga07m45_4755_c1 3300050496 Bacteria 6674
721 nmdc:mga07m45_505_c1 3300050496 Bacteria 16509
722 nmdc:mga06r32_19192_c1 3300050510 Bacteria 6274
723 nmdc:mga0n895_395853_c1 3300050512 Bacteria 1397
724 Ga0500643_000006 3300053087 Bacteria 479605
725 Ga0500643_000232 3300053087 Bacteria 51502
726 Ga0500592_000718 3300053116 Bacteria 5439
727 Ga0500595_020074 3300053119 Bacteria 2412
728 Ga0500568_0005404 3300053139 Bacteria 6605
729 Ga0500622_0000165 3300053156 Bacteria 70459
730 Ga0500622_0005497 3300053156 Bacteria 7600
731 Ga0500645_002746 3300053730 Bacteria 7633
732 Ga0501084_0116813 3300054114 Bacteria 2243
733 Ga0466962_0000727 3300061719 Bacteria 14741
734 Ga0466962_0035764 3300061719 Bacteria 2376
735 Ga0209676_1000273
736 JGI24736J21556_1001268
737 JGI24736J21556_1002566
738 JGI24741J21665_1008183
739 JGI24740J21852_10000395
740 JGI24740J21852_10023866
741 JGI24740J21852_10025113
742 JGI24739J22299_10001257
743 JGI24739J22299_10015261
744 JGI24739J22299_10018892
745 JGI24737J22298_10000051
746 JGI24737J22298_10000165
747 JGI24737J22298_10004914
748 JGI24743J22301_10004952
749 JGI24735J21928_10002842
750 JGI24750J21931_1000372
751 JGI24748J21848_1000049
752 JGI24738J21930_10000027
753 JGI24738J21930_10004118
754 JGI24749J21850_1000068
755 JGI24744J21845_10002683
756 JGI24034J26672_10000033
757 JGI24751J29686_10000400
758 JGI24751J29686_10003332
759 rootH2_10040129
760 Ga0055531_10000021
761 Ga0065707_10082133
762 Ga0065707_10089113
763 Ga0065707_10096768
764 Ga0070658_10004633
765 Ga0070658_10033056
766 Ga0070658_10052651
767 Ga0070658_10055565
768 Ga0070658_10112571
769 Ga0070658_10131856
770 Ga0070676_10004834
771 Ga0070676_10043886
772 Ga0070683_100020582
773 Ga0070683_100206723
774 Ga0070690_100000014
775 Ga0070690_100013207
776 Ga0070670_100000047
777 Ga0070670_100006640
778 Ga0070670_100012044
779 Ga0070670_100117212
780 Ga0070670_100129327
781 Ga0070677_10000829
782 Ga0068869_100001996
783 Ga0070666_10000027
784 Ga0070666_10024010
785 Ga0070666_10053109
786 Ga0070666_10057578
787 Ga0070666_10059332
788 Ga0070680_100007272
789 Ga0070682_100016005
790 Ga0070682_100103904
791 Ga0068868_100020578
792 Ga0068868_100032545
793 Ga0070660_100000767
794 Ga0070660_100021183
795 Ga0070660_100023164
796 Ga0070660_100038535
797 Ga0070660_100075152
798 Ga0070689_100001657
799 Ga0070689_100050373
800 Ga0070691_10003231
801 Ga0070661_100006327
802 Ga0070661_100007808
803 Ga0070661_100014597
804 Ga0070661_100024568
805 Ga0070661_100032766
806 Ga0070661_100043650
807 Ga0070668_100006365
808 Ga0070668_100018826
809 Ga0070668_100033901
810 Ga0070668_100072193
811 Ga0070668_100123140
812 Ga0070669_100000099
813 Ga0070669_100000162
814 Ga0070669_100000699
815 Ga0070669_100005466
816 Ga0070669_100014681
817 Ga0070675_100003584
818 Ga0070675_100012015
819 Ga0070675_100149121
820 Ga0070671_100003886
821 Ga0070671_100007605
822 Ga0070671_100018586
823 Ga0070671_100018748
824 Ga0070671_100022038
825 Ga0070671_100022628
826 Ga0070671_100107298
827 Ga0070674_100003989
828 Ga0070674_100028068
829 Ga0070673_100003743
830 Ga0070673_100009898
831 Ga0070673_100072205
832 Ga0070659_100000753
833 Ga0070659_100027561
834 Ga0070659_100030220
835 Ga0070659_100036766
836 Ga0070659_100044578
837 Ga0070659_100051876
838 Ga0070667_100001558
839 Ga0070667_100001726
840 Ga0070667_100004197
841 Ga0070667_100006262
842 Ga0070667_100026747
843 Ga0070714_100041839
844 Ga0070714_100096013
845 Ga0070694_100041086
846 Ga0070663_100007411
847 Ga0070663_100048258
848 Ga0070663_100066749
849 Ga0070663_100083195
850 Ga0070678_100013659
851 Ga0070662_100002248
852 Ga0070662_100032902
853 Ga0070662_100034495
854 Ga0070662_100115658
855 Ga0068867_100011915
856 Ga0070685_10000101
857 Ga0068853_100006221
858 Ga0068853_100007344
859 Ga0068853_100036633
860 Ga0068853_100094723
861 Ga0070672_100000234
862 Ga0070672_100001207
863 Ga0070672_100155391
864 Ga0070686_100000010
865 Ga0070665_100000254
866 Ga0070665_100003744
867 Ga0070665_100011289
868 Ga0070665_100016958
869 Ga0070665_100018536
870 Ga0070665_100030502
871 Ga0070665_100097864
872 Ga0070665_100177255
873 Ga0068855_100001164
874 Ga0068855_100001723
875 Ga0068855_100003156
876 Ga0068855_100056306
877 Ga0070664_100002457
878 Ga0070664_100002747
879 Ga0070664_100007368
880 Ga0070664_100007907
881 Ga0070664_100040646
882 Ga0068857_100003650
883 Ga0068857_100004327
884 Ga0068857_100005444
885 Ga0068857_100007919
886 Ga0068857_100013071
887 Ga0068857_100037783
888 Ga0068857_100064545
889 Ga0068857_100084161
890 Ga0068854_100000061
891 Ga0068854_100001151
892 Ga0068854_100004904
893 Ga0068854_100005672
894 Ga0068854_100010327
895 Ga0068854_100025690
896 Ga0068854_100027723
897 Ga0068854_100076804
898 Ga0068856_100000449
899 Ga0068856_100004411
900 Ga0068856_100046595
901 Ga0068856_100058084
902 Ga0068856_100090626
903 Ga0068852_100000847
904 Ga0068852_100001197
905 Ga0068852_100013939
906 Ga0068852_100024513
907 Ga0068859_100000324
908 Ga0068859_100003001
909 Ga0068859_100011614
910 Ga0068859_100024123
911 Ga0068859_100024318
912 Ga0068859_100025027
913 Ga0068859_100037329
914 Ga0068859_100069451
915 Ga0068859_100086978
916 Ga0068859_100101242
917 Ga0068864_100000051
918 Ga0068864_100000743
919 Ga0068864_100002131
920 Ga0068864_100002488
921 Ga0068864_100007461
922 Ga0068864_100024966
923 Ga0068864_100118777
924 Ga0068861_100011286
925 Ga0068861_100023488
926 Ga0068861_100066733
927 Ga0068861_100072992
928 Ga0068851_10014735
929 Ga0068851_10019078
930 Ga0068851_10022284
931 Ga0068863_100000214
932 Ga0068863_100006673
933 Ga0068863_100007339
934 Ga0068863_100069572
935 Ga0068858_100001674
936 Ga0068858_100006175
937 Ga0068858_100006917
938 Ga0068858_100007137
939 Ga0068858_100007575
940 Ga0068858_100024881
941 Ga0068858_100037115
942 Ga0068858_100038487
943 Ga0068858_100040082
944 Ga0068858_100051634
945 Ga0068860_100000080
946 Ga0068860_100000353
947 Ga0068860_100009742
948 Ga0068860_100011757
949 Ga0068860_100014764
950 Ga0068860_100032025
951 Ga0068860_100059152
952 Ga0068860_100107896
953 Ga0068860_100222950
954 Ga0068862_100000036
955 Ga0068862_100000198
956 Ga0068862_100000357
957 Ga0068862_100018625
958 Ga0068862_100023491
959 Ga0068862_100028554
960 Ga0068862_100035008
961 Ga0068862_100048188
962 Ga0068862_100076145
963 Ga0081455_10000564
964 Ga0081455_10004231
965 Ga0081455_10065401
966 Ga0081539_10058522
967 Ga0075366_10007553
968 Ga0097621_100020152
969 Ga0097621_100034584
970 Ga0097621_100120820
971 Ga0097621_100123826
972 Ga0075370_10004706
973 Ga0075370_10007682
974 Ga0068871_100057229
975 Ga0075431_100123846
976 Ga0068865_100000434
977 Ga0068865_100011662
978 Ga0068865_100028784
979 Ga0097620_100000324
980 Ga0097620_100003001
981 Ga0097620_100011614
982 Ga0097620_100024122
983 Ga0097620_100024317
984 Ga0097620_100025028
985 Ga0097620_100037328
986 Ga0097620_100069449
987 Ga0097620_100086981
988 Ga0097620_100101251
989 Ga0105251_10043986
990 Ga0105240_10003880
991 Ga0105240_10066649
992 Ga0105240_10102679
993 Ga0105240_10184912
994 Ga0105240_10188228
995 Ga0105240_10200736
996 Ga0105240_10205940
997 Ga0105245_10000424
998 Ga0105245_10048655
999 Ga0105245_10222158
1000 Ga0105247_10030004
1001 Ga0105243_10031215
1002 Ga0105241_10166782
1003 Ga0105242_10083959
1004 Ga0105248_10000123
1005 Ga0105248_10000159
1006 Ga0105248_10000407
1007 Ga0105248_10024980
1008 Ga0105248_10031334
1009 Ga0105248_10105654
1010 Ga0105248_10119460
1011 Ga0105237_10003982
1012 Ga0105237_10018540
1013 Ga0105237_10144916
1014 Ga0105237_10159970
1015 Ga0105237_10225391
1016 Ga0105238_10018232
1017 Ga0105238_10052066
1018 Ga0105238_10053533
1019 Ga0105238_10069566
1020 Ga0105238_10096252
1021 Ga0105238_10145698
1022 Ga0105249_10000015
1023 Ga0105249_10000064
1024 Ga0105249_10011234
1025 Ga0105249_10019672
1026 Ga0105239_10002388
1027 Ga0105239_10019413
1028 Ga0105239_10051754
1029 Ga0105239_10114796
1030 Ga0105239_10153247
1031 Ga0105239_10265085
1032 Ga0105246_10003940
1033 Ga0157373_10012675
1034 Ga0157371_10003598
1035 Ga0157371_10013675
1036 Ga0157370_10005586
1037 Ga0157370_10014806
1038 Ga0157370_10027355
1039 Ga0157370_10030792
1040 Ga0157370_10054688
1041 Ga0157370_10092659
1042 Ga0157370_10232362
1043 Ga0157369_10000385
1044 Ga0157369_10012084
1045 Ga0157369_10016507
1046 Ga0157369_10034107
1047 Ga0157378_10000018
1048 Ga0157378_10006264
1049 Ga0157378_10022160
1050 Ga0157378_10083214
1051 Ga0163162_10002274
1052 Ga0163162_10013200
1053 Ga0163162_10058690
1054 Ga0163162_10187894
1055 Ga0157372_10061043
1056 Ga0157372_10068118
1057 Ga0157372_10099151
1058 Ga0157372_10180763
1059 Ga0157372_10188569
1060 Ga0157375_10064297
1061 Ga0157375_10081028
1062 Ga0163163_10000265
1063 Ga0163163_10013362
1064 Ga0163163_10103722
1065 Ga0157380_10000332
1066 Ga0157379_10001201
1067 Ga0157379_10015227
1068 Ga0157376_10044100
1069 Ga0163161_10000110
1070 Ga0207672_1000729
1071 Ga0209759_1011916
1072 Ga0209676_1009644
1073 Ga0209025_1020025
1074 Ga0209051_1004538
1075 Ga0209051_1009617
1076 Ga0209257_1000032
1077 Ga0209257_1000458
1078 Ga0207697_10002358
1079 Ga0207697_10002531
1080 Ga0207656_10019188
1081 Ga0207682_10003777
1082 Ga0207710_10014589
1083 Ga0207688_10000018
1084 Ga0207688_10024275
1085 Ga0207688_10026512
1086 Ga0207680_10000009
1087 Ga0207680_10012998
1088 Ga0207647_10000232
1089 Ga0207647_10000333
1090 Ga0207647_10001648
1091 Ga0207647_10013372
1092 Ga0207647_10014933
1093 Ga0207647_10021572
1094 Ga0207647_10024185
1095 Ga0207647_10033137
1096 Ga0207647_10056231
1097 Ga0207645_10008012
1098 Ga0207645_10082577
1099 Ga0207643_10055164
1100 Ga0207705_10000059
1101 Ga0207705_10001692
1102 Ga0207705_10016137
1103 Ga0207705_10089454
1104 Ga0207654_10008896
1105 Ga0207654_10027098
1106 Ga0207654_10079171
1107 Ga0207695_10011197
1108 Ga0207695_10021396
1109 Ga0207695_10048837
1110 Ga0207671_10000841
1111 Ga0207671_10033115
1112 Ga0207671_10071063
1113 Ga0207657_10003142
1114 Ga0207657_10004185
1115 Ga0207657_10008595
1116 Ga0207657_10008817
1117 Ga0207657_10009428
1118 Ga0207657_10030517
1119 Ga0207657_10051528
1120 Ga0207657_10066083
1121 Ga0207649_10004902
1122 Ga0207649_10008761
1123 Ga0207649_10017197
1124 Ga0207649_10030987
1125 Ga0207681_10000003
1126 Ga0207681_10001180
1127 Ga0207681_10001989
1128 Ga0207694_10002118
1129 Ga0207694_10005478
1130 Ga0207694_10023373
1131 Ga0207694_10038326
1132 Ga0207694_10103667
1133 Ga0207650_10000038
1134 Ga0207650_10014405
1135 Ga0207650_10032714
1136 Ga0207650_10099346
1137 Ga0207659_10007405
1138 Ga0207687_10012203
1139 Ga0207664_10033267
1140 Ga0207644_10000512
1141 Ga0207644_10007430
1142 Ga0207644_10013409
1143 Ga0207644_10016807
1144 Ga0207644_10041587
1145 Ga0207690_10014349
1146 Ga0207706_10000171
1147 Ga0207706_10002226
1148 Ga0207706_10002480
1149 Ga0207706_10006168
1150 Ga0207706_10019005
1151 Ga0207706_10046960
1152 Ga0207706_10111062
1153 Ga0207686_10071119
1154 Ga0207709_10028961
1155 Ga0207709_10054348
1156 Ga0207670_10022219
1157 Ga0207669_10050360
1158 Ga0207704_10001207
1159 Ga0207704_10067513
1160 Ga0207691_10000070
1161 Ga0207691_10000442
1162 Ga0207691_10012078
1163 Ga0207691_10034316
1164 Ga0207711_10000100
1165 Ga0207711_10000607
1166 Ga0207711_10002610
1167 Ga0207711_10009352
1168 Ga0207711_10012993
1169 Ga0207711_10059979
1170 Ga0207711_10086011
1171 Ga0207689_10000123
1172 Ga0207689_10008724
1173 Ga0207689_10017657
1174 Ga0207679_10002516
1175 Ga0207679_10017882
1176 Ga0207679_10132261
1177 Ga0207667_10000017
1178 Ga0207667_10000503
1179 Ga0207667_10011731
1180 Ga0207667_10021710
1181 Ga0207667_10030020
1182 Ga0207667_10048962
1183 Ga0207667_10094862
1184 Ga0207651_10000332
1185 Ga0207651_10033606
1186 Ga0207651_10081205
1187 Ga0207712_10000023
1188 Ga0207712_10000044
1189 Ga0207712_10000873
1190 Ga0207668_10002284
1191 Ga0207668_10006304
1192 Ga0207668_10067676
1193 Ga0207640_10002840
1194 Ga0207640_10006873
1195 Ga0207640_10034778
1196 Ga0207640_10035086
1197 Ga0207640_10048529
1198 Ga0207640_10070849
1199 Ga0207640_10099237
1200 Ga0207640_10113553
1201 Ga0207658_10000592
1202 Ga0207658_10001131
1203 Ga0207658_10001592
1204 Ga0207658_10048397
1205 Ga0207658_10052764
1206 Ga0207677_10016237
1207 Ga0207677_10070670
1208 Ga0207703_10001186
1209 Ga0207703_10002719
1210 Ga0207703_10005654
1211 Ga0207703_10006383
1212 Ga0207703_10007545
1213 Ga0207703_10017446
1214 Ga0207639_10002215
1215 Ga0207639_10021938
1216 Ga0207639_10052430
1217 Ga0207639_10085102
1218 Ga0207639_10090113
1219 Ga0207639_10121859
1220 Ga0207678_10000198
1221 Ga0207678_10014684
1222 Ga0207678_10090619
1223 Ga0207702_10000430
1224 Ga0207702_10003048
1225 Ga0207702_10005307
1226 Ga0207702_10008058
1227 Ga0207702_10017344
1228 Ga0207702_10018151
1229 Ga0207702_10020863
1230 Ga0207702_10100994
1231 Ga0207641_10000047
1232 Ga0207641_10002327
1233 Ga0207641_10003117
1234 Ga0207641_10011082
1235 Ga0207641_10012433
1236 Ga0207641_10037126
1237 Ga0207648_10000317
1238 Ga0207648_10006135
1239 Ga0207648_10027744
1240 Ga0207648_10078277
1241 Ga0207676_10000034
1242 Ga0207676_10000378
1243 Ga0207676_10001136
1244 Ga0207676_10010624
1245 Ga0207676_10048265
1246 Ga0207676_10060871
1247 Ga0207676_10160767
1248 Ga0207674_10000937
1249 Ga0207674_10001303
1250 Ga0207674_10002718
1251 Ga0207674_10006989
1252 Ga0207674_10008395
1253 Ga0207674_10012673
1254 Ga0207674_10014814
1255 Ga0207674_10031878
1256 Ga0207674_10045622
1257 Ga0207675_100003730
1258 Ga0207675_100007062
1259 Ga0207675_100021446
1260 Ga0207675_100022045
1261 Ga0207675_100038664
1262 Ga0207675_100074463
1263 Ga0207675_100098758
1264 Ga0207683_10009217
1265 Ga0207683_10207570
1266 Ga0207698_10003405
1267 Ga0207698_10005663
1268 Ga0207698_10026840
1269 Ga0207698_10057375
1270 Ga0207698_10087331
1271 Ga0268266_10000069
1272 Ga0268266_10009139
1273 Ga0268266_10021182
1274 Ga0268266_10024362
1275 Ga0268266_10039290
1276 Ga0268265_10000021
1277 Ga0268265_10000052
1278 Ga0268265_10000197
1279 Ga0268265_10004932
1280 Ga0268265_10008194
1281 Ga0268265_10010028
1282 Ga0268265_10012793
1283 Ga0268265_10015604
1284 Ga0268265_10017401
1285 Ga0268264_10000021
1286 Ga0268264_10000131
1287 Ga0268264_10000567
1288 Ga0268264_10001814
1289 Ga0268264_10002173
1290 Ga0268264_10009033
1291 Ga0268264_10023705
1292 Ga0265327_10001003
1293 Ga0307408_100006789
1294 Ga0307508_10016531
1295 Ga0307405_10002100
1296 Ga0307406_10002601
1297 Ga0307407_10058832
1298 Ga0307412_10002490
1299 Ga0307416_100013524
1300 Ga0307415_100028341
1301 Ga0373943_0011882
1302 Ga0373942_0003470
1303 Ga0373935_0016099
1304 Ga0373927_0025861
1305 Ga0395899_0000104
1306 Ga0395899_0010084
1307 Ga0395899_0013362
1308 Ga0395899_0023792
1309 Ga0395899_0030923
1310 Ga0395899_0038373
1311 Ga0395899_0039880
1312 Ga0395899_0048079
1313 Ga0395899_0064655
1314 Ga0395899_0067646
1315 Ga0395899_0068026
1316 Ga0395899_0145899
1317 Ga0395900_0000161
1318 Ga0395900_0001979
1319 Ga0395900_0002464
1320 Ga0395900_0004869
1321 Ga0395900_0033711
1322 Ga0395900_0034176
1323 Ga0395900_0037569
1324 Ga0395900_0043596
1325 Ga0395900_0056008
1326 Ga0395900_0065428
1327 Ga0395900_0066531
1328 Ga0395900_0067047
1329 Ga0395900_0090191
1330 Ga0395900_0097049
1331 Ga0395900_0134622
1332 Ga0395900_0156766
1333 Ga0395900_0164563
1334 Ga0395898_0000169
1335 Ga0395898_0006568
1336 Ga0395898_0011480
1337 Ga0395898_0024479
1338 Ga0395898_0077624
1339 Ga0395898_0080899
1340 Ga0395898_0083517
1341 Ga0395898_0090063
1342 Ga0395898_0106979
1343 Ga0395898_0129242
1344 Ga0395898_0129678
1345 Ga0395905_0000104
1346 Ga0395905_0000120
1347 Ga0395905_0002668
1348 Ga0395905_0003971
1349 Ga0395905_0011281
1350 Ga0395905_0012663
1351 Ga0395905_0023425
1352 Ga0395905_0024005
1353 Ga0395905_0025552
1354 Ga0395905_0028768
1355 Ga0395905_0037509
1356 Ga0395905_0039312
1357 Ga0395905_0040894
1358 Ga0395905_0049225
1359 Ga0395905_0077714
1360 Ga0395905_0080011
1361 Ga0395901_0000664
1362 Ga0395901_0005588
1363 Ga0395901_0014971
1364 Ga0395901_0022137
1365 Ga0395901_0024686
1366 Ga0395901_0030692
1367 Ga0395901_0059178
1368 Ga0395901_0059393
1369 Ga0395901_0062430
1370 Ga0395901_0066271
1371 Ga0395901_0077369
1372 Ga0395901_0096271
1373 Ga0395901_0123348
1374 Ga0395901_0186020
1375 Ga0436361_0200088
1376 Ga0436361_0897280
1377 Ga0439445_0002579
1378 Ga0439448_0001144
1379 Ga0439455_0000293
1380 Ga0439458_0000011
1381 Ga0439458_0000051
1382 Ga0439458_0003106
1383 Ga0439464_0000713
1384 Ga0439464_0003431
1385 Ga0451577_0039515
1386 Ga0466969_0016598
1387 Ga0466969_0048135
1388 Ga0466972_0000786
1389 Ga0466965_0031256
1390 Ga0466966_0000052
1391 Ga0466966_0002388
1392 Ga0466961_0034809
1393 Ga0466963_0000815
1394 Ga0466963_0024046
1395 Ga0466963_0038518
1396 Ga0466963_0089749
1397 Ga0466963_0103096
1398 Ga0466964_0012472
1399 Ga0466964_0024705
1400 Ga0466971_0005602
1401 Ga0466971_0012210
1402 Ga0466968_0037164
1403 Ga0466970_0018763
1404 Ga0466970_0076593
1405 Ga0466957_0001952
1406 Ga0466957_0009863
1407 Ga0466960_0003591
1408 Ga0466960_0044746
1409 Ga0466960_0045153
1410 Ga0466960_0071728
1411 Ga0451576_0004130
1412 Ga0466958_0000611
1413 Ga0466958_0007378
1414 Ga0466958_0071292
1415 Ga0466967_0002752
1416 Ga0466967_0003933
1417 Ga0466967_0044109
1418 Ga0466967_0072847
1419 Ga0495590_0002741
1420 Ga0495638_0001102
1421 Ga0495638_0009092
1422 Ga0495625_0002352
1423 Ga0495625_0014697
1424 Ga0495669_0012674
1425 Ga0495670_0000005
1426 Ga0495687_000125
1427 Ga0495686_0000063
1428 Ga0495686_0001670
1429 Ga0496100_0012996
1430 Ga0496101_0002179
1431 Ga0496101_0062635
1432 Ga0496102_0016769
1433 Ga0496102_0019775
1434 Ga0496103_0000748
1435 Ga0496104_0038950
1436 Ga0496104_0067365
1437 Ga0496105_0024060
1438 Ga0496106_0067082
1439 Ga0496107_0005708
1440 Ga0496108_0015736
1441 Ga0496109_0009291
1442 Ga0496110_0003818
1443 Ga0496110_0015846
1444 Ga0496111_0020538
1445 Ga0496112_0066085
1446 Ga0496112_0215668
1447 Ga0496116_0026563
1448 Ga0496121_0001925
1449 Ga0496125_0111856
1450 Ga0495678_042987
1451 Ga0501034_0200126
1452 Ga0501083_0044244
1453 nmdc:mga07m45_3124_c1
1454 nmdc:mga07m45_4755_c1
1455 nmdc:mga07m45_505_c1
1456 nmdc:mga06r32_19192_c1
1457 nmdc:mga0n895_395853_c1
1458 Ga0500643_000006
1459 Ga0500643_000232
1460 Ga0500592_000718
1461 Ga0500595_020074
1462 Ga0500568_0005404
1463 Ga0500622_0000165
1464 Ga0500622_0005497
1465 Ga0500645_002746
1466 Ga0501084_0116813
1467 Ga0466962_0000727
1468 Ga0466962_0035764

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

31

426

0.91

PF00083

Sugar_tr

Sugar (and other) transporter

16

202

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.8297 26 494
8pnl-assembly1.cif.gz_A outward-open conformation of a major facilitator superfamily (mfs) transporter mhas2168, a homologue of rv1410 from m. tuberculosis, in complex with an alpaca nanobody 0.8 26 488
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.7887 24 491
7d5q-assembly1.cif.gz_A structure of norc transporter (k398a mutant) in an outward-open conformation in complex with a single-chain indian camelid antibody 0.787 24 491
7y58-assembly1.cif.gz_A cryoem structure of qaca (d411n), an antibacterial efflux transporter from staphylococcus aureus 0.7784 26 494
ID Description Score Start End Superfamily
af_P0AEJ0_15_220_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9543 18 214 1.20.1250.20
af_P9WG87_21_208_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9455 26 199 1.20.1250.20
af_P36554_12_217_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9298 26 216 1.20.1250.20
af_P9WG91_8_214_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9247 18 213 1.20.1250.20
af_Q2G2W1_141_346_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9211 26 213 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3S1U0X0-F1-model_v4 MFS transporter 0.9361 18 155 GO:0005886
GO:0022857
AF-A0A7X7SSR9-F1-model_v4 MFS transporter 0.9286 26 183 GO:0016020
GO:0022857
AF-A0A2E6BHY6-F1-model_v4 MFS transporter 0.9246 26 153 GO:0005886
GO:0022857
AF-A0A3S1U0X0-F1-model_v4 MFS transporter 0.9105 18 155 GO:0005886
GO:0022857
AF-A0A524MXG0-F1-model_v4 MFS transporter 0.9039 264 492 GO:0016020
GO:0022857

Map