F478151

General Info

Members Datasets Scaffolds Average Seq Length
734 374 1468 425

Family's Representative Sequence

Representative Sequence 3300032133|Ga0316583_10000482|Ga0316583_100004827
Length 416
Sequence MIKHASQIATVADDEVPMAPAHEAASEEHIAPAPRVSVQAFCTTVETAAAVQAAGEDRRLVKAHVKIQMGGAPAAIEAYRTAPTPNVIVIEADQRADEILDALDQLAEVCDSGTRVMVIGRINDVTLYRELTRRGVSDYMIAPVAPLDVVRAVCGLFVAPDAKPVGRILAVIGAKGGVGASTVAHDSVVTDLDLAFGTAGLDFNQDPPQGVADAVFSPDRVDTAYVDRLLSKCTEHLSLLAAPATLERAYDFSAEAFDSTIDALRTSIPCVVLDIPHIWSGWTRRLLMAADDILVVAAPDLANLRNAKNLVDLLRTARPNDHHPYYCLNQVGVPKRPEISVADFAKALEDQPLAAIPFEPQIFGTAANNGQMIAEVSATHKTADLFRQLAQILTGRAEAKRQRGGLLSPLLAKLRG

Samples

Sample ID Description Type Environment
1 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
11 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
47 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
52 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
76 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
77 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
78 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
79 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
83 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
92 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
93 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
94 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
95 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
96 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
97 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
98 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
99 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
108 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
109 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
110 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
111 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
112 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
129 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
130 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
144 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
145 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
146 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
148 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
216 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
220 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
221 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
222 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
225 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
226 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
227 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
228 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
229 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
230 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
231 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
232 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
233 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
234 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
238 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
239 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
242 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
244 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
245 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
248 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
249 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
250 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
251 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
252 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
253 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
254 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
255 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
256 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
257 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
258 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
259 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
265 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
266 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
267 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
268 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
269 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
270 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
274 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
277 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
278 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
282 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
283 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
284 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
287 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
288 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
291 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
292 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
299 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
300 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
301 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
302 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
316 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
317 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
318 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
319 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
324 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
332 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
333 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
334 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
335 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
336 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
337 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
338 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
339 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
340 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
341 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
344 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
345 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
347 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
348 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
349 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
350 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
351 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
352 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
353 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
354 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
355 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
356 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
357 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
358 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
359 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
360 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
361 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
362 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
363 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
364 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
365 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
366 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
367 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
368 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
369 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
370 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
374 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.14
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.04
Nodule 0
Rhizoplane 6.4
Rhizosphere 88.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316583_10000482 3300032133 Bacteria 11854
2 2214831327 2209111006 Bacteria 1790
3 ARcpr5oldR_c000137 3300000041 Bacteria 12442
4 ARSoilYngRDRAFT_c00008 3300000042 Bacteria 31696
5 ARcpr5yngRDRAFT_c000146 3300000043 Bacteria 11307
6 ARSoilOldRDRAFT_c000154 3300000044 Bacteria 11557
7 ARSoilOldRDRAFT_c000666 3300000044 Bacteria 3614
8 ARCol0yngRDRAFT_1000140 3300000652 Bacteria 12778
9 JGI24746J21847_1002049 3300001977 Bacteria 3221
10 JGI24737J22298_10001160 3300001990 Bacteria 9267
11 JGI24750J21931_1000220 3300002070 Bacteria 9735
12 JGI24745J21846_1000606 3300002073 Bacteria 3228
13 JGI24738J21930_10000364 3300002075 Bacteria 12586
14 JGI24749J21850_1000110 3300002076 Bacteria 13554
15 JGI24744J21845_10007279 3300002077 Bacteria 2288
16 JGI24035J26624_1000148 3300002126 Bacteria 6281
17 JGI24034J26672_10010645 3300002239 Bacteria 1370
18 JGI24742J22300_10000903 3300002244 Bacteria 4541
19 Ga0065712_10002478 3300005290 Bacteria 4925
20 Ga0065712_10072486 3300005290 Bacteria 4736
21 Ga0065715_10100243 3300005293 Bacteria 3323
22 Ga0065715_10151640 3300005293 Bacteria 1722
23 Ga0070658_10004547 3300005327 Bacteria 11276
24 Ga0070658_10013595 3300005327 Bacteria 6530
25 Ga0070658_10082068 3300005327 Bacteria 2649
26 Ga0070676_10000591 3300005328 Bacteria 17568
27 Ga0070683_100002399 3300005329 Bacteria 14877
28 Ga0070683_100080042 3300005329 Bacteria 3058
29 Ga0070690_100001110 3300005330 Bacteria 13857
30 Ga0070690_100008673 3300005330 Bacteria 5864
31 Ga0070690_100025150 3300005330 Bacteria 3665
32 Ga0070690_100060644 3300005330 Bacteria 2435
33 Ga0070670_100005628 3300005331 Bacteria 10575
34 Ga0070670_100030015 3300005331 Bacteria 4682
35 Ga0070677_10001066 3300005333 Bacteria 8855
36 Ga0070677_10011607 3300005333 Bacteria 3042
37 Ga0068869_100003665 3300005334 Bacteria 9441
38 Ga0070666_10000759 3300005335 Bacteria 19520
39 Ga0070666_10042914 3300005335 Bacteria 3027
40 Ga0070666_10173999 3300005335 Bacteria 1508
41 Ga0070680_100003137 3300005336 Bacteria 12278
42 Ga0070680_100011487 3300005336 Bacteria 6852
43 Ga0070680_100014603 3300005336 Bacteria 6142
44 Ga0070680_100060670 3300005336 Bacteria 3095
45 Ga0070680_100096977 3300005336 Bacteria 2444
46 Ga0070682_100000961 3300005337 Bacteria 16785
47 Ga0070682_100105745 3300005337 Bacteria 1866
48 Ga0068868_100071367 3300005338 Bacteria 2770
49 Ga0070660_100001680 3300005339 Bacteria 15185
50 Ga0070660_100019659 3300005339 Bacteria 4952
51 Ga0070660_100036861 3300005339 Bacteria 3705
52 Ga0070689_100015071 3300005340 Bacteria 5629
53 Ga0070689_100053240 3300005340 Bacteria 3131
54 Ga0070691_10001100 3300005341 Bacteria 11228
55 Ga0070687_100000170 3300005343 Bacteria 22490
56 Ga0070687_100066858 3300005343 Bacteria 1917
57 Ga0070661_100000725 3300005344 Bacteria 24086
58 Ga0070692_10000703 3300005345 Bacteria 10779
59 Ga0070692_10009396 3300005345 Bacteria 4408
60 Ga0070668_100001707 3300005347 Bacteria 15938
61 Ga0070669_100001864 3300005353 Bacteria 15182
62 Ga0070675_100002550 3300005354 Bacteria 13633
63 Ga0070675_100043146 3300005354 Bacteria 3685
64 Ga0070671_100001845 3300005355 Bacteria 16138
65 Ga0070671_100002025 3300005355 Bacteria 15597
66 Ga0070671_100014200 3300005355 Bacteria 6431
67 Ga0070671_100019134 3300005355 Bacteria 5570
68 Ga0070674_100000854 3300005356 Bacteria 15809
69 Ga0070674_100140650 3300005356 Bacteria 1811
70 Ga0070673_100002424 3300005364 Bacteria 11361
71 Ga0070673_100010200 3300005364 Bacteria 6346
72 Ga0070673_100133899 3300005364 Bacteria 2083
73 Ga0070673_100264525 3300005364 Bacteria 1503
74 Ga0070688_100000605 3300005365 Bacteria 17977
75 Ga0070688_100023098 3300005365 Bacteria 3654
76 Ga0070659_100005725 3300005366 Bacteria 8948
77 Ga0070659_100172276 3300005366 Bacteria 1773
78 Ga0070667_100017465 3300005367 Bacteria 5947
79 Ga0070667_100101467 3300005367 Bacteria 2486
80 Ga0070709_10002216 3300005434 Bacteria 10530
81 Ga0070709_10019426 3300005434 Bacteria 3928
82 Ga0070709_10127923 3300005434 Bacteria 1730
83 Ga0070714_100011683 3300005435 Bacteria 6972
84 Ga0070714_100152156 3300005435 Bacteria 2086
85 Ga0070713_100017362 3300005436 Bacteria 5440
86 Ga0070713_100018752 3300005436 Bacteria 5264
87 Ga0070713_100020658 3300005436 Bacteria 5052
88 Ga0070713_100033076 3300005436 Bacteria 4139
89 Ga0070713_100039360 3300005436 Bacteria 3836
90 Ga0070713_100093741 3300005436 Bacteria 2588
91 Ga0070710_10002966 3300005437 Bacteria 8056
92 Ga0070710_10020751 3300005437 Bacteria 3413
93 Ga0070701_10000549 3300005438 Bacteria 12973
94 Ga0070711_100068609 3300005439 Bacteria 2492
95 Ga0070711_100258230 3300005439 Bacteria 1369
96 Ga0070705_100006756 3300005440 Bacteria 5642
97 Ga0070700_100001172 3300005441 Bacteria 12973
98 Ga0070694_100001934 3300005444 Bacteria 12278
99 Ga0070708_100034277 3300005445 Bacteria 4415
100 Ga0070663_100011089 3300005455 Bacteria 5642
101 Ga0070663_100013473 3300005455 Bacteria 5216
102 Ga0070663_100079387 3300005455 Bacteria 2407
103 Ga0070678_100001825 3300005456 Bacteria 11477
104 Ga0070678_100270201 3300005456 Bacteria 1433
105 Ga0070662_100012447 3300005457 Bacteria 5642
106 Ga0070662_100034273 3300005457 Bacteria 3579
107 Ga0070681_10002373 3300005458 Bacteria 17193
108 Ga0068867_100014198 3300005459 Bacteria 5642
109 Ga0070685_10001615 3300005466 Bacteria 11893
110 Ga0070685_10044374 3300005466 Bacteria 2544
111 Ga0070707_100206813 3300005468 Bacteria 1913
112 Ga0070679_100019790 3300005530 Bacteria 6553
113 Ga0070679_100066291 3300005530 Bacteria 3599
114 Ga0070679_100115125 3300005530 Bacteria 2674
115 Ga0070679_100134125 3300005530 Bacteria 2457
116 Ga0070679_100178858 3300005530 Bacteria 2094
117 Ga0070684_100000824 3300005535 Bacteria 21702
118 Ga0070684_100067168 3300005535 Bacteria 3149
119 Ga0070697_100022252 3300005536 Bacteria 5030
120 Ga0068853_100008991 3300005539 Bacteria 8045
121 Ga0068853_100056661 3300005539 Bacteria 3381
122 Ga0070672_100001528 3300005543 Bacteria 14331
123 Ga0070672_100040178 3300005543 Bacteria 3587
124 Ga0070672_100155873 3300005543 Bacteria 1892
125 Ga0070686_100001579 3300005544 Bacteria 12800
126 Ga0070686_100072296 3300005544 Bacteria 2261
127 Ga0070695_100004477 3300005545 Bacteria 8210
128 Ga0070695_100109476 3300005545 Bacteria 1872
129 Ga0070696_100043810 3300005546 Bacteria 3097
130 Ga0070693_100022156 3300005547 Bacteria 3373
131 Ga0070693_100077823 3300005547 Bacteria 1969
132 Ga0070665_100007463 3300005548 Bacteria 11122
133 Ga0070665_100033352 3300005548 Bacteria 5181
134 Ga0070704_100000648 3300005549 Bacteria 16785
135 Ga0068855_100010706 3300005563 Bacteria 11066
136 Ga0068855_100024952 3300005563 Bacteria 7154
137 Ga0068855_100051469 3300005563 Bacteria 4851
138 Ga0068855_100100727 3300005563 Bacteria 3326
139 Ga0070664_100001399 3300005564 Bacteria 19241
140 Ga0070664_100015707 3300005564 Bacteria 6197
141 Ga0068857_100002108 3300005577 Bacteria 16166
142 Ga0068854_100001344 3300005578 Bacteria 14812
143 Ga0068854_100104720 3300005578 Bacteria 2126
144 Ga0068856_100001625 3300005614 Bacteria 23533
145 Ga0070702_100000539 3300005615 Bacteria 13682
146 Ga0070702_100011853 3300005615 Bacteria 4348
147 Ga0070702_100040035 3300005615 Bacteria 2619
148 Ga0068852_100003265 3300005616 Bacteria 11323
149 Ga0068859_100000920 3300005617 Bacteria 30125
150 Ga0068859_100037502 3300005617 Bacteria 4864
151 Ga0068864_100000735 3300005618 Bacteria 27446
152 Ga0068864_100023453 3300005618 Bacteria 5182
153 Ga0068866_10000295 3300005718 Bacteria 23724
154 Ga0068861_100013901 3300005719 Bacteria 5642
155 Ga0068870_10000025 3300005840 Bacteria 46848
156 Ga0068863_100001734 3300005841 Bacteria 21588
157 Ga0068863_100053884 3300005841 Bacteria 3812
158 Ga0068863_100071901 3300005841 Bacteria 3273
159 Ga0068858_100010777 3300005842 Bacteria 8644
160 Ga0068858_100015489 3300005842 Bacteria 7170
161 Ga0068858_100147722 3300005842 Bacteria 2208
162 Ga0068858_100184444 3300005842 Bacteria 1971
163 Ga0068860_100004928 3300005843 Bacteria 13606
164 Ga0068860_100051751 3300005843 Bacteria 3906
165 Ga0068862_100011514 3300005844 Bacteria 7301
166 Ga0081455_10000059 3300005937 Bacteria 119148
167 Ga0081455_10005762 3300005937 Bacteria 13507
168 Ga0081455_10010795 3300005937 Bacteria 9232
169 Ga0081539_10001975 3300005985 Bacteria 31233
170 Ga0070717_10089838 3300006028 Bacteria 2592
171 Ga0075365_10004224 3300006038 Bacteria 7572
172 Ga0075365_10099692 3300006038 Bacteria 1988
173 Ga0075363_100001522 3300006048 Bacteria 8872
174 Ga0075363_100005125 3300006048 Bacteria 5796
175 Ga0075364_10007639 3300006051 Bacteria 6430
176 Ga0075364_10010292 3300006051 Bacteria 5644
177 Ga0075432_10021456 3300006058 Bacteria 2208
178 Ga0070715_10001099 3300006163 Bacteria 7676
179 Ga0070716_100002384 3300006173 Bacteria 8648
180 Ga0070712_100029488 3300006175 Bacteria 3678
181 Ga0070712_100036140 3300006175 Bacteria 3359
182 Ga0075362_10011001 3300006177 Bacteria 3553
183 Ga0075362_10012248 3300006177 Bacteria 3403
184 Ga0075367_10002959 3300006178 Bacteria 7939
185 Ga0075367_10004365 3300006178 Bacteria 6896
186 Ga0075367_10021356 3300006178 Bacteria 3617
187 Ga0075369_10001020 3300006186 Bacteria 9343
188 Ga0075366_10000506 3300006195 Bacteria 18061
189 Ga0075366_10002848 3300006195 Bacteria 8960
190 Ga0097621_100001541 3300006237 Bacteria 15771
191 Ga0097621_100066859 3300006237 Bacteria 2961
192 Ga0097621_100084296 3300006237 Bacteria 2649
193 Ga0068871_100000269 3300006358 Bacteria 35773
194 Ga0068871_100178102 3300006358 Bacteria 1826
195 Ga0075428_100153922 3300006844 Bacteria 2498
196 Ga0075430_100000092 3300006846 Bacteria 52226
197 Ga0075433_10005231 3300006852 Bacteria 10170
198 Ga0075434_100002566 3300006871 Bacteria 16037
199 Ga0075434_100096535 3300006871 Bacteria 2960
200 Ga0075434_100165446 3300006871 Bacteria 2232
201 Ga0068865_100005241 3300006881 Bacteria 7838
202 Ga0068865_100005256 3300006881 Bacteria 7826
203 Ga0075436_100067408 3300006914 Bacteria 2474
204 Ga0097620_100000920 3300006931 Bacteria 30125
205 Ga0097620_100037500 3300006931 Bacteria 4864
206 Ga0105244_10072815 3300009036 Bacteria 1711
207 Ga0105250_10018675 3300009092 Bacteria 2806
208 Ga0105240_10042112 3300009093 Bacteria 5822
209 Ga0105240_10046066 3300009093 Bacteria 5528
210 Ga0105240_10122877 3300009093 Bacteria 3124
211 Ga0105240_10160239 3300009093 Bacteria 2673
212 Ga0111539_10002201 3300009094 Bacteria 26028
213 Ga0111539_10054530 3300009094 Bacteria 4756
214 Ga0111539_10181354 3300009094 Bacteria 2459
215 Ga0105245_10000183 3300009098 Bacteria 59105
216 Ga0105245_10004710 3300009098 Bacteria 12058
217 Ga0105245_10023267 3300009098 Bacteria 5439
218 Ga0105247_10000713 3300009101 Bacteria 25918
219 Ga0105247_10006037 3300009101 Bacteria 7535
220 Ga0105247_10011128 3300009101 Bacteria 5425
221 Ga0114129_10112707 3300009147 Bacteria 3751
222 Ga0114129_10291300 3300009147 Bacteria 2178
223 Ga0114129_10323247 3300009147 Bacteria 2051
224 Ga0114129_10495763 3300009147 Bacteria 1596
225 Ga0105243_10002342 3300009148 Bacteria 15854
226 Ga0105243_10047328 3300009148 Bacteria 3385
227 Ga0105243_10311957 3300009148 Bacteria 1430
228 Ga0105241_10002242 3300009174 Bacteria 14536
229 Ga0105241_10165433 3300009174 Bacteria 1822
230 Ga0105242_10000701 3300009176 Bacteria 26184
231 Ga0105242_10021299 3300009176 Bacteria 5087
232 Ga0105242_10131556 3300009176 Bacteria 2161
233 Ga0105248_10003608 3300009177 Bacteria 17159
234 Ga0105248_10073134 3300009177 Bacteria 3852
235 Ga0105237_10159974 3300009545 Bacteria 2250
236 Ga0105249_10003039 3300009553 Bacteria 14477
237 Ga0105239_10005782 3300010375 Bacteria 14425
238 Ga0105239_10012448 3300010375 Bacteria 9475
239 Ga0105239_10150016 3300010375 Bacteria 2602
240 Ga0105246_10001519 3300011119 Bacteria 13761
241 Ga0105246_10014194 3300011119 Bacteria 5007
242 Ga0105246_10059501 3300011119 Bacteria 2651
243 Ga0157373_10003776 3300013100 Bacteria 11462
244 Ga0157373_10033473 3300013100 Bacteria 3697
245 Ga0157373_10064582 3300013100 Bacteria 2591
246 Ga0157371_10031731 3300013102 Bacteria 3805
247 Ga0157370_10014911 3300013104 Bacteria 7927
248 Ga0157370_10030956 3300013104 Bacteria 5240
249 Ga0157370_10079797 3300013104 Bacteria 3082
250 Ga0157369_10243349 3300013105 Bacteria 1879
251 Ga0157369_10294452 3300013105 Bacteria 1689
252 Ga0157374_10000463 3300013296 Bacteria 36848
253 Ga0157374_10034668 3300013296 Bacteria 4613
254 Ga0157378_10000613 3300013297 Bacteria 33512
255 Ga0163162_10001669 3300013306 Bacteria 20821
256 Ga0163162_10078440 3300013306 Bacteria 3368
257 Ga0157372_10113014 3300013307 Bacteria 3112
258 Ga0157375_10001394 3300013308 Bacteria 20868
259 Ga0157375_10012326 3300013308 Bacteria 7581
260 Ga0157375_10233009 3300013308 Bacteria 2000
261 Ga0163163_10120105 3300014325 Bacteria 2662
262 Ga0157380_10002531 3300014326 Bacteria 12345
263 Ga0157379_10000790 3300014968 Bacteria 25684
264 Ga0157376_10000811 3300014969 Bacteria 20461
265 Ga0157376_10008597 3300014969 Bacteria 7379
266 Ga0157376_10198847 3300014969 Bacteria 1842
267 Ga0163161_10002443 3300017792 Bacteria 13272
268 Ga0206356_10491682 3300020070 Bacteria 2216
269 Ga0213876_10002176 3300021384 Bacteria 11577
270 Ga0224572_1000708 3300024225 Bacteria 4285
271 Ga0209233_1005089 3300025261 Bacteria 4398
272 Ga0207666_1000033 3300025271 Bacteria 28723
273 Ga0207666_1000359 3300025271 Bacteria 6183
274 Ga0207673_1000037 3300025290 Bacteria 10478
275 Ga0207697_10000840 3300025315 Bacteria 17357
276 Ga0207697_10011257 3300025315 Bacteria 3789
277 Ga0207653_10002308 3300025885 Bacteria 6089
278 Ga0207682_10000062 3300025893 Bacteria 46841
279 Ga0207682_10000372 3300025893 Bacteria 20677
280 Ga0207692_10040899 3300025898 Bacteria 2291
281 Ga0207692_10066193 3300025898 Bacteria 1888
282 Ga0207642_10000237 3300025899 Bacteria 16465
283 Ga0207710_10006024 3300025900 Bacteria 5197
284 Ga0207710_10011581 3300025900 Bacteria 3711
285 Ga0207710_10032140 3300025900 Bacteria 2299
286 Ga0207688_10000104 3300025901 Bacteria 33727
287 Ga0207688_10056822 3300025901 Bacteria 2199
288 Ga0207680_10055966 3300025903 Bacteria 2380
289 Ga0207647_10002869 3300025904 Bacteria 12981
290 Ga0207685_10000612 3300025905 Bacteria 6253
291 Ga0207699_10002176 3300025906 Bacteria 9251
292 Ga0207699_10123103 3300025906 Bacteria 1680
293 Ga0207645_10000248 3300025907 Bacteria 44949
294 Ga0207643_10000064 3300025908 Bacteria 70490
295 Ga0207705_10093580 3300025909 Bacteria 2203
296 Ga0207654_10018510 3300025911 Bacteria 3656
297 Ga0207707_10004601 3300025912 Bacteria 12116
298 Ga0207707_10024380 3300025912 Bacteria 5293
299 Ga0207707_10026835 3300025912 Bacteria 5033
300 Ga0207707_10143698 3300025912 Bacteria 2086
301 Ga0207671_10034552 3300025914 Bacteria 3755
302 Ga0207693_10012657 3300025915 Bacteria 6815
303 Ga0207693_10018600 3300025915 Bacteria 5531
304 Ga0207660_10000194 3300025917 Bacteria 38742
305 Ga0207660_10015200 3300025917 Bacteria 5079
306 Ga0207660_10029616 3300025917 Bacteria 3758
307 Ga0207660_10079030 3300025917 Bacteria 2412
308 Ga0207662_10000134 3300025918 Bacteria 35725
309 Ga0207662_10008217 3300025918 Bacteria 5710
310 Ga0207657_10001575 3300025919 Bacteria 24490
311 Ga0207657_10027789 3300025919 Bacteria 5174
312 Ga0207649_10000234 3300025920 Bacteria 45397
313 Ga0207649_10087164 3300025920 Bacteria 2036
314 Ga0207652_10010745 3300025921 Bacteria 7371
315 Ga0207652_10157644 3300025921 Bacteria 2034
316 Ga0207681_10000861 3300025923 Bacteria 19970
317 Ga0207694_10140875 3300025924 Bacteria 1939
318 Ga0207650_10000594 3300025925 Bacteria 28969
319 Ga0207650_10064309 3300025925 Bacteria 2746
320 Ga0207650_10079355 3300025925 Bacteria 2486
321 Ga0207659_10000172 3300025926 Bacteria 38725
322 Ga0207687_10029859 3300025927 Bacteria 3670
323 Ga0207700_10013789 3300025928 Bacteria 5274
324 Ga0207664_10043755 3300025929 Bacteria 3505
325 Ga0207664_10076809 3300025929 Bacteria 2704
326 Ga0207664_10284671 3300025929 Bacteria 1451
327 Ga0207644_10002157 3300025931 Bacteria 12759
328 Ga0207644_10005690 3300025931 Bacteria 8114
329 Ga0207644_10011936 3300025931 Bacteria 5760
330 Ga0207644_10032677 3300025931 Bacteria 3632
331 Ga0207690_10001738 3300025932 Bacteria 13374
332 Ga0207706_10002014 3300025933 Bacteria 19884
333 Ga0207706_10193274 3300025933 Bacteria 1786
334 Ga0207686_10001424 3300025934 Bacteria 13556
335 Ga0207709_10001547 3300025935 Bacteria 15806
336 Ga0207670_10000987 3300025936 Bacteria 15049
337 Ga0207670_10001066 3300025936 Bacteria 14465
338 Ga0207670_10001957 3300025936 Bacteria 10798
339 Ga0207669_10000141 3300025937 Bacteria 34618
340 Ga0207704_10000670 3300025938 Bacteria 15162
341 Ga0207665_10008613 3300025939 Bacteria 6714
342 Ga0207665_10051224 3300025939 Bacteria 2778
343 Ga0207665_10054722 3300025939 Bacteria 2691
344 Ga0207691_10001233 3300025940 Bacteria 25513
345 Ga0207691_10004399 3300025940 Bacteria 13658
346 Ga0207691_10101980 3300025940 Bacteria 2560
347 Ga0207711_10003089 3300025941 Bacteria 14519
348 Ga0207711_10017141 3300025941 Bacteria 6016
349 Ga0207689_10002384 3300025942 Bacteria 17536
350 Ga0207661_10000098 3300025944 Bacteria 55518
351 Ga0207661_10014678 3300025944 Bacteria 5747
352 Ga0207679_10000174 3300025945 Bacteria 53051
353 Ga0207667_10017603 3300025949 Bacteria 8036
354 Ga0207667_10052807 3300025949 Bacteria 4278
355 Ga0207651_10000502 3300025960 Bacteria 16449
356 Ga0207651_10004819 3300025960 Bacteria 6869
357 Ga0207651_10020896 3300025960 Bacteria 3963
358 Ga0207712_10001012 3300025961 Bacteria 20023
359 Ga0207712_10001673 3300025961 Bacteria 14882
360 Ga0207712_10035556 3300025961 Bacteria 3386
361 Ga0207668_10000893 3300025972 Bacteria 18008
362 Ga0207668_10032382 3300025972 Bacteria 3454
363 Ga0207640_10000612 3300025981 Bacteria 21037
364 Ga0207640_10092927 3300025981 Bacteria 2094
365 Ga0207658_10001985 3300025986 Bacteria 15265
366 Ga0207703_10004781 3300026035 Bacteria 11039
367 Ga0207703_10008661 3300026035 Bacteria 8028
368 Ga0207703_10018167 3300026035 Bacteria 5491
369 Ga0207639_10039536 3300026041 Bacteria 3516
370 Ga0207678_10000770 3300026067 Bacteria 29248
371 Ga0207678_10010864 3300026067 Bacteria 8002
372 Ga0207678_10011630 3300026067 Bacteria 7730
373 Ga0207708_10000663 3300026075 Bacteria 26397
374 Ga0207702_10068763 3300026078 Bacteria 3043
375 Ga0207641_10000622 3300026088 Bacteria 38657
376 Ga0207641_10033995 3300026088 Bacteria 4238
377 Ga0207648_10002601 3300026089 Bacteria 19343
378 Ga0207648_10014153 3300026089 Bacteria 7377
379 Ga0207676_10001055 3300026095 Bacteria 20979
380 Ga0207676_10091161 3300026095 Bacteria 2503
381 Ga0207674_10002861 3300026116 Bacteria 21440
382 Ga0207674_10255396 3300026116 Bacteria 1700
383 Ga0207675_100015413 3300026118 Bacteria 7130
384 Ga0207683_10000763 3300026121 Bacteria 29248
385 Ga0207683_10017090 3300026121 Bacteria 6174
386 Ga0207683_10087129 3300026121 Bacteria 2777
387 Ga0207698_10013275 3300026142 Bacteria 5428
388 Ga0207698_10122134 3300026142 Bacteria 2207
389 Ga0210002_1001152 3300027617 Bacteria 3680
390 Ga0209971_1007319 3300027682 Bacteria 2619
391 Ga0209966_1000884 3300027695 Bacteria 5763
392 Ga0209966_1006283 3300027695 Bacteria 2060
393 Ga0209998_10000999 3300027717 Bacteria 7125
394 Ga0209998_10004571 3300027717 Bacteria 2936
395 Ga0209974_10000624 3300027876 Bacteria 11895
396 Ga0207428_10000513 3300027907 Bacteria 46311
397 Ga0207428_10000626 3300027907 Bacteria 41522
398 Ga0207428_10095642 3300027907 Bacteria 2301
399 Ga0268266_10004873 3300028379 Bacteria 12733
400 Ga0268266_10044608 3300028379 Bacteria 3791
401 Ga0268265_10001239 3300028380 Bacteria 22083
402 Ga0268264_10003843 3300028381 Bacteria 12883
403 Ga0265337_1001195 3300028556 Bacteria 13202
404 Ga0265338_10005417 3300028800 Bacteria 16662
405 Ga0265338_10045488 3300028800 Bacteria 4035
406 Ga0265338_10047785 3300028800 Bacteria 3903
407 Ga0265338_10142884 3300028800 Bacteria 1872
408 Ga0265330_10007719 3300031235 Bacteria 5224
409 Ga0265325_10000398 3300031241 Bacteria 30875
410 Ga0265325_10000672 3300031241 Bacteria 24929
411 Ga0265325_10005261 3300031241 Bacteria 8030
412 Ga0265325_10007938 3300031241 Bacteria 6305
413 Ga0265325_10014217 3300031241 Bacteria 4505
414 Ga0265325_10029540 3300031241 Bacteria 2946
415 Ga0265325_10036657 3300031241 Bacteria 2597
416 Ga0265340_10009167 3300031247 Bacteria 5321
417 Ga0265339_10000069 3300031249 Bacteria 90219
418 Ga0265339_10005374 3300031249 Bacteria 8531
419 Ga0265331_10011073 3300031250 Bacteria 4948
420 Ga0265316_10016882 3300031344 Bacteria 6319
421 Ga0265316_10036749 3300031344 Bacteria 3959
422 Ga0265316_10121214 3300031344 Bacteria 1975
423 Ga0265313_10000386 3300031595 Bacteria 47422
424 Ga0265313_10000525 3300031595 Bacteria 40049
425 Ga0265313_10007412 3300031595 Bacteria 7513
426 Ga0265313_10011149 3300031595 Bacteria 5604
427 Ga0265313_10011978 3300031595 Bacteria 5346
428 Ga0265313_10036840 3300031595 Bacteria 2453
429 Ga0265314_10000439 3300031711 Bacteria 55613
430 Ga0265314_10003505 3300031711 Bacteria 15140
431 Ga0265314_10097902 3300031711 Bacteria 1893
432 Ga0265342_10011895 3300031712 Bacteria 5921
433 Ga0316583_10056372 3300032133 Bacteria 1381
434 Ga0373948_0000396 3300034817 Bacteria 5359
435 Ga0373948_0005266 3300034817 Bacteria 2089
436 Ga0373950_0001525 3300034818 Bacteria 3035
437 Ga0373950_0005385 3300034818 Bacteria 1910
438 Ga0373958_0001713 3300034819 Bacteria 2977
439 Ga0373958_0013704 3300034819 Bacteria 1408
440 Ga0373959_0005522 3300034820 Bacteria 2074
441 Ga0373938_0000420 3300034957 Bacteria 6841
442 Ga0373938_0000974 3300034957 Bacteria 4593
443 Ga0373926_0017128 3300035083 Bacteria 2486
444 Ga0373929_0005765 3300035085 Bacteria 2236
445 Ga0373940_0001273 3300035088 Bacteria 4478
446 Ga0373949_0002110 3300035090 Bacteria 5225
447 Ga0373951_0002339 3300035091 Bacteria 4808
448 Ga0373952_0000215 3300035092 Bacteria 9137
449 Ga0373932_0001220 3300035112 Bacteria 7297
450 Ga0373932_0002882 3300035112 Bacteria 4247
451 Ga0373932_0035844 3300035112 Bacteria 1405
452 Ga0373936_0026195 3300035113 Bacteria 2284
453 Ga0373939_0000721 3300035114 Bacteria 8186
454 Ga0373939_0000757 3300035114 Bacteria 7975
455 Ga0373939_0001032 3300035114 Bacteria 6870
456 Ga0373939_0006944 3300035114 Bacteria 2740
457 Ga0373941_0001071 3300035115 Bacteria 5686
458 Ga0373941_0001433 3300035115 Bacteria 5033
459 Ga0373941_0001754 3300035115 Bacteria 4658
460 Ga0373941_0017337 3300035115 Bacteria 1972
461 Ga0373953_0002663 3300035117 Bacteria 5412
462 Ga0373954_0001818 3300035118 Bacteria 8796
463 Ga0373954_0015783 3300035118 Bacteria 3378
464 Ga0373957_0002575 3300035120 Bacteria 5196
465 Ga0373957_0011882 3300035120 Bacteria 2917
466 Ga0373960_0000380 3300035121 Bacteria 8617
467 Ga0373943_0075580 3300035170 Bacteria 1716
468 Ga0373946_0096365 3300035171 Bacteria 1319
469 Ga0373955_0000509 3300035172 Bacteria 16517
470 Ga0373955_0001798 3300035172 Bacteria 9210
471 Ga0373955_0065731 3300035172 Bacteria 2014
472 Ga0373942_0002101 3300035207 Bacteria 4945
473 Ga0373962_0001207 3300035242 Bacteria 6045
474 Ga0373962_0001973 3300035242 Bacteria 4893
475 Ga0373924_0016917 3300035410 Bacteria 2790
476 Ga0373924_0021458 3300035410 Bacteria 2519
477 Ga0373931_0000433 3300035691 Bacteria 16982
478 Ga0373931_0007936 3300035691 Bacteria 5021
479 Ga0373931_0009041 3300035691 Bacteria 4750
480 Ga0373931_0011167 3300035691 Bacteria 4335
481 Ga0373931_0017659 3300035691 Bacteria 3533
482 Ga0373935_0015453 3300035692 Bacteria 4615
483 Ga0373935_0022943 3300035692 Bacteria 3832
484 Ga0373935_0122374 3300035692 Bacteria 1739
485 Ga0373927_0005965 3300035695 Bacteria 8343
486 Ga0373927_0016387 3300035695 Bacteria 4888
487 Ga0373927_0172011 3300035695 Bacteria 1420
488 Ga0373933_0002323 3300035724 Bacteria 10796
489 Ga0373933_0010197 3300035724 Bacteria 5146
490 Ga0373933_0012039 3300035724 Bacteria 4777
491 Ga0373947_0007320 3300035725 Bacteria 6391
492 Ga0373947_0032752 3300035725 Bacteria 3065
493 Ga0373937_0004592 3300036401 Bacteria 11716
494 Ga0373937_0017091 3300036401 Bacteria 6452
495 Ga0373937_0018354 3300036401 Bacteria 6246
496 Ga0373925_0001273 3300037068 Bacteria 22250
497 Ga0373925_0152339 3300037068 Bacteria 1816
498 Ga0395900_0001475 3300037418 Bacteria 28056
499 Ga0395900_0104296 3300037418 Bacteria 2913
500 Ga0395898_0059148 3300037466 Bacteria 3729
501 Ga0395901_0011499 3300038443 Bacteria 8969
502 Ga0436365_0828614 3300039437 Bacteria 1618
503 Ga0436363_1535534 3300039450 Bacteria 1751
504 Ga0439448_0013246 3300042005 Bacteria 2476
505 Ga0439463_010597 3300042016 Bacteria 2265
506 Ga0466963_0003055 3300044694 Bacteria 9475
507 Ga0466957_0081931 3300044842 Bacteria 2010
508 Ga0451576_0100496 3300045051 Bacteria 3008
509 Ga0466967_0001550 3300045976 Bacteria 13463
510 Ga0495592_0013410 3300046454 Bacteria 6236
511 Ga0495603_0137776 3300046455 Bacteria 1420
512 Ga0495629_0047666 3300046459 Bacteria 3006
513 Ga0495629_0160147 3300046459 Bacteria 1564
514 Ga0495638_0026869 3300046460 Bacteria 3729
515 Ga0495651_0012307 3300046462 Bacteria 6595
516 Ga0495651_0020742 3300046462 Bacteria 5102
517 Ga0495653_0018530 3300046463 Bacteria 5651
518 Ga0495653_0120991 3300046463 Bacteria 1866
519 Ga0495662_0032078 3300046476 Bacteria 2538
520 Ga0495664_0015719 3300046477 Bacteria 4306
521 Ga0495608_0004462 3300046511 Bacteria 10003
522 Ga0495608_0028112 3300046511 Bacteria 3823
523 Ga0495608_0068574 3300046511 Bacteria 2319
524 Ga0495618_0008953 3300046514 Bacteria 6040
525 Ga0495628_0001465 3300046516 Bacteria 21652
526 Ga0495630_0085415 3300046517 Bacteria 2382
527 Ga0495652_0002359 3300046529 Bacteria 19593
528 Ga0495640_0007343 3300046533 Bacteria 8672
529 Ga0495587_0001059 3300046536 Bacteria 18102
530 Ga0495587_0022304 3300046536 Bacteria 3898
531 Ga0495645_0002006 3300046543 Bacteria 13860
532 Ga0495645_0004750 3300046543 Bacteria 9285
533 Ga0495667_0002889 3300046559 Bacteria 11519
534 Ga0495667_0005390 3300046559 Bacteria 8649
535 Ga0495667_0077906 3300046559 Bacteria 2155
536 Ga0495634_0171387 3300046642 Bacteria 1363
537 Ga0495657_0002195 3300046675 Bacteria 16535
538 Ga0495599_0002972 3300046678 Bacteria 9867
539 Ga0495623_0000278 3300046679 Bacteria 33474
540 Ga0495623_0019492 3300046679 Bacteria 4383
541 Ga0495646_0039931 3300046680 Bacteria 2892
542 Ga0495600_0006517 3300046809 Bacteria 7105
543 Ga0495600_0008729 3300046809 Bacteria 6235
544 Ga0495604_0013591 3300047317 Bacteria 6493
545 Ga0495674_0014374 3300047319 Bacteria 7411
546 Ga0495676_0073596 3300047321 Bacteria 2619
547 Ga0495680_0004174 3300047322 Bacteria 13888
548 Ga0495680_0033416 3300047322 Bacteria 4165
549 Ga0495680_0084150 3300047322 Bacteria 2397
550 Ga0495675_0001793 3300047444 Bacteria 12793
551 Ga0495675_0077175 3300047444 Bacteria 2099
552 Ga0495677_0022200 3300047445 Bacteria 2301
553 Ga0495602_0006975 3300048088 Bacteria 11864
554 Ga0495602_0012049 3300048088 Bacteria 8913
555 Ga0495602_0197540 3300048088 Bacteria 1537
556 Ga0496100_0005988 3300048903 Bacteria 6596
557 Ga0496100_0017537 3300048903 Bacteria 4228
558 Ga0496100_0018733 3300048903 Bacteria 4113
559 Ga0496100_0273364 3300048903 Bacteria 1257
560 Ga0496101_0002150 3300048904 Bacteria 12035
561 Ga0496101_0004388 3300048904 Bacteria 8868
562 Ga0496101_0033730 3300048904 Bacteria 3612
563 Ga0496102_0019788 3300048905 Bacteria 5933
564 Ga0496102_0030602 3300048905 Bacteria 4818
565 Ga0496102_0059121 3300048905 Bacteria 3504
566 Ga0496103_0002131 3300048906 Bacteria 12593
567 Ga0496104_0000126 3300048907 Bacteria 70488
568 Ga0496104_0113910 3300048907 Bacteria 2593
569 Ga0496104_0166262 3300048907 Bacteria 2116
570 Ga0496105_0000117 3300048908 Bacteria 54274
571 Ga0496105_0110194 3300048908 Bacteria 2272
572 Ga0496105_0127597 3300048908 Bacteria 2097
573 Ga0496106_0000557 3300048909 Bacteria 26528
574 Ga0496106_0008869 3300048909 Bacteria 7433
575 Ga0496106_0014245 3300048909 Bacteria 5874
576 Ga0496106_0081740 3300048909 Bacteria 2482
577 Ga0496106_0082433 3300048909 Bacteria 2472
578 Ga0496106_0106969 3300048909 Bacteria 2175
579 Ga0496107_0002524 3300048910 Bacteria 11909
580 Ga0496108_0000968 3300048911 Bacteria 22359
581 Ga0496108_0003489 3300048911 Bacteria 12599
582 Ga0496108_0003501 3300048911 Bacteria 12578
583 Ga0496108_0035554 3300048911 Bacteria 4142
584 Ga0496109_0000188 3300048912 Bacteria 61633
585 Ga0496109_0013336 3300048912 Bacteria 7124
586 Ga0496109_0042726 3300048912 Bacteria 4107
587 Ga0496109_0110838 3300048912 Bacteria 2551
588 Ga0496110_0010047 3300048913 Bacteria 7682
589 Ga0496110_0054153 3300048913 Bacteria 3528
590 Ga0496110_0164926 3300048913 Bacteria 2009
591 Ga0496111_0038892 3300048914 Bacteria 3408
592 Ga0496111_0094651 3300048914 Bacteria 2191
593 Ga0496112_0040237 3300048915 Bacteria 4570
594 Ga0496112_0081369 3300048915 Bacteria 3202
595 Ga0496113_0058680 3300048916 Bacteria 2896
596 Ga0496113_0068818 3300048916 Bacteria 2687
597 Ga0496114_0003448 3300048917 Bacteria 12128
598 Ga0496114_0005405 3300048917 Bacteria 9989
599 Ga0496114_0027537 3300048917 Bacteria 4657
600 Ga0496115_0003121 3300048918 Bacteria 11911
601 Ga0496115_0008004 3300048918 Bacteria 7801
602 Ga0496115_0147873 3300048918 Bacteria 1939
603 Ga0501031_0004746 3300049568 Bacteria 8824
604 Ga0501031_0030603 3300049568 Bacteria 3512
605 Ga0501032_0009541 3300049569 Bacteria 7036
606 Ga0501032_0013464 3300049569 Bacteria 5816
607 Ga0501032_0047941 3300049569 Bacteria 2884
608 Ga0501032_0050191 3300049569 Bacteria 2814
609 Ga0501033_0008092 3300049570 Bacteria 8147
610 Ga0501033_0014637 3300049570 Bacteria 5956
611 Ga0501034_0000734 3300049571 Bacteria 49577
612 Ga0501034_0012202 3300049571 Bacteria 8885
613 Ga0501034_0013749 3300049571 Bacteria 8326
614 Ga0501034_0019316 3300049571 Bacteria 6972
615 Ga0501034_0042997 3300049571 Bacteria 4573
616 Ga0501034_0072051 3300049571 Bacteria 3464
617 Ga0501034_0077688 3300049571 Bacteria 3325
618 Ga0501034_0182592 3300049571 Bacteria 2062
619 Ga0501036_0015123 3300049572 Bacteria 6443
620 Ga0501036_0019362 3300049572 Bacteria 5712
621 Ga0501036_0048611 3300049572 Bacteria 3591
622 Ga0501036_0085906 3300049572 Bacteria 2659
623 Ga0501036_0102253 3300049572 Bacteria 2424
624 Ga0501037_0010168 3300049573 Bacteria 6903
625 Ga0501037_0037200 3300049573 Bacteria 3587
626 Ga0501038_0004684 3300049574 Bacteria 12732
627 Ga0501038_0011385 3300049574 Bacteria 8117
628 Ga0501038_0103896 3300049574 Bacteria 2362
629 Ga0501039_0003913 3300049575 Bacteria 11187
630 Ga0501043_0005879 3300049579 Bacteria 9869
631 Ga0501043_0008823 3300049579 Bacteria 7935
632 Ga0501043_0038014 3300049579 Bacteria 3785
633 Ga0501043_0060619 3300049579 Bacteria 2970
634 Ga0501046_0083694 3300049580 Bacteria 2462
635 Ga0501047_0000124 3300049581 Bacteria 94721
636 Ga0501047_0011414 3300049581 Bacteria 8408
637 Ga0501047_0025219 3300049581 Bacteria 5712
638 Ga0501047_0081682 3300049581 Bacteria 3107
639 Ga0501047_0094214 3300049581 Bacteria 2873
640 Ga0501047_0107402 3300049581 Bacteria 2672
641 Ga0501048_0000150 3300049582 Bacteria 42721
642 Ga0501048_0255528 3300049582 Bacteria 1245
643 Ga0501067_0110123 3300049583 Bacteria 1531
644 Ga0501068_0032400 3300049584 Bacteria 3108
645 Ga0501068_0156533 3300049584 Bacteria 1435
646 Ga0501069_0005884 3300049585 Bacteria 6390
647 Ga0501069_0072256 3300049585 Bacteria 1934
648 Ga0501070_0012759 3300049586 Bacteria 7084
649 Ga0501070_0019535 3300049586 Bacteria 5682
650 Ga0501070_0023512 3300049586 Bacteria 5162
651 Ga0501070_0083322 3300049586 Bacteria 2647
652 Ga0501070_0125693 3300049586 Bacteria 2119
653 Ga0501071_0037243 3300049587 Bacteria 3472
654 Ga0501071_0168967 3300049587 Bacteria 1637
655 Ga0501072_0058824 3300049588 Bacteria 3029
656 Ga0501072_0070576 3300049588 Bacteria 2759
657 Ga0501073_0066031 3300049589 Bacteria 2522
658 Ga0501073_0069900 3300049589 Bacteria 2446
659 Ga0501074_0005366 3300049590 Bacteria 9220
660 Ga0501074_0011770 3300049590 Bacteria 6359
661 Ga0501074_0063789 3300049590 Bacteria 2653
662 Ga0501074_0182682 3300049590 Bacteria 1496
663 Ga0501076_0004081 3300049592 Bacteria 10329
664 Ga0501077_0002084 3300049593 Bacteria 12059
665 Ga0501079_0011091 3300049741 Bacteria 6874
666 Ga0501079_0035215 3300049741 Bacteria 3853
667 Ga0501080_0000074 3300049742 Bacteria 66985
668 Ga0501080_0016238 3300049742 Bacteria 6873
669 Ga0501080_0046373 3300049742 Bacteria 4046
670 Ga0501080_0104551 3300049742 Bacteria 2626
671 Ga0501080_0188714 3300049742 Bacteria 1894
672 Ga0501080_0198305 3300049742 Bacteria 1843
673 Ga0501081_0001974 3300049743 Bacteria 12773
674 Ga0501083_0001836 3300049744 Bacteria 14565
675 Ga0501083_0003149 3300049744 Bacteria 11481
676 Ga0501083_0003568 3300049744 Bacteria 10904
677 Ga0501083_0081805 3300049744 Bacteria 2140
678 Ga0501035_0001398 3300049822 Bacteria 24778
679 Ga0501044_0009883 3300049823 Bacteria 10367
680 Ga0501044_0015498 3300049823 Bacteria 8209
681 Ga0501044_0104260 3300049823 Bacteria 2850
682 nmdc:mga03683_14741_c1 3300050489 Bacteria 2554
683 nmdc:mga03683_2898_c1 3300050489 Bacteria 5410
684 nmdc:mga03n38_15987_c1 3300050490 Bacteria 2910
685 nmdc:mga03n38_28809_c1 3300050490 Bacteria 2318
686 nmdc:mga03n38_7756_c1 3300050490 Bacteria 3809
687 nmdc:mga00v17_13657_c1 3300050491 Bacteria 4514
688 nmdc:mga00v17_27398_c1 3300050491 Bacteria 3326
689 nmdc:mga0yw44_31612_c1 3300050492 Bacteria 3080
690 nmdc:mga0yw44_40189_c1 3300050492 Bacteria 2777
691 nmdc:mga0k408_1585_c1 3300050493 Bacteria 12299
692 nmdc:mga06z11_50988_c1 3300050494 Bacteria 2117
693 nmdc:mga06z11_68384_c1 3300050494 Bacteria 1872
694 nmdc:mga05p37_161164_c1 3300050507 Bacteria 2739
695 nmdc:mga05p37_169824_c1 3300050507 Bacteria 2660
696 nmdc:mga0qj67_146466_c1 3300050509 Bacteria 1915
697 nmdc:mga0qj67_55_c1 3300050509 Bacteria 83015
698 nmdc:mga06r32_269425_c1 3300050510 Bacteria 1690
699 nmdc:mga08y16_163316_c1 3300050511 Bacteria 2314
700 nmdc:mga08y16_3857_c1 3300050511 Bacteria 15589
701 nmdc:mga08y16_3921_c1 3300050511 Bacteria 15490
702 nmdc:mga0n895_1656_c1 3300050512 Bacteria 16845
703 nmdc:mga0n895_256859_c1 3300050512 Bacteria 1773
704 nmdc:mga0n895_69585_c1 3300050512 Bacteria 3487
705 nmdc:mga0a205_4564_c1 3300050515 Bacteria 12426
706 Ga0495601_0000128 3300053077 Bacteria 42850
707 Ga0495601_0003883 3300053077 Bacteria 8599
708 Ga0495601_0027145 3300053077 Bacteria 3539
709 Ga0495601_0032245 3300053077 Bacteria 3260
710 Ga0495601_0153204 3300053077 Bacteria 1505
711 Ga0495612_0000805 3300053078 Bacteria 12775
712 Ga0495612_0002131 3300053078 Bacteria 8135
713 Ga0495595_0003203 3300053084 Bacteria 6493
714 Ga0495595_0006481 3300053084 Bacteria 4776
715 Ga0495595_0011609 3300053084 Bacteria 3686
716 Ga0495619_0000016 3300053085 Bacteria 231442
717 Ga0495619_0000252 3300053085 Bacteria 38976
718 Ga0495619_0003932 3300053085 Bacteria 9547
719 Ga0500643_004418 3300053087 Bacteria 6368
720 Ga0500651_0037935 3300053093 Bacteria 3036
721 Ga0500593_000034 3300053117 Bacteria 48768
722 Ga0500593_020485 3300053117 Bacteria 2903
723 Ga0500595_000010 3300053119 Bacteria 275806
724 Ga0500652_000068 3300053131 Bacteria 45116
725 Ga0500652_007818 3300053131 Bacteria 3527
726 Ga0500568_0000002 3300053139 Bacteria 880601
727 Ga0500616_0000001 3300053153 Bacteria 1986011
728 Ga0500645_001000 3300053730 Bacteria 15943
729 Ga0501084_0027194 3300054114 Bacteria 4780
730 Ga0501084_0259018 3300054114 Bacteria 1468
731 Ga0501082_0030559 3300060353 Bacteria 4642
732 Ga0501082_0087865 3300060353 Bacteria 2682
733 Ga0466962_0042175 3300061719 Bacteria 2184
734 2643758751 2643221547 Bacteria 4740017
735 Ga0316583_10000482
736 2214831327
737 ARcpr5oldR_c000137
738 ARSoilYngRDRAFT_c00008
739 ARcpr5yngRDRAFT_c000146
740 ARSoilOldRDRAFT_c000154
741 ARSoilOldRDRAFT_c000666
742 ARCol0yngRDRAFT_1000140
743 JGI24746J21847_1002049
744 JGI24737J22298_10001160
745 JGI24750J21931_1000220
746 JGI24745J21846_1000606
747 JGI24738J21930_10000364
748 JGI24749J21850_1000110
749 JGI24744J21845_10007279
750 JGI24035J26624_1000148
751 JGI24034J26672_10010645
752 JGI24742J22300_10000903
753 Ga0065712_10002478
754 Ga0065712_10072486
755 Ga0065715_10100243
756 Ga0065715_10151640
757 Ga0070658_10004547
758 Ga0070658_10013595
759 Ga0070658_10082068
760 Ga0070676_10000591
761 Ga0070683_100002399
762 Ga0070683_100080042
763 Ga0070690_100001110
764 Ga0070690_100008673
765 Ga0070690_100025150
766 Ga0070690_100060644
767 Ga0070670_100005628
768 Ga0070670_100030015
769 Ga0070677_10001066
770 Ga0070677_10011607
771 Ga0068869_100003665
772 Ga0070666_10000759
773 Ga0070666_10042914
774 Ga0070666_10173999
775 Ga0070680_100003137
776 Ga0070680_100011487
777 Ga0070680_100014603
778 Ga0070680_100060670
779 Ga0070680_100096977
780 Ga0070682_100000961
781 Ga0070682_100105745
782 Ga0068868_100071367
783 Ga0070660_100001680
784 Ga0070660_100019659
785 Ga0070660_100036861
786 Ga0070689_100015071
787 Ga0070689_100053240
788 Ga0070691_10001100
789 Ga0070687_100000170
790 Ga0070687_100066858
791 Ga0070661_100000725
792 Ga0070692_10000703
793 Ga0070692_10009396
794 Ga0070668_100001707
795 Ga0070669_100001864
796 Ga0070675_100002550
797 Ga0070675_100043146
798 Ga0070671_100001845
799 Ga0070671_100002025
800 Ga0070671_100014200
801 Ga0070671_100019134
802 Ga0070674_100000854
803 Ga0070674_100140650
804 Ga0070673_100002424
805 Ga0070673_100010200
806 Ga0070673_100133899
807 Ga0070673_100264525
808 Ga0070688_100000605
809 Ga0070688_100023098
810 Ga0070659_100005725
811 Ga0070659_100172276
812 Ga0070667_100017465
813 Ga0070667_100101467
814 Ga0070709_10002216
815 Ga0070709_10019426
816 Ga0070709_10127923
817 Ga0070714_100011683
818 Ga0070714_100152156
819 Ga0070713_100017362
820 Ga0070713_100018752
821 Ga0070713_100020658
822 Ga0070713_100033076
823 Ga0070713_100039360
824 Ga0070713_100093741
825 Ga0070710_10002966
826 Ga0070710_10020751
827 Ga0070701_10000549
828 Ga0070711_100068609
829 Ga0070711_100258230
830 Ga0070705_100006756
831 Ga0070700_100001172
832 Ga0070694_100001934
833 Ga0070708_100034277
834 Ga0070663_100011089
835 Ga0070663_100013473
836 Ga0070663_100079387
837 Ga0070678_100001825
838 Ga0070678_100270201
839 Ga0070662_100012447
840 Ga0070662_100034273
841 Ga0070681_10002373
842 Ga0068867_100014198
843 Ga0070685_10001615
844 Ga0070685_10044374
845 Ga0070707_100206813
846 Ga0070679_100019790
847 Ga0070679_100066291
848 Ga0070679_100115125
849 Ga0070679_100134125
850 Ga0070679_100178858
851 Ga0070684_100000824
852 Ga0070684_100067168
853 Ga0070697_100022252
854 Ga0068853_100008991
855 Ga0068853_100056661
856 Ga0070672_100001528
857 Ga0070672_100040178
858 Ga0070672_100155873
859 Ga0070686_100001579
860 Ga0070686_100072296
861 Ga0070695_100004477
862 Ga0070695_100109476
863 Ga0070696_100043810
864 Ga0070693_100022156
865 Ga0070693_100077823
866 Ga0070665_100007463
867 Ga0070665_100033352
868 Ga0070704_100000648
869 Ga0068855_100010706
870 Ga0068855_100024952
871 Ga0068855_100051469
872 Ga0068855_100100727
873 Ga0070664_100001399
874 Ga0070664_100015707
875 Ga0068857_100002108
876 Ga0068854_100001344
877 Ga0068854_100104720
878 Ga0068856_100001625
879 Ga0070702_100000539
880 Ga0070702_100011853
881 Ga0070702_100040035
882 Ga0068852_100003265
883 Ga0068859_100000920
884 Ga0068859_100037502
885 Ga0068864_100000735
886 Ga0068864_100023453
887 Ga0068866_10000295
888 Ga0068861_100013901
889 Ga0068870_10000025
890 Ga0068863_100001734
891 Ga0068863_100053884
892 Ga0068863_100071901
893 Ga0068858_100010777
894 Ga0068858_100015489
895 Ga0068858_100147722
896 Ga0068858_100184444
897 Ga0068860_100004928
898 Ga0068860_100051751
899 Ga0068862_100011514
900 Ga0081455_10000059
901 Ga0081455_10005762
902 Ga0081455_10010795
903 Ga0081539_10001975
904 Ga0070717_10089838
905 Ga0075365_10004224
906 Ga0075365_10099692
907 Ga0075363_100001522
908 Ga0075363_100005125
909 Ga0075364_10007639
910 Ga0075364_10010292
911 Ga0075432_10021456
912 Ga0070715_10001099
913 Ga0070716_100002384
914 Ga0070712_100029488
915 Ga0070712_100036140
916 Ga0075362_10011001
917 Ga0075362_10012248
918 Ga0075367_10002959
919 Ga0075367_10004365
920 Ga0075367_10021356
921 Ga0075369_10001020
922 Ga0075366_10000506
923 Ga0075366_10002848
924 Ga0097621_100001541
925 Ga0097621_100066859
926 Ga0097621_100084296
927 Ga0068871_100000269
928 Ga0068871_100178102
929 Ga0075428_100153922
930 Ga0075430_100000092
931 Ga0075433_10005231
932 Ga0075434_100002566
933 Ga0075434_100096535
934 Ga0075434_100165446
935 Ga0068865_100005241
936 Ga0068865_100005256
937 Ga0075436_100067408
938 Ga0097620_100000920
939 Ga0097620_100037500
940 Ga0105244_10072815
941 Ga0105250_10018675
942 Ga0105240_10042112
943 Ga0105240_10046066
944 Ga0105240_10122877
945 Ga0105240_10160239
946 Ga0111539_10002201
947 Ga0111539_10054530
948 Ga0111539_10181354
949 Ga0105245_10000183
950 Ga0105245_10004710
951 Ga0105245_10023267
952 Ga0105247_10000713
953 Ga0105247_10006037
954 Ga0105247_10011128
955 Ga0114129_10112707
956 Ga0114129_10291300
957 Ga0114129_10323247
958 Ga0114129_10495763
959 Ga0105243_10002342
960 Ga0105243_10047328
961 Ga0105243_10311957
962 Ga0105241_10002242
963 Ga0105241_10165433
964 Ga0105242_10000701
965 Ga0105242_10021299
966 Ga0105242_10131556
967 Ga0105248_10003608
968 Ga0105248_10073134
969 Ga0105237_10159974
970 Ga0105249_10003039
971 Ga0105239_10005782
972 Ga0105239_10012448
973 Ga0105239_10150016
974 Ga0105246_10001519
975 Ga0105246_10014194
976 Ga0105246_10059501
977 Ga0157373_10003776
978 Ga0157373_10033473
979 Ga0157373_10064582
980 Ga0157371_10031731
981 Ga0157370_10014911
982 Ga0157370_10030956
983 Ga0157370_10079797
984 Ga0157369_10243349
985 Ga0157369_10294452
986 Ga0157374_10000463
987 Ga0157374_10034668
988 Ga0157378_10000613
989 Ga0163162_10001669
990 Ga0163162_10078440
991 Ga0157372_10113014
992 Ga0157375_10001394
993 Ga0157375_10012326
994 Ga0157375_10233009
995 Ga0163163_10120105
996 Ga0157380_10002531
997 Ga0157379_10000790
998 Ga0157376_10000811
999 Ga0157376_10008597
1000 Ga0157376_10198847
1001 Ga0163161_10002443
1002 Ga0206356_10491682
1003 Ga0213876_10002176
1004 Ga0224572_1000708
1005 Ga0209233_1005089
1006 Ga0207666_1000033
1007 Ga0207666_1000359
1008 Ga0207673_1000037
1009 Ga0207697_10000840
1010 Ga0207697_10011257
1011 Ga0207653_10002308
1012 Ga0207682_10000062
1013 Ga0207682_10000372
1014 Ga0207692_10040899
1015 Ga0207692_10066193
1016 Ga0207642_10000237
1017 Ga0207710_10006024
1018 Ga0207710_10011581
1019 Ga0207710_10032140
1020 Ga0207688_10000104
1021 Ga0207688_10056822
1022 Ga0207680_10055966
1023 Ga0207647_10002869
1024 Ga0207685_10000612
1025 Ga0207699_10002176
1026 Ga0207699_10123103
1027 Ga0207645_10000248
1028 Ga0207643_10000064
1029 Ga0207705_10093580
1030 Ga0207654_10018510
1031 Ga0207707_10004601
1032 Ga0207707_10024380
1033 Ga0207707_10026835
1034 Ga0207707_10143698
1035 Ga0207671_10034552
1036 Ga0207693_10012657
1037 Ga0207693_10018600
1038 Ga0207660_10000194
1039 Ga0207660_10015200
1040 Ga0207660_10029616
1041 Ga0207660_10079030
1042 Ga0207662_10000134
1043 Ga0207662_10008217
1044 Ga0207657_10001575
1045 Ga0207657_10027789
1046 Ga0207649_10000234
1047 Ga0207649_10087164
1048 Ga0207652_10010745
1049 Ga0207652_10157644
1050 Ga0207681_10000861
1051 Ga0207694_10140875
1052 Ga0207650_10000594
1053 Ga0207650_10064309
1054 Ga0207650_10079355
1055 Ga0207659_10000172
1056 Ga0207687_10029859
1057 Ga0207700_10013789
1058 Ga0207664_10043755
1059 Ga0207664_10076809
1060 Ga0207664_10284671
1061 Ga0207644_10002157
1062 Ga0207644_10005690
1063 Ga0207644_10011936
1064 Ga0207644_10032677
1065 Ga0207690_10001738
1066 Ga0207706_10002014
1067 Ga0207706_10193274
1068 Ga0207686_10001424
1069 Ga0207709_10001547
1070 Ga0207670_10000987
1071 Ga0207670_10001066
1072 Ga0207670_10001957
1073 Ga0207669_10000141
1074 Ga0207704_10000670
1075 Ga0207665_10008613
1076 Ga0207665_10051224
1077 Ga0207665_10054722
1078 Ga0207691_10001233
1079 Ga0207691_10004399
1080 Ga0207691_10101980
1081 Ga0207711_10003089
1082 Ga0207711_10017141
1083 Ga0207689_10002384
1084 Ga0207661_10000098
1085 Ga0207661_10014678
1086 Ga0207679_10000174
1087 Ga0207667_10017603
1088 Ga0207667_10052807
1089 Ga0207651_10000502
1090 Ga0207651_10004819
1091 Ga0207651_10020896
1092 Ga0207712_10001012
1093 Ga0207712_10001673
1094 Ga0207712_10035556
1095 Ga0207668_10000893
1096 Ga0207668_10032382
1097 Ga0207640_10000612
1098 Ga0207640_10092927
1099 Ga0207658_10001985
1100 Ga0207703_10004781
1101 Ga0207703_10008661
1102 Ga0207703_10018167
1103 Ga0207639_10039536
1104 Ga0207678_10000770
1105 Ga0207678_10010864
1106 Ga0207678_10011630
1107 Ga0207708_10000663
1108 Ga0207702_10068763
1109 Ga0207641_10000622
1110 Ga0207641_10033995
1111 Ga0207648_10002601
1112 Ga0207648_10014153
1113 Ga0207676_10001055
1114 Ga0207676_10091161
1115 Ga0207674_10002861
1116 Ga0207674_10255396
1117 Ga0207675_100015413
1118 Ga0207683_10000763
1119 Ga0207683_10017090
1120 Ga0207683_10087129
1121 Ga0207698_10013275
1122 Ga0207698_10122134
1123 Ga0210002_1001152
1124 Ga0209971_1007319
1125 Ga0209966_1000884
1126 Ga0209966_1006283
1127 Ga0209998_10000999
1128 Ga0209998_10004571
1129 Ga0209974_10000624
1130 Ga0207428_10000513
1131 Ga0207428_10000626
1132 Ga0207428_10095642
1133 Ga0268266_10004873
1134 Ga0268266_10044608
1135 Ga0268265_10001239
1136 Ga0268264_10003843
1137 Ga0265337_1001195
1138 Ga0265338_10005417
1139 Ga0265338_10045488
1140 Ga0265338_10047785
1141 Ga0265338_10142884
1142 Ga0265330_10007719
1143 Ga0265325_10000398
1144 Ga0265325_10000672
1145 Ga0265325_10005261
1146 Ga0265325_10007938
1147 Ga0265325_10014217
1148 Ga0265325_10029540
1149 Ga0265325_10036657
1150 Ga0265340_10009167
1151 Ga0265339_10000069
1152 Ga0265339_10005374
1153 Ga0265331_10011073
1154 Ga0265316_10016882
1155 Ga0265316_10036749
1156 Ga0265316_10121214
1157 Ga0265313_10000386
1158 Ga0265313_10000525
1159 Ga0265313_10007412
1160 Ga0265313_10011149
1161 Ga0265313_10011978
1162 Ga0265313_10036840
1163 Ga0265314_10000439
1164 Ga0265314_10003505
1165 Ga0265314_10097902
1166 Ga0265342_10011895
1167 Ga0316583_10056372
1168 Ga0373948_0000396
1169 Ga0373948_0005266
1170 Ga0373950_0001525
1171 Ga0373950_0005385
1172 Ga0373958_0001713
1173 Ga0373958_0013704
1174 Ga0373959_0005522
1175 Ga0373938_0000420
1176 Ga0373938_0000974
1177 Ga0373926_0017128
1178 Ga0373929_0005765
1179 Ga0373940_0001273
1180 Ga0373949_0002110
1181 Ga0373951_0002339
1182 Ga0373952_0000215
1183 Ga0373932_0001220
1184 Ga0373932_0002882
1185 Ga0373932_0035844
1186 Ga0373936_0026195
1187 Ga0373939_0000721
1188 Ga0373939_0000757
1189 Ga0373939_0001032
1190 Ga0373939_0006944
1191 Ga0373941_0001071
1192 Ga0373941_0001433
1193 Ga0373941_0001754
1194 Ga0373941_0017337
1195 Ga0373953_0002663
1196 Ga0373954_0001818
1197 Ga0373954_0015783
1198 Ga0373957_0002575
1199 Ga0373957_0011882
1200 Ga0373960_0000380
1201 Ga0373943_0075580
1202 Ga0373946_0096365
1203 Ga0373955_0000509
1204 Ga0373955_0001798
1205 Ga0373955_0065731
1206 Ga0373942_0002101
1207 Ga0373962_0001207
1208 Ga0373962_0001973
1209 Ga0373924_0016917
1210 Ga0373924_0021458
1211 Ga0373931_0000433
1212 Ga0373931_0007936
1213 Ga0373931_0009041
1214 Ga0373931_0011167
1215 Ga0373931_0017659
1216 Ga0373935_0015453
1217 Ga0373935_0022943
1218 Ga0373935_0122374
1219 Ga0373927_0005965
1220 Ga0373927_0016387
1221 Ga0373927_0172011
1222 Ga0373933_0002323
1223 Ga0373933_0010197
1224 Ga0373933_0012039
1225 Ga0373947_0007320
1226 Ga0373947_0032752
1227 Ga0373937_0004592
1228 Ga0373937_0017091
1229 Ga0373937_0018354
1230 Ga0373925_0001273
1231 Ga0373925_0152339
1232 Ga0395900_0001475
1233 Ga0395900_0104296
1234 Ga0395898_0059148
1235 Ga0395901_0011499
1236 Ga0436365_0828614
1237 Ga0436363_1535534
1238 Ga0439448_0013246
1239 Ga0439463_010597
1240 Ga0466963_0003055
1241 Ga0466957_0081931
1242 Ga0451576_0100496
1243 Ga0466967_0001550
1244 Ga0495592_0013410
1245 Ga0495603_0137776
1246 Ga0495629_0047666
1247 Ga0495629_0160147
1248 Ga0495638_0026869
1249 Ga0495651_0012307
1250 Ga0495651_0020742
1251 Ga0495653_0018530
1252 Ga0495653_0120991
1253 Ga0495662_0032078
1254 Ga0495664_0015719
1255 Ga0495608_0004462
1256 Ga0495608_0028112
1257 Ga0495608_0068574
1258 Ga0495618_0008953
1259 Ga0495628_0001465
1260 Ga0495630_0085415
1261 Ga0495652_0002359
1262 Ga0495640_0007343
1263 Ga0495587_0001059
1264 Ga0495587_0022304
1265 Ga0495645_0002006
1266 Ga0495645_0004750
1267 Ga0495667_0002889
1268 Ga0495667_0005390
1269 Ga0495667_0077906
1270 Ga0495634_0171387
1271 Ga0495657_0002195
1272 Ga0495599_0002972
1273 Ga0495623_0000278
1274 Ga0495623_0019492
1275 Ga0495646_0039931
1276 Ga0495600_0006517
1277 Ga0495600_0008729
1278 Ga0495604_0013591
1279 Ga0495674_0014374
1280 Ga0495676_0073596
1281 Ga0495680_0004174
1282 Ga0495680_0033416
1283 Ga0495680_0084150
1284 Ga0495675_0001793
1285 Ga0495675_0077175
1286 Ga0495677_0022200
1287 Ga0495602_0006975
1288 Ga0495602_0012049
1289 Ga0495602_0197540
1290 Ga0496100_0005988
1291 Ga0496100_0017537
1292 Ga0496100_0018733
1293 Ga0496100_0273364
1294 Ga0496101_0002150
1295 Ga0496101_0004388
1296 Ga0496101_0033730
1297 Ga0496102_0019788
1298 Ga0496102_0030602
1299 Ga0496102_0059121
1300 Ga0496103_0002131
1301 Ga0496104_0000126
1302 Ga0496104_0113910
1303 Ga0496104_0166262
1304 Ga0496105_0000117
1305 Ga0496105_0110194
1306 Ga0496105_0127597
1307 Ga0496106_0000557
1308 Ga0496106_0008869
1309 Ga0496106_0014245
1310 Ga0496106_0081740
1311 Ga0496106_0082433
1312 Ga0496106_0106969
1313 Ga0496107_0002524
1314 Ga0496108_0000968
1315 Ga0496108_0003489
1316 Ga0496108_0003501
1317 Ga0496108_0035554
1318 Ga0496109_0000188
1319 Ga0496109_0013336
1320 Ga0496109_0042726
1321 Ga0496109_0110838
1322 Ga0496110_0010047
1323 Ga0496110_0054153
1324 Ga0496110_0164926
1325 Ga0496111_0038892
1326 Ga0496111_0094651
1327 Ga0496112_0040237
1328 Ga0496112_0081369
1329 Ga0496113_0058680
1330 Ga0496113_0068818
1331 Ga0496114_0003448
1332 Ga0496114_0005405
1333 Ga0496114_0027537
1334 Ga0496115_0003121
1335 Ga0496115_0008004
1336 Ga0496115_0147873
1337 Ga0501031_0004746
1338 Ga0501031_0030603
1339 Ga0501032_0009541
1340 Ga0501032_0013464
1341 Ga0501032_0047941
1342 Ga0501032_0050191
1343 Ga0501033_0008092
1344 Ga0501033_0014637
1345 Ga0501034_0000734
1346 Ga0501034_0012202
1347 Ga0501034_0013749
1348 Ga0501034_0019316
1349 Ga0501034_0042997
1350 Ga0501034_0072051
1351 Ga0501034_0077688
1352 Ga0501034_0182592
1353 Ga0501036_0015123
1354 Ga0501036_0019362
1355 Ga0501036_0048611
1356 Ga0501036_0085906
1357 Ga0501036_0102253
1358 Ga0501037_0010168
1359 Ga0501037_0037200
1360 Ga0501038_0004684
1361 Ga0501038_0011385
1362 Ga0501038_0103896
1363 Ga0501039_0003913
1364 Ga0501043_0005879
1365 Ga0501043_0008823
1366 Ga0501043_0038014
1367 Ga0501043_0060619
1368 Ga0501046_0083694
1369 Ga0501047_0000124
1370 Ga0501047_0011414
1371 Ga0501047_0025219
1372 Ga0501047_0081682
1373 Ga0501047_0094214
1374 Ga0501047_0107402
1375 Ga0501048_0000150
1376 Ga0501048_0255528
1377 Ga0501067_0110123
1378 Ga0501068_0032400
1379 Ga0501068_0156533
1380 Ga0501069_0005884
1381 Ga0501069_0072256
1382 Ga0501070_0012759
1383 Ga0501070_0019535
1384 Ga0501070_0023512
1385 Ga0501070_0083322
1386 Ga0501070_0125693
1387 Ga0501071_0037243
1388 Ga0501071_0168967
1389 Ga0501072_0058824
1390 Ga0501072_0070576
1391 Ga0501073_0066031
1392 Ga0501073_0069900
1393 Ga0501074_0005366
1394 Ga0501074_0011770
1395 Ga0501074_0063789
1396 Ga0501074_0182682
1397 Ga0501076_0004081
1398 Ga0501077_0002084
1399 Ga0501079_0011091
1400 Ga0501079_0035215
1401 Ga0501080_0000074
1402 Ga0501080_0016238
1403 Ga0501080_0046373
1404 Ga0501080_0104551
1405 Ga0501080_0188714
1406 Ga0501080_0198305
1407 Ga0501081_0001974
1408 Ga0501083_0001836
1409 Ga0501083_0003149
1410 Ga0501083_0003568
1411 Ga0501083_0081805
1412 Ga0501035_0001398
1413 Ga0501044_0009883
1414 Ga0501044_0015498
1415 Ga0501044_0104260
1416 nmdc:mga03683_14741_c1
1417 nmdc:mga03683_2898_c1
1418 nmdc:mga03n38_15987_c1
1419 nmdc:mga03n38_28809_c1
1420 nmdc:mga03n38_7756_c1
1421 nmdc:mga00v17_13657_c1
1422 nmdc:mga00v17_27398_c1
1423 nmdc:mga0yw44_31612_c1
1424 nmdc:mga0yw44_40189_c1
1425 nmdc:mga0k408_1585_c1
1426 nmdc:mga06z11_50988_c1
1427 nmdc:mga06z11_68384_c1
1428 nmdc:mga05p37_161164_c1
1429 nmdc:mga05p37_169824_c1
1430 nmdc:mga0qj67_146466_c1
1431 nmdc:mga0qj67_55_c1
1432 nmdc:mga06r32_269425_c1
1433 nmdc:mga08y16_163316_c1
1434 nmdc:mga08y16_3857_c1
1435 nmdc:mga08y16_3921_c1
1436 nmdc:mga0n895_1656_c1
1437 nmdc:mga0n895_256859_c1
1438 nmdc:mga0n895_69585_c1
1439 nmdc:mga0a205_4564_c1
1440 Ga0495601_0000128
1441 Ga0495601_0003883
1442 Ga0495601_0027145
1443 Ga0495601_0032245
1444 Ga0495601_0153204
1445 Ga0495612_0000805
1446 Ga0495612_0002131
1447 Ga0495595_0003203
1448 Ga0495595_0006481
1449 Ga0495595_0011609
1450 Ga0495619_0000016
1451 Ga0495619_0000252
1452 Ga0495619_0003932
1453 Ga0500643_004418
1454 Ga0500651_0037935
1455 Ga0500593_000034
1456 Ga0500593_020485
1457 Ga0500595_000010
1458 Ga0500652_000068
1459 Ga0500652_007818
1460 Ga0500568_0000002
1461 Ga0500616_0000001
1462 Ga0500645_001000
1463 Ga0501084_0027194
1464 Ga0501084_0259018
1465 Ga0501082_0030559
1466 Ga0501082_0087865
1467 Ga0466962_0042175
1468 2643758751

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4myr-assembly4.cif.gz_D crystal structure of a putative cpae2 pilus assembly protein (cpae2) from sinorhizobium meliloti 1021 at 2.72 a resolution (psi community target, shapiro) 0.9665 35 155
4n0p-assembly5.cif.gz_E crystal structure of a pilus assembly protein cpae (cc_2943) from caulobacter crescentus cb15 at 1.75 a resolution (psi community target, shapiro) 0.9627 33 155
4n0p-assembly5.cif.gz_E crystal structure of a pilus assembly protein cpae (cc_2943) from caulobacter crescentus cb15 at 1.75 a resolution (psi community target, shapiro) 0.9552 33 155
4myr-assembly4.cif.gz_D crystal structure of a putative cpae2 pilus assembly protein (cpae2) from sinorhizobium meliloti 1021 at 2.72 a resolution (psi community target, shapiro) 0.9512 35 155
4n0p-assembly2.cif.gz_B crystal structure of a pilus assembly protein cpae (cc_2943) from caulobacter crescentus cb15 at 1.75 a resolution (psi community target, shapiro) 0.9447 27 155
ID Description Score Start End Superfamily
4n0pE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9626 33 155 3.40.50.2300
4n0pE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9551 33 155 3.40.50.2300
4myrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9536 35 155 3.40.50.2300
4myrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.938 35 155 3.40.50.2300
3cz5B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.7985 32 151 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A528N414-F1-model_v4 CtpF protein 0.9776 30 116
AF-A0A528N414-F1-model_v4 CtpF protein 0.9354 30 116
AF-A0A2J0YSI0-F1-model_v4 CtpF protein 0.8611 267 389 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782
AF-A0A3B9GYP9-F1-model_v4 Pilus assembly protein CpaE 0.8358 287 414
AF-A0A1G3IPY6-F1-model_v4 AAA domain-containing protein 0.8271 32 429 GO:0005524
GO:0005829
GO:0009898
GO:0016887
GO:0051782

Map