F478158
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 734 | 332 | 713 | 250 |
Family's Representative Sequence
| Representative Sequence | 3300038443|Ga0395901_0016643|Ga0395901_0016643_1081_1836 |
| Length | 251 |
| Sequence | MKILVPVKRVVDYNVKVRVKSDGSGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEIVAVSCGVTQCQETLRTAMAIGADRAILVETPADLELQPLAVAKLLKAVVDKEQPQLVILGKQAIDDDCNQTGQMLAALLDWPQATFASKLTVADGKASVTREVDGGLETLSLTLPAIVTTDLRLNEPRYVTLPNIMKAKKKPLDTVQPADLGVDVAPRLKTLKVAEPPKRSAGIKVPDVATLVDKLKNEAKVI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 2 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 3 | 2595698237 | Methylobacterium sp. UNCCL125 | Isolate | Unclassified |
| 4 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 5 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 6 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 7 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 8 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 9 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 10 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 11 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 12 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 13 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 14 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 15 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 16 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 17 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 18 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 19 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 119 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 125 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 128 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 195 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 198 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 200 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 201 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 210 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 215 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 219 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 220 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 225 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 226 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 227 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 228 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 229 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 230 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 231 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 232 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 233 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 234 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 235 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 236 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 237 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 238 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 239 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 240 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 241 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 242 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 243 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 244 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 245 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 246 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 279 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 280 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 281 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 282 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 283 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 284 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 285 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 310 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 311 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 312 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 319 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 320 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 321 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 322 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 323 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 324 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 325 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 326 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 327 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 328 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 331 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 332 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97 |
| Metatranscriptomes | 0.14 |
| Isolates | 2.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.86 |
| Nodule | 0.41 |
| Rhizoplane | 2.32 |
| Rhizosphere | 89.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10078825 | 3300001979 | Bacteria | 867 |
| 2 | Ga0070658_10007411 | 3300005327 | Bacteria | 8859 |
| 3 | Ga0070676_10010301 | 3300005328 | Bacteria | 5069 |
| 4 | Ga0070676_10169957 | 3300005328 | Bacteria | 1409 |
| 5 | Ga0070676_10239067 | 3300005328 | Bacteria | 1207 |
| 6 | Ga0070683_100008427 | 3300005329 | Bacteria | 8756 |
| 7 | Ga0070690_100056989 | 3300005330 | Bacteria | 2507 |
| 8 | Ga0070670_100192158 | 3300005331 | Bacteria | 1773 |
| 9 | Ga0070670_100257209 | 3300005331 | Bacteria | 1522 |
| 10 | Ga0070677_10000303 | 3300005333 | Bacteria | 17204 |
| 11 | Ga0070677_10020974 | 3300005333 | Bacteria | 2390 |
| 12 | Ga0068869_100066857 | 3300005334 | Bacteria | 2650 |
| 13 | Ga0070666_10007495 | 3300005335 | Bacteria | 6726 |
| 14 | Ga0070666_10010571 | 3300005335 | Bacteria | 5776 |
| 15 | Ga0070666_10371291 | 3300005335 | Bacteria | 1026 |
| 16 | Ga0070680_100073271 | 3300005336 | Bacteria | 2816 |
| 17 | Ga0068868_100000202 | 3300005338 | Bacteria | 40069 |
| 18 | Ga0068868_100426788 | 3300005338 | Bacteria | 1149 |
| 19 | Ga0068868_100551771 | 3300005338 | Bacteria | 1016 |
| 20 | Ga0070660_100004342 | 3300005339 | Bacteria | 9795 |
| 21 | Ga0070660_100012151 | 3300005339 | Bacteria | 6148 |
| 22 | Ga0070660_100054219 | 3300005339 | Bacteria | 3095 |
| 23 | Ga0070660_100063163 | 3300005339 | Bacteria | 2878 |
| 24 | Ga0070660_100166387 | 3300005339 | Bacteria | 1779 |
| 25 | Ga0070689_100068704 | 3300005340 | Bacteria | 2764 |
| 26 | Ga0070689_100084918 | 3300005340 | Bacteria | 2489 |
| 27 | Ga0070689_100517755 | 3300005340 | Bacteria | 1024 |
| 28 | Ga0070661_100002674 | 3300005344 | Bacteria | 12199 |
| 29 | Ga0070661_100005346 | 3300005344 | Bacteria | 8859 |
| 30 | Ga0070661_100053473 | 3300005344 | Bacteria | 2956 |
| 31 | Ga0070661_100189793 | 3300005344 | Bacteria | 1567 |
| 32 | Ga0070661_100234980 | 3300005344 | Bacteria | 1410 |
| 33 | Ga0070692_10012611 | 3300005345 | Bacteria | 3918 |
| 34 | Ga0070668_100001226 | 3300005347 | Bacteria | 18239 |
| 35 | Ga0070668_100013228 | 3300005347 | Bacteria | 6155 |
| 36 | Ga0070668_100021611 | 3300005347 | Bacteria | 4861 |
| 37 | Ga0070668_100030266 | 3300005347 | Bacteria | 4116 |
| 38 | Ga0070668_100321385 | 3300005347 | Bacteria | 1303 |
| 39 | Ga0070669_100011290 | 3300005353 | Bacteria | 6342 |
| 40 | Ga0070669_100135950 | 3300005353 | Bacteria | 1891 |
| 41 | Ga0070675_100004894 | 3300005354 | Bacteria | 10218 |
| 42 | Ga0070675_100018428 | 3300005354 | Bacteria | 5555 |
| 43 | Ga0070675_100020120 | 3300005354 | Bacteria | 5325 |
| 44 | Ga0070675_100028350 | 3300005354 | Bacteria | 4507 |
| 45 | Ga0070675_100189929 | 3300005354 | Bacteria | 1779 |
| 46 | Ga0070671_100005030 | 3300005355 | Bacteria | 10541 |
| 47 | Ga0070671_100007991 | 3300005355 | Bacteria | 8466 |
| 48 | Ga0070671_100083526 | 3300005355 | Bacteria | 2670 |
| 49 | Ga0070674_100000310 | 3300005356 | Bacteria | 23996 |
| 50 | Ga0070674_100040277 | 3300005356 | Bacteria | 3160 |
| 51 | Ga0070674_100091895 | 3300005356 | Bacteria | 2193 |
| 52 | Ga0070674_100138643 | 3300005356 | Bacteria | 1823 |
| 53 | Ga0070673_100000377 | 3300005364 | Bacteria | 23358 |
| 54 | Ga0070673_100015977 | 3300005364 | Bacteria | 5291 |
| 55 | Ga0070673_100024384 | 3300005364 | Bacteria | 4435 |
| 56 | Ga0070673_100035279 | 3300005364 | Bacteria | 3791 |
| 57 | Ga0070673_100045407 | 3300005364 | Bacteria | 3407 |
| 58 | Ga0070673_100171359 | 3300005364 | Bacteria | 1853 |
| 59 | Ga0070659_100002822 | 3300005366 | Bacteria | 12364 |
| 60 | Ga0070659_100039163 | 3300005366 | Bacteria | 3699 |
| 61 | Ga0070659_100171595 | 3300005366 | Bacteria | 1777 |
| 62 | Ga0070667_100009129 | 3300005367 | Bacteria | 8205 |
| 63 | Ga0070667_100021029 | 3300005367 | Bacteria | 5421 |
| 64 | Ga0070667_100126024 | 3300005367 | Bacteria | 2231 |
| 65 | Ga0070667_100322824 | 3300005367 | Bacteria | 1393 |
| 66 | Ga0070709_10032614 | 3300005434 | Bacteria | 3142 |
| 67 | Ga0070709_10503515 | 3300005434 | Bacteria | 920 |
| 68 | Ga0070714_100001888 | 3300005435 | Bacteria | 15291 |
| 69 | Ga0070714_100112229 | 3300005435 | Bacteria | 2415 |
| 70 | Ga0070714_100143716 | 3300005435 | Bacteria | 2144 |
| 71 | Ga0070714_100448063 | 3300005435 | Bacteria | 1226 |
| 72 | Ga0070713_100051580 | 3300005436 | Bacteria | 3402 |
| 73 | Ga0070710_10013243 | 3300005437 | Bacteria | 4124 |
| 74 | Ga0070705_100107555 | 3300005440 | Bacteria | 1775 |
| 75 | Ga0070700_100000389 | 3300005441 | Bacteria | 22607 |
| 76 | Ga0070694_100123770 | 3300005444 | Bacteria | 1859 |
| 77 | Ga0070708_100052118 | 3300005445 | Bacteria | 3627 |
| 78 | Ga0070663_100000590 | 3300005455 | Bacteria | 19317 |
| 79 | Ga0070663_100141421 | 3300005455 | Bacteria | 1838 |
| 80 | Ga0070663_100163345 | 3300005455 | Bacteria | 1716 |
| 81 | Ga0070663_100498446 | 3300005455 | Bacteria | 1011 |
| 82 | Ga0070678_100002811 | 3300005456 | Bacteria | 9619 |
| 83 | Ga0070678_100091988 | 3300005456 | Bacteria | 2329 |
| 84 | Ga0070662_100055724 | 3300005457 | Bacteria | 2869 |
| 85 | Ga0070662_100121970 | 3300005457 | Bacteria | 1999 |
| 86 | Ga0070681_10012100 | 3300005458 | Bacteria | 8556 |
| 87 | Ga0070681_10042339 | 3300005458 | Bacteria | 4564 |
| 88 | Ga0070681_10113222 | 3300005458 | Bacteria | 2653 |
| 89 | Ga0068867_100004591 | 3300005459 | Bacteria | 9712 |
| 90 | Ga0068867_100017430 | 3300005459 | Bacteria | 5103 |
| 91 | Ga0068867_100024393 | 3300005459 | Bacteria | 4333 |
| 92 | Ga0068867_100030016 | 3300005459 | Bacteria | 3920 |
| 93 | Ga0068867_100096522 | 3300005459 | Bacteria | 2251 |
| 94 | Ga0068867_100374839 | 3300005459 | Bacteria | 1194 |
| 95 | Ga0068867_100383796 | 3300005459 | Bacteria | 1181 |
| 96 | Ga0070685_10014848 | 3300005466 | Bacteria | 4130 |
| 97 | Ga0070706_100144128 | 3300005467 | Bacteria | 2224 |
| 98 | Ga0070706_100167220 | 3300005467 | Bacteria | 2053 |
| 99 | Ga0070706_100241043 | 3300005467 | Bacteria | 1688 |
| 100 | Ga0070698_100003313 | 3300005471 | Bacteria | 17719 |
| 101 | Ga0070698_100366248 | 3300005471 | Bacteria | 1373 |
| 102 | Ga0070699_100001885 | 3300005518 | Bacteria | 18942 |
| 103 | Ga0070699_100024597 | 3300005518 | Bacteria | 5191 |
| 104 | Ga0070679_100005852 | 3300005530 | Bacteria | 11410 |
| 105 | Ga0070679_100007564 | 3300005530 | Bacteria | 10161 |
| 106 | Ga0070679_100021550 | 3300005530 | Bacteria | 6293 |
| 107 | Ga0070679_100221193 | 3300005530 | Bacteria | 1854 |
| 108 | Ga0070679_100819547 | 3300005530 | Bacteria | 874 |
| 109 | Ga0070679_100887894 | 3300005530 | Bacteria | 835 |
| 110 | Ga0070684_100001171 | 3300005535 | Bacteria | 18817 |
| 111 | Ga0070684_100005136 | 3300005535 | Bacteria | 10008 |
| 112 | Ga0070697_100104285 | 3300005536 | Bacteria | 2358 |
| 113 | Ga0068853_100001630 | 3300005539 | Bacteria | 16404 |
| 114 | Ga0068853_100053634 | 3300005539 | Bacteria | 3472 |
| 115 | Ga0068853_100082326 | 3300005539 | Bacteria | 2819 |
| 116 | Ga0068853_100119321 | 3300005539 | Bacteria | 2351 |
| 117 | Ga0068853_100207744 | 3300005539 | Bacteria | 1784 |
| 118 | Ga0068853_100255155 | 3300005539 | Bacteria | 1611 |
| 119 | Ga0068853_100349604 | 3300005539 | Bacteria | 1375 |
| 120 | Ga0068853_100582658 | 3300005539 | Bacteria | 1062 |
| 121 | Ga0070672_100000154 | 3300005543 | Bacteria | 37910 |
| 122 | Ga0070672_100012524 | 3300005543 | Bacteria | 5959 |
| 123 | Ga0070672_100028014 | 3300005543 | Bacteria | 4210 |
| 124 | Ga0070672_100030677 | 3300005543 | Bacteria | 4041 |
| 125 | Ga0070672_100036976 | 3300005543 | Bacteria | 3723 |
| 126 | Ga0070672_100055143 | 3300005543 | Bacteria | 3113 |
| 127 | Ga0070672_100118285 | 3300005543 | Bacteria | 2167 |
| 128 | Ga0070672_100169363 | 3300005543 | Bacteria | 1816 |
| 129 | Ga0070695_100095318 | 3300005545 | Bacteria | 1994 |
| 130 | Ga0070696_100068958 | 3300005546 | Bacteria | 2484 |
| 131 | Ga0070696_100075437 | 3300005546 | Bacteria | 2379 |
| 132 | Ga0070696_100144725 | 3300005546 | Bacteria | 1740 |
| 133 | Ga0070693_100000664 | 3300005547 | Bacteria | 15219 |
| 134 | Ga0070693_100029155 | 3300005547 | Bacteria | 3008 |
| 135 | Ga0070665_100001485 | 3300005548 | Bacteria | 27386 |
| 136 | Ga0070665_100002599 | 3300005548 | Bacteria | 19719 |
| 137 | Ga0070665_100016813 | 3300005548 | Bacteria | 7334 |
| 138 | Ga0070665_100113299 | 3300005548 | Bacteria | 2715 |
| 139 | Ga0070665_100453913 | 3300005548 | Bacteria | 1291 |
| 140 | Ga0068855_100000453 | 3300005563 | Bacteria | 50677 |
| 141 | Ga0068855_100021038 | 3300005563 | Bacteria | 7823 |
| 142 | Ga0068855_100023304 | 3300005563 | Bacteria | 7414 |
| 143 | Ga0068855_100032340 | 3300005563 | Bacteria | 6247 |
| 144 | Ga0068855_100040480 | 3300005563 | Bacteria | 5531 |
| 145 | Ga0068855_100071949 | 3300005563 | Bacteria | 4019 |
| 146 | Ga0068855_100202606 | 3300005563 | Bacteria | 2233 |
| 147 | Ga0070664_100007881 | 3300005564 | Bacteria | 8603 |
| 148 | Ga0070664_100022623 | 3300005564 | Bacteria | 5183 |
| 149 | Ga0070664_100055758 | 3300005564 | Bacteria | 3357 |
| 150 | Ga0070664_100135705 | 3300005564 | Bacteria | 2163 |
| 151 | Ga0070664_100269620 | 3300005564 | Bacteria | 1533 |
| 152 | Ga0068857_100009699 | 3300005577 | Bacteria | 8366 |
| 153 | Ga0068857_100011559 | 3300005577 | Bacteria | 7680 |
| 154 | Ga0068854_100327529 | 3300005578 | Bacteria | 1247 |
| 155 | Ga0068856_100079751 | 3300005614 | Bacteria | 3246 |
| 156 | Ga0068856_100095318 | 3300005614 | Bacteria | 2964 |
| 157 | Ga0068856_100130033 | 3300005614 | Bacteria | 2522 |
| 158 | Ga0068856_100272361 | 3300005614 | Bacteria | 1709 |
| 159 | Ga0068856_100526687 | 3300005614 | Bacteria | 1203 |
| 160 | Ga0070702_100090588 | 3300005615 | Bacteria | 1854 |
| 161 | Ga0068852_100006808 | 3300005616 | Bacteria | 8298 |
| 162 | Ga0068852_100014848 | 3300005616 | Bacteria | 6018 |
| 163 | Ga0068852_100039716 | 3300005616 | Bacteria | 3964 |
| 164 | Ga0068852_100112109 | 3300005616 | Bacteria | 2481 |
| 165 | Ga0068852_100172530 | 3300005616 | Bacteria | 2028 |
| 166 | Ga0068852_100226062 | 3300005616 | Bacteria | 1782 |
| 167 | Ga0068852_100425308 | 3300005616 | Bacteria | 1311 |
| 168 | Ga0068852_100510253 | 3300005616 | Bacteria | 1198 |
| 169 | Ga0068859_100442671 | 3300005617 | Bacteria | 1396 |
| 170 | Ga0068859_100784661 | 3300005617 | Bacteria | 1041 |
| 171 | Ga0068864_100000871 | 3300005618 | Bacteria | 25420 |
| 172 | Ga0068864_100031930 | 3300005618 | Bacteria | 4471 |
| 173 | Ga0068864_100147230 | 3300005618 | Bacteria | 2130 |
| 174 | Ga0068866_10003537 | 3300005718 | Bacteria | 6399 |
| 175 | Ga0068866_10056517 | 3300005718 | Bacteria | 2018 |
| 176 | Ga0068866_10131774 | 3300005718 | Bacteria | 1423 |
| 177 | Ga0068861_100000316 | 3300005719 | Bacteria | 27077 |
| 178 | Ga0068861_100004991 | 3300005719 | Bacteria | 8943 |
| 179 | Ga0068851_10000162 | 3300005834 | Bacteria | 34956 |
| 180 | Ga0068851_10004370 | 3300005834 | Bacteria | 6363 |
| 181 | Ga0068851_10017787 | 3300005834 | Bacteria | 3419 |
| 182 | Ga0068870_10039511 | 3300005840 | Bacteria | 2442 |
| 183 | Ga0068870_10123732 | 3300005840 | Bacteria | 1493 |
| 184 | Ga0068870_10306147 | 3300005840 | Bacteria | 1005 |
| 185 | Ga0068863_100006936 | 3300005841 | Bacteria | 11104 |
| 186 | Ga0068863_100010991 | 3300005841 | Bacteria | 8779 |
| 187 | Ga0068863_100108141 | 3300005841 | Bacteria | 2647 |
| 188 | Ga0068863_100223289 | 3300005841 | Bacteria | 1815 |
| 189 | Ga0068858_100072757 | 3300005842 | Bacteria | 3189 |
| 190 | Ga0068858_100150752 | 3300005842 | Bacteria | 2186 |
| 191 | Ga0068860_100074217 | 3300005843 | Bacteria | 3234 |
| 192 | Ga0068860_100243430 | 3300005843 | Bacteria | 1750 |
| 193 | Ga0068862_100057288 | 3300005844 | Bacteria | 3341 |
| 194 | Ga0068862_100123419 | 3300005844 | Bacteria | 2285 |
| 195 | Ga0075364_10209920 | 3300006051 | Bacteria | 1320 |
| 196 | Ga0075432_10007467 | 3300006058 | Bacteria | 3724 |
| 197 | Ga0075362_10043316 | 3300006177 | Bacteria | 1993 |
| 198 | Ga0075366_10063992 | 3300006195 | Bacteria | 2187 |
| 199 | Ga0097621_100009127 | 3300006237 | Bacteria | 7186 |
| 200 | Ga0097621_100030201 | 3300006237 | Bacteria | 4287 |
| 201 | Ga0068871_100010900 | 3300006358 | Bacteria | 6655 |
| 202 | Ga0068871_100075325 | 3300006358 | Bacteria | 2786 |
| 203 | Ga0075434_100609147 | 3300006871 | Bacteria | 1111 |
| 204 | Ga0075429_100069086 | 3300006880 | Bacteria | 3076 |
| 205 | Ga0068865_100003157 | 3300006881 | Bacteria | 9864 |
| 206 | Ga0068865_100012280 | 3300006881 | Bacteria | 5387 |
| 207 | Ga0075436_100018225 | 3300006914 | Bacteria | 4808 |
| 208 | Ga0075436_100227664 | 3300006914 | Bacteria | 1324 |
| 209 | Ga0097620_100010242 | 3300006931 | Bacteria | 9436 |
| 210 | Ga0097620_100442683 | 3300006931 | Bacteria | 1396 |
| 211 | Ga0097620_100784535 | 3300006931 | Bacteria | 1041 |
| 212 | Ga0105240_10005452 | 3300009093 | Bacteria | 18958 |
| 213 | Ga0105240_10005556 | 3300009093 | Bacteria | 18767 |
| 214 | Ga0105240_10009189 | 3300009093 | Bacteria | 14018 |
| 215 | Ga0105240_10071585 | 3300009093 | Bacteria | 4287 |
| 216 | Ga0105240_10121999 | 3300009093 | Bacteria | 3137 |
| 217 | Ga0105240_10696894 | 3300009093 | Bacteria | 1109 |
| 218 | Ga0111539_10004114 | 3300009094 | Bacteria | 19083 |
| 219 | Ga0111539_10158467 | 3300009094 | Bacteria | 2648 |
| 220 | Ga0111539_10207054 | 3300009094 | Bacteria | 2286 |
| 221 | Ga0111539_11125707 | 3300009094 | Bacteria | 912 |
| 222 | Ga0111539_11176176 | 3300009094 | Bacteria | 891 |
| 223 | Ga0105245_10108460 | 3300009098 | Bacteria | 2579 |
| 224 | Ga0105245_10202208 | 3300009098 | Bacteria | 1908 |
| 225 | Ga0105243_10038652 | 3300009148 | Bacteria | 3717 |
| 226 | Ga0105241_10001153 | 3300009174 | Bacteria | 20106 |
| 227 | Ga0105241_10286296 | 3300009174 | Bacteria | 1409 |
| 228 | Ga0105242_10002660 | 3300009176 | Bacteria | 14000 |
| 229 | Ga0105248_10015640 | 3300009177 | Bacteria | 8364 |
| 230 | Ga0105248_10096242 | 3300009177 | Bacteria | 3334 |
| 231 | Ga0105248_10237679 | 3300009177 | Bacteria | 2051 |
| 232 | Ga0105237_10006464 | 3300009545 | Bacteria | 12995 |
| 233 | Ga0105237_10261443 | 3300009545 | Bacteria | 1733 |
| 234 | Ga0105237_10299783 | 3300009545 | Bacteria | 1610 |
| 235 | Ga0105237_10423989 | 3300009545 | Bacteria | 1336 |
| 236 | Ga0105238_10002904 | 3300009551 | Bacteria | 17122 |
| 237 | Ga0105238_10014966 | 3300009551 | Bacteria | 7854 |
| 238 | Ga0105238_10070887 | 3300009551 | Bacteria | 3483 |
| 239 | Ga0105238_10085095 | 3300009551 | Bacteria | 3151 |
| 240 | Ga0105249_10050559 | 3300009553 | Bacteria | 3789 |
| 241 | Ga0105249_10714541 | 3300009553 | Bacteria | 1063 |
| 242 | Ga0099796_10143091 | 3300010159 | Bacteria | 936 |
| 243 | Ga0105239_10021891 | 3300010375 | Bacteria | 7048 |
| 244 | Ga0105239_10037066 | 3300010375 | Bacteria | 5349 |
| 245 | Ga0105239_10449320 | 3300010375 | Bacteria | 1462 |
| 246 | Ga0105239_10674763 | 3300010375 | Bacteria | 1181 |
| 247 | Ga0157373_10001625 | 3300013100 | Bacteria | 17155 |
| 248 | Ga0157373_10002315 | 3300013100 | Bacteria | 14434 |
| 249 | Ga0157373_10131286 | 3300013100 | Bacteria | 1762 |
| 250 | Ga0157371_10006118 | 3300013102 | Bacteria | 10004 |
| 251 | Ga0157371_10198392 | 3300013102 | Bacteria | 1438 |
| 252 | Ga0157370_10010719 | 3300013104 | Bacteria | 9640 |
| 253 | Ga0157370_10013088 | 3300013104 | Bacteria | 8563 |
| 254 | Ga0157370_10039789 | 3300013104 | Bacteria | 4542 |
| 255 | Ga0157370_10041188 | 3300013104 | Bacteria | 4459 |
| 256 | Ga0157370_10047695 | 3300013104 | Bacteria | 4105 |
| 257 | Ga0157370_10066646 | 3300013104 | Bacteria | 3404 |
| 258 | Ga0157370_10092245 | 3300013104 | Bacteria | 2843 |
| 259 | Ga0157370_10349031 | 3300013104 | Bacteria | 1364 |
| 260 | Ga0157370_10515518 | 3300013104 | Bacteria | 1098 |
| 261 | Ga0157369_10018507 | 3300013105 | Bacteria | 7809 |
| 262 | Ga0157369_10068397 | 3300013105 | Bacteria | 3816 |
| 263 | Ga0157369_10086410 | 3300013105 | Bacteria | 3350 |
| 264 | Ga0157369_10419440 | 3300013105 | Bacteria | 1387 |
| 265 | Ga0157374_10002469 | 3300013296 | Bacteria | 15618 |
| 266 | Ga0157374_10024112 | 3300013296 | Bacteria | 5450 |
| 267 | Ga0157374_10310029 | 3300013296 | Bacteria | 1562 |
| 268 | Ga0157374_10494809 | 3300013296 | Bacteria | 1227 |
| 269 | Ga0157374_10523599 | 3300013296 | Bacteria | 1192 |
| 270 | Ga0157378_10045990 | 3300013297 | Bacteria | 3880 |
| 271 | Ga0157378_10198283 | 3300013297 | Bacteria | 1897 |
| 272 | Ga0157378_10254941 | 3300013297 | Bacteria | 1681 |
| 273 | Ga0157378_10739708 | 3300013297 | Bacteria | 1006 |
| 274 | Ga0157378_10751920 | 3300013297 | Bacteria | 998 |
| 275 | Ga0163162_10014407 | 3300013306 | Bacteria | 7727 |
| 276 | Ga0163162_10133422 | 3300013306 | Bacteria | 2593 |
| 277 | Ga0163162_10142267 | 3300013306 | Bacteria | 2513 |
| 278 | Ga0163162_10242048 | 3300013306 | Bacteria | 1935 |
| 279 | Ga0157372_10008916 | 3300013307 | Bacteria | 10656 |
| 280 | Ga0157372_10028729 | 3300013307 | Bacteria | 6071 |
| 281 | Ga0157372_10048489 | 3300013307 | Bacteria | 4721 |
| 282 | Ga0157372_10106261 | 3300013307 | Bacteria | 3211 |
| 283 | Ga0157372_10175351 | 3300013307 | Bacteria | 2481 |
| 284 | Ga0157375_10001062 | 3300013308 | Bacteria | 23741 |
| 285 | Ga0157375_10008634 | 3300013308 | Bacteria | 8923 |
| 286 | Ga0157375_10672425 | 3300013308 | Bacteria | 1190 |
| 287 | Ga0163163_11008069 | 3300014325 | Bacteria | 896 |
| 288 | Ga0182008_10088059 | 3300014497 | Bacteria | 1530 |
| 289 | Ga0182008_10094444 | 3300014497 | Bacteria | 1475 |
| 290 | Ga0157377_10006333 | 3300014745 | Bacteria | 5637 |
| 291 | Ga0157379_10111123 | 3300014968 | Bacteria | 2461 |
| 292 | Ga0157376_10032804 | 3300014969 | Bacteria | 4173 |
| 293 | Ga0157376_10198234 | 3300014969 | Bacteria | 1845 |
| 294 | Ga0163161_10012661 | 3300017792 | Bacteria | 5859 |
| 295 | Ga0163161_10189905 | 3300017792 | Bacteria | 1579 |
| 296 | Ga0163161_10509870 | 3300017792 | Bacteria | 981 |
| 297 | Ga0206351_10961181 | 3300020077 | Eukaryota | 831 |
| 298 | Ga0213872_10000191 | 3300021361 | Bacteria | 54643 |
| 299 | Ga0213872_10134565 | 3300021361 | Bacteria | 1087 |
| 300 | Ga0213874_10019065 | 3300021377 | Bacteria | 1863 |
| 301 | Ga0213876_10010100 | 3300021384 | Bacteria | 5073 |
| 302 | Ga0213876_10128763 | 3300021384 | Bacteria | 1345 |
| 303 | Ga0213871_10005091 | 3300021441 | Bacteria | 2686 |
| 304 | Ga0213871_10020431 | 3300021441 | Bacteria | 1640 |
| 305 | Ga0209025_1000040 | 3300025294 | Bacteria | 376228 |
| 306 | Ga0207697_10005684 | 3300025315 | Bacteria | 5754 |
| 307 | Ga0207697_10199249 | 3300025315 | Bacteria | 880 |
| 308 | Ga0207656_10000949 | 3300025321 | Bacteria | 9470 |
| 309 | Ga0207656_10001351 | 3300025321 | Bacteria | 8089 |
| 310 | Ga0207656_10023192 | 3300025321 | Bacteria | 2496 |
| 311 | Ga0207656_10115911 | 3300025321 | Bacteria | 1243 |
| 312 | Ga0207682_10000069 | 3300025893 | Bacteria | 45399 |
| 313 | Ga0207682_10044012 | 3300025893 | Bacteria | 1829 |
| 314 | Ga0207642_10057581 | 3300025899 | Bacteria | 1789 |
| 315 | Ga0207688_10059946 | 3300025901 | Bacteria | 2143 |
| 316 | Ga0207680_10013991 | 3300025903 | Bacteria | 4137 |
| 317 | Ga0207680_10168905 | 3300025903 | Bacteria | 1472 |
| 318 | Ga0207699_10025473 | 3300025906 | Bacteria | 3248 |
| 319 | Ga0207645_10001232 | 3300025907 | Bacteria | 21068 |
| 320 | Ga0207645_10002497 | 3300025907 | Bacteria | 14438 |
| 321 | Ga0207645_10089973 | 3300025907 | Bacteria | 1974 |
| 322 | Ga0207705_10020554 | 3300025909 | Bacteria | 4714 |
| 323 | Ga0207705_10028966 | 3300025909 | Bacteria | 3949 |
| 324 | Ga0207705_10029460 | 3300025909 | Bacteria | 3913 |
| 325 | Ga0207705_10645846 | 3300025909 | Bacteria | 823 |
| 326 | Ga0207684_10111542 | 3300025910 | Bacteria | 2341 |
| 327 | Ga0207684_10434069 | 3300025910 | Bacteria | 1128 |
| 328 | Ga0207654_10008354 | 3300025911 | Bacteria | 5229 |
| 329 | Ga0207707_10006272 | 3300025912 | Bacteria | 10385 |
| 330 | Ga0207707_10012306 | 3300025912 | Bacteria | 7436 |
| 331 | Ga0207707_10033902 | 3300025912 | Bacteria | 4468 |
| 332 | Ga0207707_10110405 | 3300025912 | Bacteria | 2404 |
| 333 | Ga0207707_10336073 | 3300025912 | Bacteria | 1303 |
| 334 | Ga0207695_10000806 | 3300025913 | Bacteria | 58371 |
| 335 | Ga0207695_10001360 | 3300025913 | Bacteria | 41481 |
| 336 | Ga0207695_10006983 | 3300025913 | Bacteria | 14490 |
| 337 | Ga0207695_10020583 | 3300025913 | Bacteria | 7553 |
| 338 | Ga0207695_10094842 | 3300025913 | Bacteria | 2990 |
| 339 | Ga0207695_10095321 | 3300025913 | Bacteria | 2980 |
| 340 | Ga0207695_10099641 | 3300025913 | Bacteria | 2903 |
| 341 | Ga0207695_10201036 | 3300025913 | Bacteria | 1907 |
| 342 | Ga0207695_10584682 | 3300025913 | Bacteria | 998 |
| 343 | Ga0207671_10028983 | 3300025914 | Bacteria | 4135 |
| 344 | Ga0207693_10108979 | 3300025915 | Bacteria | 2172 |
| 345 | Ga0207663_10289578 | 3300025916 | Bacteria | 1219 |
| 346 | Ga0207660_10003252 | 3300025917 | Bacteria | 10643 |
| 347 | Ga0207660_10043284 | 3300025917 | Bacteria | 3164 |
| 348 | Ga0207660_10052150 | 3300025917 | Bacteria | 2911 |
| 349 | Ga0207660_10090744 | 3300025917 | Bacteria | 2264 |
| 350 | Ga0207660_10594690 | 3300025917 | Bacteria | 901 |
| 351 | Ga0207657_10000524 | 3300025919 | Bacteria | 40619 |
| 352 | Ga0207657_10022610 | 3300025919 | Bacteria | 5878 |
| 353 | Ga0207657_10122371 | 3300025919 | Bacteria | 2140 |
| 354 | Ga0207657_10167188 | 3300025919 | Bacteria | 1783 |
| 355 | Ga0207657_10269930 | 3300025919 | Bacteria | 1352 |
| 356 | Ga0207649_10002238 | 3300025920 | Bacteria | 10931 |
| 357 | Ga0207649_10015519 | 3300025920 | Bacteria | 4280 |
| 358 | Ga0207649_10225976 | 3300025920 | Bacteria | 1336 |
| 359 | Ga0207652_10008722 | 3300025921 | Bacteria | 8160 |
| 360 | Ga0207652_10058808 | 3300025921 | Bacteria | 3312 |
| 361 | Ga0207652_10059551 | 3300025921 | Bacteria | 3292 |
| 362 | Ga0207652_10136635 | 3300025921 | Bacteria | 2189 |
| 363 | Ga0207681_10013955 | 3300025923 | Bacteria | 4978 |
| 364 | Ga0207681_10104032 | 3300025923 | Bacteria | 2053 |
| 365 | Ga0207694_10001760 | 3300025924 | Bacteria | 18157 |
| 366 | Ga0207694_10004511 | 3300025924 | Bacteria | 10863 |
| 367 | Ga0207694_10146019 | 3300025924 | Bacteria | 1904 |
| 368 | Ga0207694_10180375 | 3300025924 | Bacteria | 1712 |
| 369 | Ga0207694_10240098 | 3300025924 | Bacteria | 1481 |
| 370 | Ga0207650_10005184 | 3300025925 | Bacteria | 8891 |
| 371 | Ga0207650_10008066 | 3300025925 | Bacteria | 7176 |
| 372 | Ga0207650_10133200 | 3300025925 | Bacteria | 1947 |
| 373 | Ga0207650_10593141 | 3300025925 | Bacteria | 931 |
| 374 | Ga0207659_10023091 | 3300025926 | Bacteria | 4148 |
| 375 | Ga0207659_10035920 | 3300025926 | Bacteria | 3429 |
| 376 | Ga0207687_10168112 | 3300025927 | Bacteria | 1689 |
| 377 | Ga0207687_10517100 | 3300025927 | Bacteria | 998 |
| 378 | Ga0207687_10523119 | 3300025927 | Bacteria | 992 |
| 379 | Ga0207700_10021182 | 3300025928 | Bacteria | 4432 |
| 380 | Ga0207664_10003618 | 3300025929 | Bacteria | 10344 |
| 381 | Ga0207664_10095049 | 3300025929 | Bacteria | 2451 |
| 382 | Ga0207664_10119111 | 3300025929 | Bacteria | 2207 |
| 383 | Ga0207664_10231373 | 3300025929 | Bacteria | 1607 |
| 384 | Ga0207644_10008388 | 3300025931 | Bacteria | 6762 |
| 385 | Ga0207644_10169098 | 3300025931 | Bacteria | 1705 |
| 386 | Ga0207690_10004332 | 3300025932 | Bacteria | 8383 |
| 387 | Ga0207690_10135756 | 3300025932 | Bacteria | 1806 |
| 388 | Ga0207706_10076464 | 3300025933 | Bacteria | 2944 |
| 389 | Ga0207686_10051120 | 3300025934 | Bacteria | 2573 |
| 390 | Ga0207686_10445358 | 3300025934 | Bacteria | 995 |
| 391 | Ga0207709_10002633 | 3300025935 | Bacteria | 11161 |
| 392 | Ga0207709_10102956 | 3300025935 | Bacteria | 1891 |
| 393 | Ga0207709_10558088 | 3300025935 | Bacteria | 902 |
| 394 | Ga0207670_10077452 | 3300025936 | Bacteria | 2316 |
| 395 | Ga0207670_10519936 | 3300025936 | Bacteria | 969 |
| 396 | Ga0207669_10076299 | 3300025937 | Bacteria | 2127 |
| 397 | Ga0207704_10022141 | 3300025938 | Bacteria | 3399 |
| 398 | Ga0207704_10115350 | 3300025938 | Bacteria | 1825 |
| 399 | Ga0207691_10000343 | 3300025940 | Bacteria | 46843 |
| 400 | Ga0207691_10000826 | 3300025940 | Bacteria | 30881 |
| 401 | Ga0207691_10001614 | 3300025940 | Bacteria | 22406 |
| 402 | Ga0207691_10007847 | 3300025940 | Bacteria | 10281 |
| 403 | Ga0207691_10091643 | 3300025940 | Bacteria | 2723 |
| 404 | Ga0207691_10211364 | 3300025940 | Bacteria | 1685 |
| 405 | Ga0207711_10072118 | 3300025941 | Bacteria | 2999 |
| 406 | Ga0207711_10091298 | 3300025941 | Bacteria | 2678 |
| 407 | Ga0207711_10142215 | 3300025941 | Bacteria | 2159 |
| 408 | Ga0207711_10446166 | 3300025941 | Bacteria | 1204 |
| 409 | Ga0207689_10021920 | 3300025942 | Bacteria | 5373 |
| 410 | Ga0207679_10002888 | 3300025945 | Bacteria | 10658 |
| 411 | Ga0207679_10023404 | 3300025945 | Bacteria | 4223 |
| 412 | Ga0207679_10054441 | 3300025945 | Bacteria | 2945 |
| 413 | Ga0207679_10205861 | 3300025945 | Bacteria | 1647 |
| 414 | Ga0207679_10206787 | 3300025945 | Bacteria | 1643 |
| 415 | Ga0207679_10222219 | 3300025945 | Bacteria | 1590 |
| 416 | Ga0207679_10264469 | 3300025945 | Bacteria | 1468 |
| 417 | Ga0207667_10005070 | 3300025949 | Bacteria | 16094 |
| 418 | Ga0207667_10005399 | 3300025949 | Bacteria | 15585 |
| 419 | Ga0207667_10023396 | 3300025949 | Bacteria | 6803 |
| 420 | Ga0207667_10024982 | 3300025949 | Bacteria | 6549 |
| 421 | Ga0207667_10035108 | 3300025949 | Bacteria | 5380 |
| 422 | Ga0207667_10173798 | 3300025949 | Bacteria | 2214 |
| 423 | Ga0207651_10000672 | 3300025960 | Bacteria | 14616 |
| 424 | Ga0207651_10022567 | 3300025960 | Bacteria | 3851 |
| 425 | Ga0207651_10086815 | 3300025960 | Bacteria | 2275 |
| 426 | Ga0207651_10095402 | 3300025960 | Bacteria | 2190 |
| 427 | Ga0207651_10442950 | 3300025960 | Bacteria | 1113 |
| 428 | Ga0207651_10872936 | 3300025960 | Bacteria | 800 |
| 429 | Ga0207712_10027674 | 3300025961 | Bacteria | 3787 |
| 430 | Ga0207668_10038769 | 3300025972 | Bacteria | 3201 |
| 431 | Ga0207668_10114188 | 3300025972 | Bacteria | 2032 |
| 432 | Ga0207668_10181768 | 3300025972 | Bacteria | 1659 |
| 433 | Ga0207640_10009128 | 3300025981 | Bacteria | 5538 |
| 434 | Ga0207640_10329991 | 3300025981 | Bacteria | 1218 |
| 435 | Ga0207640_10357053 | 3300025981 | Bacteria | 1176 |
| 436 | Ga0207658_10001180 | 3300025986 | Bacteria | 20855 |
| 437 | Ga0207658_10093617 | 3300025986 | Bacteria | 2336 |
| 438 | Ga0207677_10004841 | 3300026023 | Bacteria | 7265 |
| 439 | Ga0207677_10120538 | 3300026023 | Bacteria | 1972 |
| 440 | Ga0207677_10148576 | 3300026023 | Bacteria | 1804 |
| 441 | Ga0207677_10276451 | 3300026023 | Bacteria | 1376 |
| 442 | Ga0207677_10572532 | 3300026023 | Bacteria | 987 |
| 443 | Ga0207703_10062768 | 3300026035 | Bacteria | 3044 |
| 444 | Ga0207703_10162752 | 3300026035 | Bacteria | 1955 |
| 445 | Ga0207639_10042766 | 3300026041 | Bacteria | 3397 |
| 446 | Ga0207639_10154037 | 3300026041 | Bacteria | 1928 |
| 447 | Ga0207639_10217459 | 3300026041 | Bacteria | 1648 |
| 448 | Ga0207639_10273461 | 3300026041 | Bacteria | 1483 |
| 449 | Ga0207639_10276853 | 3300026041 | Bacteria | 1474 |
| 450 | Ga0207678_10000974 | 3300026067 | Bacteria | 26088 |
| 451 | Ga0207678_10111746 | 3300026067 | Bacteria | 2331 |
| 452 | Ga0207678_10172888 | 3300026067 | Bacteria | 1844 |
| 453 | Ga0207678_10599802 | 3300026067 | Bacteria | 965 |
| 454 | Ga0207708_10011960 | 3300026075 | Bacteria | 6465 |
| 455 | Ga0207702_10010434 | 3300026078 | Bacteria | 7771 |
| 456 | Ga0207702_10016629 | 3300026078 | Bacteria | 6087 |
| 457 | Ga0207702_10203534 | 3300026078 | Bacteria | 1836 |
| 458 | Ga0207702_10225287 | 3300026078 | Bacteria | 1749 |
| 459 | Ga0207702_10225422 | 3300026078 | Bacteria | 1749 |
| 460 | Ga0207702_10253264 | 3300026078 | Bacteria | 1654 |
| 461 | Ga0207702_10269471 | 3300026078 | Bacteria | 1605 |
| 462 | Ga0207641_10119950 | 3300026088 | Bacteria | 2345 |
| 463 | Ga0207641_10218621 | 3300026088 | Bacteria | 1765 |
| 464 | Ga0207648_10002497 | 3300026089 | Bacteria | 19743 |
| 465 | Ga0207648_10004228 | 3300026089 | Bacteria | 14837 |
| 466 | Ga0207648_10012406 | 3300026089 | Bacteria | 7978 |
| 467 | Ga0207648_10020098 | 3300026089 | Bacteria | 6022 |
| 468 | Ga0207648_10022240 | 3300026089 | Bacteria | 5697 |
| 469 | Ga0207648_10127594 | 3300026089 | Bacteria | 2238 |
| 470 | Ga0207648_10389729 | 3300026089 | Bacteria | 1261 |
| 471 | Ga0207648_10426923 | 3300026089 | Bacteria | 1204 |
| 472 | Ga0207676_10000548 | 3300026095 | Bacteria | 31359 |
| 473 | Ga0207676_10075779 | 3300026095 | Bacteria | 2715 |
| 474 | Ga0207676_10455771 | 3300026095 | Bacteria | 1206 |
| 475 | Ga0207674_10000045 | 3300026116 | Bacteria | 122251 |
| 476 | Ga0207674_10436833 | 3300026116 | Bacteria | 1265 |
| 477 | Ga0207675_100017006 | 3300026118 | Bacteria | 6796 |
| 478 | Ga0207675_100022734 | 3300026118 | Bacteria | 5834 |
| 479 | Ga0207675_100105148 | 3300026118 | Bacteria | 2661 |
| 480 | Ga0207683_10000009 | 3300026121 | Bacteria | 150281 |
| 481 | Ga0207683_10000182 | 3300026121 | Bacteria | 54134 |
| 482 | Ga0207683_10035293 | 3300026121 | Bacteria | 4348 |
| 483 | Ga0207698_10001283 | 3300026142 | Bacteria | 14640 |
| 484 | Ga0207698_10029233 | 3300026142 | Bacteria | 3943 |
| 485 | Ga0207698_10316101 | 3300026142 | Bacteria | 1460 |
| 486 | Ga0207698_10434707 | 3300026142 | Bacteria | 1263 |
| 487 | Ga0209984_1011506 | 3300027424 | Bacteria | 1146 |
| 488 | Ga0209974_10004711 | 3300027876 | Bacteria | 4846 |
| 489 | Ga0207428_10017142 | 3300027907 | Bacteria | 6224 |
| 490 | Ga0207428_10460627 | 3300027907 | Bacteria | 926 |
| 491 | Ga0268266_10000551 | 3300028379 | Bacteria | 52218 |
| 492 | Ga0268266_10032142 | 3300028379 | Bacteria | 4458 |
| 493 | Ga0268265_10002908 | 3300028380 | Bacteria | 12578 |
| 494 | Ga0268265_10151184 | 3300028380 | Bacteria | 1958 |
| 495 | Ga0268265_10381476 | 3300028380 | Bacteria | 1297 |
| 496 | Ga0268264_10039584 | 3300028381 | Bacteria | 3895 |
| 497 | Ga0268264_10432779 | 3300028381 | Bacteria | 1271 |
| 498 | Ga0268264_10858882 | 3300028381 | Bacteria | 909 |
| 499 | Ga0265330_10069042 | 3300031235 | Bacteria | 1530 |
| 500 | Ga0265325_10007961 | 3300031241 | Bacteria | 6294 |
| 501 | Ga0265325_10072852 | 3300031241 | Bacteria | 1721 |
| 502 | Ga0265340_10002715 | 3300031247 | Bacteria | 10073 |
| 503 | Ga0265340_10033158 | 3300031247 | Bacteria | 2573 |
| 504 | Ga0265340_10083189 | 3300031247 | Bacteria | 1504 |
| 505 | Ga0265339_10007542 | 3300031249 | Bacteria | 7014 |
| 506 | Ga0265331_10000250 | 3300031250 | Bacteria | 63883 |
| 507 | Ga0265327_10000007 | 3300031251 | Bacteria | 678515 |
| 508 | Ga0265327_10000280 | 3300031251 | Bacteria | 100757 |
| 509 | Ga0265316_10055609 | 3300031344 | Bacteria | 3094 |
| 510 | Ga0307513_10001002 | 3300031456 | Bacteria | 40842 |
| 511 | Ga0307513_10361575 | 3300031456 | Bacteria | 1196 |
| 512 | Ga0307513_10377296 | 3300031456 | Bacteria | 1158 |
| 513 | Ga0307408_100029509 | 3300031548 | Bacteria | 3801 |
| 514 | Ga0307408_100287883 | 3300031548 | Bacteria | 1371 |
| 515 | Ga0265313_10008203 | 3300031595 | Bacteria | 6978 |
| 516 | Ga0265313_10020281 | 3300031595 | Bacteria | 3671 |
| 517 | Ga0265314_10154468 | 3300031711 | Bacteria | 1403 |
| 518 | Ga0265342_10062731 | 3300031712 | Bacteria | 2186 |
| 519 | Ga0307405_10002589 | 3300031731 | Bacteria | 8020 |
| 520 | Ga0307413_10028792 | 3300031824 | Bacteria | 3100 |
| 521 | Ga0307413_10097044 | 3300031824 | Bacteria | 1937 |
| 522 | Ga0307410_10017443 | 3300031852 | Bacteria | 4312 |
| 523 | Ga0307406_10049422 | 3300031901 | Bacteria | 2661 |
| 524 | Ga0307407_10100077 | 3300031903 | Bacteria | 1797 |
| 525 | Ga0307412_10050730 | 3300031911 | Bacteria | 2740 |
| 526 | Ga0307409_100195811 | 3300031995 | Bacteria | 1803 |
| 527 | Ga0307409_100256209 | 3300031995 | Bacteria | 1603 |
| 528 | Ga0307416_100069094 | 3300032002 | Bacteria | 2922 |
| 529 | Ga0307416_100085395 | 3300032002 | Bacteria | 2686 |
| 530 | Ga0307411_10003144 | 3300032005 | Bacteria | 7573 |
| 531 | Ga0307411_10043493 | 3300032005 | Bacteria | 2874 |
| 532 | Ga0307411_10089629 | 3300032005 | Bacteria | 2143 |
| 533 | Ga0307510_10019906 | 3300033180 | Bacteria | 7860 |
| 534 | Ga0373930_0013043 | 3300034816 | Bacteria | 1526 |
| 535 | Ga0373958_0003476 | 3300034819 | Bacteria | 2274 |
| 536 | Ga0373923_0167773 | 3300035111 | Bacteria | 1004 |
| 537 | Ga0373936_0003352 | 3300035113 | Bacteria | 6002 |
| 538 | Ga0373931_0135708 | 3300035691 | Bacteria | 1420 |
| 539 | Ga0373937_0142189 | 3300036401 | Bacteria | 2245 |
| 540 | Ga0373937_0196697 | 3300036401 | Bacteria | 1895 |
| 541 | Ga0395900_0029076 | 3300037418 | Bacteria | 5669 |
| 542 | Ga0395900_0225305 | 3300037418 | Bacteria | 1888 |
| 543 | Ga0395898_0200182 | 3300037466 | Bacteria | 1907 |
| 544 | Ga0395905_0014988 | 3300037471 | Bacteria | 7393 |
| 545 | Ga0395905_0025761 | 3300037471 | Bacteria | 5545 |
| 546 | Ga0436364_0098673 | 3300037853 | Bacteria | 6312 |
| 547 | Ga0395901_0016643 | 3300038443 | Bacteria | 7491 |
| 548 | Ga0395901_0171472 | 3300038443 | Bacteria | 2277 |
| 549 | Ga0395901_0258871 | 3300038443 | Bacteria | 1811 |
| 550 | Ga0400483_041511 | 3300039062 | Bacteria | 11733 |
| 551 | Ga0400483_068901 | 3300039062 | Bacteria | 1132 |
| 552 | Ga0400483_206794 | 3300039062 | Bacteria | 8594 |
| 553 | Ga0436365_0503502 | 3300039437 | Bacteria | 2683 |
| 554 | Ga0436365_0874983 | 3300039437 | Bacteria | 53988 |
| 555 | Ga0436360_0404552 | 3300039438 | Bacteria | 2610 |
| 556 | Ga0436360_0605189 | 3300039438 | Bacteria | 1492 |
| 557 | Ga0436360_0614325 | 3300039438 | Bacteria | 2486 |
| 558 | Ga0436360_1178753 | 3300039438 | Bacteria | 8244 |
| 559 | Ga0436361_0025705 | 3300039447 | Bacteria | 809 |
| 560 | Ga0436361_0469822 | 3300039447 | Bacteria | 6391 |
| 561 | Ga0436361_0672930 | 3300039447 | Bacteria | 1141 |
| 562 | Ga0436361_0788745 | 3300039447 | Bacteria | 34906 |
| 563 | Ga0436361_0794633 | 3300039447 | Bacteria | 1356 |
| 564 | Ga0436361_0885505 | 3300039447 | Bacteria | 4065 |
| 565 | Ga0436361_1082188 | 3300039447 | Bacteria | 1795 |
| 566 | Ga0436363_0854040 | 3300039450 | Bacteria | 16936 |
| 567 | Ga0436362_0009912 | 3300039453 | Bacteria | 1529 |
| 568 | Ga0436362_1093207 | 3300039453 | Bacteria | 1383 |
| 569 | Ga0436362_1161051 | 3300039453 | Bacteria | 1132 |
| 570 | Ga0451837_0626772 | 3300041494 | Bacteria | 2044 |
| 571 | Ga0451849_1443180 | 3300041505 | Bacteria | 4173 |
| 572 | Ga0451843_1776483 | 3300041509 | Bacteria | 2786 |
| 573 | Ga0439450_009520 | 3300042008 | Bacteria | 1847 |
| 574 | Ga0466969_0000722 | 3300044656 | Bacteria | 17863 |
| 575 | Ga0466969_0114506 | 3300044656 | Bacteria | 1260 |
| 576 | Ga0466966_0005576 | 3300044684 | Bacteria | 8276 |
| 577 | Ga0466961_0001425 | 3300044693 | Bacteria | 14831 |
| 578 | Ga0466964_0072768 | 3300044706 | Bacteria | 1457 |
| 579 | Ga0466971_0009671 | 3300044719 | Bacteria | 4207 |
| 580 | Ga0466957_0029156 | 3300044842 | Bacteria | 3289 |
| 581 | Ga0466959_0000040 | 3300045049 | Bacteria | 101109 |
| 582 | Ga0451576_0233789 | 3300045051 | Bacteria | 1920 |
| 583 | Ga0466958_0026837 | 3300045836 | Bacteria | 3404 |
| 584 | Ga0466967_0115997 | 3300045976 | Bacteria | 2467 |
| 585 | Ga0495653_0020962 | 3300046463 | Bacteria | 5296 |
| 586 | Ga0495580_0007478 | 3300046472 | Bacteria | 8778 |
| 587 | Ga0495582_0025557 | 3300046473 | Bacteria | 3235 |
| 588 | Ga0495628_0004869 | 3300046516 | Bacteria | 11820 |
| 589 | Ga0495643_0014143 | 3300046522 | Bacteria | 4755 |
| 590 | Ga0495648_0030142 | 3300046524 | Bacteria | 3592 |
| 591 | Ga0495640_0148576 | 3300046533 | Bacteria | 1507 |
| 592 | Ga0495622_0000126 | 3300046557 | Bacteria | 66247 |
| 593 | Ga0495633_0094747 | 3300046558 | Bacteria | 1387 |
| 594 | Ga0495656_0019662 | 3300046615 | Bacteria | 2609 |
| 595 | Ga0495668_0153531 | 3300046616 | Bacteria | 1261 |
| 596 | Ga0495634_0142013 | 3300046642 | Bacteria | 1524 |
| 597 | Ga0495659_0019428 | 3300046664 | Bacteria | 2274 |
| 598 | Ga0495646_0058453 | 3300046680 | Bacteria | 2305 |
| 599 | Ga0495658_0112940 | 3300046683 | Bacteria | 1635 |
| 600 | Ga0495624_0003707 | 3300046690 | Bacteria | 11296 |
| 601 | Ga0495624_0059831 | 3300046690 | Bacteria | 2389 |
| 602 | Ga0495660_0012577 | 3300046810 | Bacteria | 4913 |
| 603 | Ga0495672_0024117 | 3300047320 | Bacteria | 3926 |
| 604 | Ga0495676_0027671 | 3300047321 | Bacteria | 4858 |
| 605 | Ga0495680_0182815 | 3300047322 | Bacteria | 1512 |
| 606 | Ga0495686_0003731 | 3300047472 | Bacteria | 12996 |
| 607 | Ga0495593_0010943 | 3300047673 | Bacteria | 5224 |
| 608 | Ga0495602_0010213 | 3300048088 | Bacteria | 9745 |
| 609 | Ga0495615_0064971 | 3300048090 | Bacteria | 972 |
| 610 | Ga0495626_0029736 | 3300048091 | Bacteria | 2641 |
| 611 | Ga0496101_0047366 | 3300048904 | Bacteria | 3086 |
| 612 | Ga0496102_0207031 | 3300048905 | Bacteria | 1849 |
| 613 | Ga0496104_0033852 | 3300048907 | Bacteria | 4762 |
| 614 | Ga0496105_0250086 | 3300048908 | Bacteria | 1436 |
| 615 | Ga0496106_0005904 | 3300048909 | Bacteria | 9050 |
| 616 | Ga0496106_0334733 | 3300048909 | Bacteria | 1215 |
| 617 | Ga0496108_0240464 | 3300048911 | Bacteria | 1575 |
| 618 | Ga0496109_0089142 | 3300048912 | Bacteria | 2851 |
| 619 | Ga0496109_0666179 | 3300048912 | Bacteria | 978 |
| 620 | Ga0496110_0055644 | 3300048913 | Bacteria | 3481 |
| 621 | Ga0496110_0274091 | 3300048913 | Bacteria | 1536 |
| 622 | Ga0496110_0292116 | 3300048913 | Bacteria | 1485 |
| 623 | Ga0496112_0305970 | 3300048915 | Bacteria | 1535 |
| 624 | Ga0496114_0036117 | 3300048917 | Bacteria | 4085 |
| 625 | Ga0496114_0066918 | 3300048917 | Bacteria | 3013 |
| 626 | Ga0496114_0369051 | 3300048917 | Bacteria | 1270 |
| 627 | Ga0496115_0163647 | 3300048918 | Bacteria | 1839 |
| 628 | Ga0496117_0000427 | 3300048920 | Bacteria | 70530 |
| 629 | Ga0496121_0072024 | 3300048924 | Bacteria | 2776 |
| 630 | Ga0496124_0000046 | 3300048927 | Bacteria | 287043 |
| 631 | Ga0496125_0000545 | 3300048928 | Bacteria | 64939 |
| 632 | Ga0496126_0394898 | 3300048929 | Bacteria | 1123 |
| 633 | Ga0501031_0271311 | 3300049568 | Bacteria | 1101 |
| 634 | Ga0501033_0008244 | 3300049570 | Bacteria | 8066 |
| 635 | Ga0501033_0012171 | 3300049570 | Bacteria | 6568 |
| 636 | Ga0501034_0003497 | 3300049571 | Bacteria | 17835 |
| 637 | Ga0501034_0034901 | 3300049571 | Bacteria | 5100 |
| 638 | Ga0501034_0073475 | 3300049571 | Bacteria | 3428 |
| 639 | Ga0501034_0083970 | 3300049571 | Bacteria | 3187 |
| 640 | Ga0501034_0258542 | 3300049571 | Bacteria | 1684 |
| 641 | Ga0501036_0000257 | 3300049572 | Bacteria | 36095 |
| 642 | Ga0501037_0002777 | 3300049573 | Bacteria | 12676 |
| 643 | Ga0501037_0041628 | 3300049573 | Bacteria | 3378 |
| 644 | Ga0501037_0218121 | 3300049573 | Bacteria | 1343 |
| 645 | Ga0501038_0015573 | 3300049574 | Bacteria | 6912 |
| 646 | Ga0501038_0137858 | 3300049574 | Bacteria | 1998 |
| 647 | Ga0501038_0448708 | 3300049574 | Bacteria | 992 |
| 648 | Ga0501043_0001370 | 3300049579 | Bacteria | 21370 |
| 649 | Ga0501043_0085430 | 3300049579 | Bacteria | 2480 |
| 650 | Ga0501046_0001784 | 3300049580 | Bacteria | 20535 |
| 651 | Ga0501047_0006873 | 3300049581 | Bacteria | 10691 |
| 652 | Ga0501047_0063051 | 3300049581 | Bacteria | 3575 |
| 653 | Ga0501047_0184266 | 3300049581 | Bacteria | 1953 |
| 654 | Ga0501047_0399209 | 3300049581 | Bacteria | 1208 |
| 655 | Ga0501048_0169128 | 3300049582 | Bacteria | 1548 |
| 656 | Ga0501069_0005141 | 3300049585 | Bacteria | 6793 |
| 657 | Ga0501070_0003776 | 3300049586 | Bacteria | 13081 |
| 658 | Ga0501071_0305798 | 3300049587 | Bacteria | 1206 |
| 659 | Ga0501073_0015471 | 3300049589 | Bacteria | 5535 |
| 660 | Ga0501073_0479362 | 3300049589 | Bacteria | 860 |
| 661 | Ga0501074_0022336 | 3300049590 | Bacteria | 4596 |
| 662 | Ga0501074_0094537 | 3300049590 | Bacteria | 2140 |
| 663 | Ga0501076_0510148 | 3300049592 | Bacteria | 991 |
| 664 | Ga0501079_0029442 | 3300049741 | Bacteria | 4216 |
| 665 | Ga0501080_0006486 | 3300049742 | Bacteria | 10508 |
| 666 | Ga0501080_0084524 | 3300049742 | Bacteria | 2949 |
| 667 | Ga0501080_0296413 | 3300049742 | Bacteria | 1467 |
| 668 | Ga0501083_0022836 | 3300049744 | Bacteria | 4340 |
| 669 | Ga0501083_0039192 | 3300049744 | Bacteria | 3218 |
| 670 | Ga0501083_0061714 | 3300049744 | Bacteria | 2502 |
| 671 | Ga0501083_0221679 | 3300049744 | Bacteria | 1232 |
| 672 | Ga0501035_0003798 | 3300049822 | Bacteria | 14391 |
| 673 | Ga0501035_0222071 | 3300049822 | Bacteria | 1613 |
| 674 | Ga0501044_0003872 | 3300049823 | Bacteria | 16771 |
| 675 | Ga0501044_0006073 | 3300049823 | Bacteria | 13326 |
| 676 | Ga0501044_0018509 | 3300049823 | Bacteria | 7462 |
| 677 | Ga0501044_0183067 | 3300049823 | Bacteria | 2061 |
| 678 | Ga0501044_0249859 | 3300049823 | Bacteria | 1715 |
| 679 | Ga0501044_0752675 | 3300049823 | Bacteria | 856 |
| 680 | Ga0501045_0211595 | 3300049824 | Bacteria | 1444 |
| 681 | nmdc:mga03683_4675_c1 | 3300050489 | Bacteria | 4564 |
| 682 | nmdc:mga00v17_27_c2 | 3300050491 | Bacteria | 60228 |
| 683 | nmdc:mga00v17_34091_c1 | 3300050491 | Bacteria | 3021 |
| 684 | nmdc:mga0k408_60154_c2 | 3300050493 | Bacteria | 1379 |
| 685 | nmdc:mga05p37_223159_c1 | 3300050507 | Bacteria | 2273 |
| 686 | nmdc:mga09592_119231_c1 | 3300050508 | Bacteria | 2265 |
| 687 | nmdc:mga08y16_223668_c1 | 3300050511 | Bacteria | 1948 |
| 688 | nmdc:mga08y16_6264_c1 | 3300050511 | Bacteria | 12472 |
| 689 | nmdc:mga08y16_833632_c1 | 3300050511 | Bacteria | 913 |
| 690 | nmdc:mga0n895_201090_c1 | 3300050512 | Bacteria | 2023 |
| 691 | nmdc:mga0n895_489921_c1 | 3300050512 | Bacteria | 1239 |
| 692 | nmdc:mga0rr50_57969_c1 | 3300050513 | Bacteria | 2900 |
| 693 | nmdc:mga08x19_12019_c1 | 3300050514 | Bacteria | 5210 |
| 694 | nmdc:mga08x19_194951_c1 | 3300050514 | Bacteria | 1387 |
| 695 | Ga0500643_000374 | 3300053087 | Bacteria | 34998 |
| 696 | Ga0500643_020753 | 3300053087 | Bacteria | 2140 |
| 697 | Ga0500646_0062098 | 3300053090 | Bacteria | 1102 |
| 698 | Ga0500554_003869 | 3300053102 | Bacteria | 3109 |
| 699 | Ga0500559_0003582 | 3300053136 | Bacteria | 7596 |
| 700 | Ga0500568_0000668 | 3300053139 | Bacteria | 24820 |
| 701 | Ga0500616_0007439 | 3300053153 | Bacteria | 6956 |
| 702 | Ga0500616_0026014 | 3300053153 | Bacteria | 3244 |
| 703 | Ga0500622_0033224 | 3300053156 | Bacteria | 2704 |
| 704 | Ga0500624_022600 | 3300053157 | Bacteria | 1024 |
| 705 | Ga0500627_0179372 | 3300053158 | Bacteria | 953 |
| 706 | Ga0500645_001741 | 3300053730 | Bacteria | 10557 |
| 707 | Ga0500645_001866 | 3300053730 | Bacteria | 10084 |
| 708 | Ga0501084_0075279 | 3300054114 | Bacteria | 2828 |
| 709 | Ga0501084_0265183 | 3300054114 | Bacteria | 1450 |
| 710 | Ga0501084_0351336 | 3300054114 | Bacteria | 1245 |
| 711 | Ga0501082_0062503 | 3300060353 | Bacteria | 3205 |
| 712 | Ga0466962_0000450 | 3300061719 | Bacteria | 17837 |
| 713 | Ga0530510_0191115 | 3300061734 | Bacteria | 1520 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049744 | Ga0501083_0221679 | Ga0501083_0221679_492_1220 | 242 |
| 2 | 3300005347 | Ga0070668_100021611 | Ga0070668_1000216114 | 243 |
| 3 | 3300005353 | Ga0070669_100135950 | Ga0070669_1001359502 | 243 |
| 4 | 3300005364 | Ga0070673_100171359 | Ga0070673_1001713593 | 243 |
| 5 | 3300005457 | Ga0070662_100121970 | Ga0070662_1001219702 | 243 |
| 6 | 3300005616 | Ga0068852_100510253 | Ga0068852_1005102532 | 243 |
| 7 | 3300006358 | Ga0068871_100075325 | Ga0068871_1000753254 | 243 |
| 8 | 3300025923 | Ga0207681_10104032 | Ga0207681_101040323 | 243 |
| 9 | 3300010375 | Ga0105239_10037066 | Ga0105239_100370663 | 244 |
| 10 | 3300054114 | Ga0501084_0075279 | Ga0501084_0075279_249_983 | 244 |
| 11 | iso_pu_bacteria | 2534681786 | 2535485421 | 244 |
| 12 | iso_pu_bacteria | 2751185800 | 2753360354 | 244 |
| 13 | iso_pu_bacteria | 2758568016 | 2758640380 | 244 |
| 14 | iso_pu_bacteria | 2758568016 | 2758642790 | 244 |
| 15 | iso_pu_bacteria | 2854911287 | 2854911670 | 244 |
| 16 | iso_pu_bacteria | 2854911287 | 2854913567 | 244 |
| 17 | iso_pu_bacteria | 2537561587 | 2537876257 | 245 |
| 18 | iso_pu_bacteria | 2595698237 | 2596374431 | 245 |
| 19 | iso_pu_bacteria | 2738541281 | 2738743189 | 245 |
| 20 | iso_pu_bacteria | 2738543032 | 2739352806 | 245 |
| 21 | iso_pu_bacteria | 2739367655 | 2739612421 | 245 |
| 22 | iso_pu_bacteria | 2791355137 | 2792835520 | 245 |
| 23 | iso_pu_bacteria | 2842698319 | 2842700470 | 245 |
| 24 | iso_pu_bacteria | 2842711865 | 2842715345 | 245 |
| 25 | iso_pu_bacteria | 2855730933 | 2855736496 | 245 |
| 26 | iso_pu_bacteria | 2855767633 | 2855773433 | 245 |
| 27 | iso_pu_bacteria | 2857542790 | 2857546698 | 245 |
| 28 | iso_pu_bacteria | 2881412998 | 2881418611 | 245 |
| 29 | iso_pu_bacteria | 2915650412 | 2915650445 | 245 |
| 30 | iso_pu_bacteria | 2924754689 | 2924754960 | 245 |
| 31 | iso_pu_bacteria | 8002392321 | 8002394802 | 245 |
| 32 | 3300009093 | Ga0105240_10005452 | Ga0105240_100054524 | 247 |
| 33 | 3300009545 | Ga0105237_10423989 | Ga0105237_104239892 | 247 |
| 34 | 3300013104 | Ga0157370_10047695 | Ga0157370_100476953 | 247 |
| 35 | 3300013105 | Ga0157369_10419440 | Ga0157369_104194402 | 247 |
| 36 | 3300013307 | Ga0157372_10106261 | Ga0157372_101062613 | 247 |
| 37 | 3300025913 | Ga0207695_10094842 | Ga0207695_100948423 | 247 |
| 38 | 3300025929 | Ga0207664_10095049 | Ga0207664_100950492 | 247 |
| 39 | 3300025949 | Ga0207667_10173798 | Ga0207667_101737983 | 247 |
| 40 | 3300050514 | nmdc:mga08x19_194951_c1 | nmdc:mga08x19_194951_c1_39_782 | 247 |
| 41 | 3300005327 | Ga0070658_10007411 | Ga0070658_100074115 | 248 |
| 42 | 3300005335 | Ga0070666_10007495 | Ga0070666_100074955 | 248 |
| 43 | 3300005336 | Ga0070680_100073271 | Ga0070680_1000732713 | 248 |
| 44 | 3300005339 | Ga0070660_100012151 | Ga0070660_1000121515 | 248 |
| 45 | 3300005339 | Ga0070660_100063163 | Ga0070660_1000631633 | 248 |
| 46 | 3300005367 | Ga0070667_100322824 | Ga0070667_1003228241 | 248 |
| 47 | 3300005440 | Ga0070705_100107555 | Ga0070705_1001075552 | 248 |
| 48 | 3300005458 | Ga0070681_10113222 | Ga0070681_101132223 | 248 |
| 49 | 3300005530 | Ga0070679_100005852 | Ga0070679_10000585214 | 248 |
| 50 | 3300005539 | Ga0068853_100349604 | Ga0068853_1003496041 | 248 |
| 51 | 3300005548 | Ga0070665_100001485 | Ga0070665_10000148526 | 248 |
| 52 | 3300005548 | Ga0070665_100016813 | Ga0070665_1000168137 | 248 |
| 53 | 3300005548 | Ga0070665_100453913 | Ga0070665_1004539131 | 248 |
| 54 | 3300005563 | Ga0068855_100202606 | Ga0068855_1002026063 | 248 |
| 55 | 3300005614 | Ga0068856_100130033 | Ga0068856_1001300332 | 248 |
| 56 | 3300005616 | Ga0068852_100172530 | Ga0068852_1001725302 | 248 |
| 57 | 3300005842 | Ga0068858_100150752 | Ga0068858_1001507522 | 248 |
| 58 | 3300006051 | Ga0075364_10209920 | Ga0075364_102099201 | 248 |
| 59 | 3300006177 | Ga0075362_10043316 | Ga0075362_100433161 | 248 |
| 60 | 3300006914 | Ga0075436_100018225 | Ga0075436_1000182253 | 248 |
| 61 | 3300009093 | Ga0105240_10696894 | Ga0105240_106968941 | 248 |
| 62 | 3300009174 | Ga0105241_10286296 | Ga0105241_102862962 | 248 |
| 63 | 3300009545 | Ga0105237_10299783 | Ga0105237_102997832 | 248 |
| 64 | 3300009551 | Ga0105238_10070887 | Ga0105238_100708874 | 248 |
| 65 | 3300009551 | Ga0105238_10085095 | Ga0105238_100850952 | 248 |
| 66 | 3300013104 | Ga0157370_10066646 | Ga0157370_100666463 | 248 |
| 67 | 3300013105 | Ga0157369_10068397 | Ga0157369_100683973 | 248 |
| 68 | 3300013307 | Ga0157372_10028729 | Ga0157372_100287293 | 248 |
| 69 | 3300020077 | Ga0206351_10961181 | Ga0206351_109611811 | 248 |
| 70 | 3300025909 | Ga0207705_10028966 | Ga0207705_100289664 | 248 |
| 71 | 3300025909 | Ga0207705_10029460 | Ga0207705_100294607 | 248 |
| 72 | 3300025913 | Ga0207695_10201036 | Ga0207695_102010362 | 248 |
| 73 | 3300025917 | Ga0207660_10090744 | Ga0207660_100907443 | 248 |
| 74 | 3300025919 | Ga0207657_10022610 | Ga0207657_100226107 | 248 |
| 75 | 3300025919 | Ga0207657_10269930 | Ga0207657_102699302 | 248 |
| 76 | 3300025921 | Ga0207652_10008722 | Ga0207652_100087222 | 248 |
| 77 | 3300025921 | Ga0207652_10059551 | Ga0207652_100595513 | 248 |
| 78 | 3300025924 | Ga0207694_10240098 | Ga0207694_102400982 | 248 |
| 79 | 3300025927 | Ga0207687_10168112 | Ga0207687_101681122 | 248 |
| 80 | 3300025941 | Ga0207711_10142215 | Ga0207711_101422153 | 248 |
| 81 | 3300026116 | Ga0207674_10436833 | Ga0207674_104368332 | 248 |
| 82 | 3300026142 | Ga0207698_10316101 | Ga0207698_103161011 | 248 |
| 83 | 3300028379 | Ga0268266_10000551 | Ga0268266_100005518 | 248 |
| 84 | 3300028379 | Ga0268266_10032142 | Ga0268266_100321425 | 248 |
| 85 | 3300031235 | Ga0265330_10069042 | Ga0265330_100690422 | 248 |
| 86 | 3300031241 | Ga0265325_10007961 | Ga0265325_100079616 | 248 |
| 87 | 3300031247 | Ga0265340_10002715 | Ga0265340_100027154 | 248 |
| 88 | 3300031247 | Ga0265340_10083189 | Ga0265340_100831892 | 248 |
| 89 | 3300031249 | Ga0265339_10007542 | Ga0265339_100075425 | 248 |
| 90 | 3300031344 | Ga0265316_10055609 | Ga0265316_100556094 | 248 |
| 91 | 3300031456 | Ga0307513_10361575 | Ga0307513_103615751 | 248 |
| 92 | 3300031595 | Ga0265313_10008203 | Ga0265313_100082032 | 248 |
| 93 | 3300031595 | Ga0265313_10020281 | Ga0265313_100202812 | 248 |
| 94 | 3300031712 | Ga0265342_10062731 | Ga0265342_100627313 | 248 |
| 95 | 3300032005 | Ga0307411_10043493 | Ga0307411_100434932 | 248 |
| 96 | 3300037471 | Ga0395905_0025761 | Ga0395905_0025761_2793_3539 | 248 |
| 97 | 3300044656 | Ga0466969_0000722 | Ga0466969_0000722_14594_15340 | 248 |
| 98 | 3300044684 | Ga0466966_0005576 | Ga0466966_0005576_5840_6586 | 248 |
| 99 | 3300044693 | Ga0466961_0001425 | Ga0466961_0001425_13839_14585 | 248 |
| 100 | 3300044719 | Ga0466971_0009671 | Ga0466971_0009671_560_1306 | 248 |
| 101 | 3300044842 | Ga0466957_0029156 | Ga0466957_0029156_1362_2108 | 248 |
| 102 | 3300045049 | Ga0466959_0000040 | Ga0466959_0000040_74250_74996 | 248 |
| 103 | 3300045836 | Ga0466958_0026837 | Ga0466958_0026837_561_1307 | 248 |
| 104 | 3300045976 | Ga0466967_0115997 | Ga0466967_0115997_831_1577 | 248 |
| 105 | 3300046616 | Ga0495668_0153531 | Ga0495668_0153531_438_1184 | 248 |
| 106 | 3300046810 | Ga0495660_0012577 | Ga0495660_0012577_357_1103 | 248 |
| 107 | 3300047472 | Ga0495686_0003731 | Ga0495686_0003731_1040_1786 | 248 |
| 108 | 3300049571 | Ga0501034_0083970 | Ga0501034_0083970_2176_2922 | 248 |
| 109 | 3300049573 | Ga0501037_0218121 | Ga0501037_0218121_501_1247 | 248 |
| 110 | 3300049592 | Ga0501076_0510148 | Ga0501076_0510148_113_859 | 248 |
| 111 | 3300049824 | Ga0501045_0211595 | Ga0501045_0211595_513_1259 | 248 |
| 112 | 3300050489 | nmdc:mga03683_4675_c1 | nmdc:mga03683_4675_c1_1323_2069 | 248 |
| 113 | 3300050491 | nmdc:mga00v17_27_c2 | nmdc:mga00v17_27_c2_600_1346 | 248 |
| 114 | 3300050491 | nmdc:mga00v17_34091_c1 | nmdc:mga00v17_34091_c1_1632_2378 | 248 |
| 115 | 3300050512 | nmdc:mga0n895_201090_c1 | nmdc:mga0n895_201090_c1_853_1602 | 248 |
| 116 | 3300050514 | nmdc:mga08x19_12019_c1 | nmdc:mga08x19_12019_c1_2826_3575 | 248 |
| 117 | 3300053087 | Ga0500643_000374 | Ga0500643_000374_14769_15515 | 248 |
| 118 | 3300053087 | Ga0500643_020753 | Ga0500643_020753_474_1220 | 248 |
| 119 | 3300053102 | Ga0500554_003869 | Ga0500554_003869_699_1445 | 248 |
| 120 | 3300053139 | Ga0500568_0000668 | Ga0500568_0000668_6398_7204 | 248 |
| 121 | 3300053153 | Ga0500616_0026014 | Ga0500616_0026014_347_1093 | 248 |
| 122 | 3300053158 | Ga0500627_0179372 | Ga0500627_0179372_65_811 | 248 |
| 123 | 3300053730 | Ga0500645_001741 | Ga0500645_001741_733_1479 | 248 |
| 124 | 3300053730 | Ga0500645_001866 | Ga0500645_001866_6442_7188 | 248 |
| 125 | 3300061719 | Ga0466962_0000450 | Ga0466962_0000450_2365_3111 | 248 |
| 126 | 3300061734 | Ga0530510_0191115 | Ga0530510_0191115_130_876 | 248 |
| 127 | 3300005333 | Ga0070677_10020974 | Ga0070677_100209743 | 249 |
| 128 | 3300005339 | Ga0070660_100166387 | Ga0070660_1001663872 | 249 |
| 129 | 3300005340 | Ga0070689_100068704 | Ga0070689_1000687041 | 249 |
| 130 | 3300005340 | Ga0070689_100084918 | Ga0070689_1000849183 | 249 |
| 131 | 3300005347 | Ga0070668_100030266 | Ga0070668_1000302662 | 249 |
| 132 | 3300005353 | Ga0070669_100011290 | Ga0070669_1000112902 | 249 |
| 133 | 3300005354 | Ga0070675_100189929 | Ga0070675_1001899292 | 249 |
| 134 | 3300005356 | Ga0070674_100138643 | Ga0070674_1001386432 | 249 |
| 135 | 3300005367 | Ga0070667_100126024 | Ga0070667_1001260242 | 249 |
| 136 | 3300005435 | Ga0070714_100143716 | Ga0070714_1001437162 | 249 |
| 137 | 3300005441 | Ga0070700_100000389 | Ga0070700_10000038917 | 249 |
| 138 | 3300005444 | Ga0070694_100123770 | Ga0070694_1001237702 | 249 |
| 139 | 3300005445 | Ga0070708_100052118 | Ga0070708_1000521183 | 249 |
| 140 | 3300005456 | Ga0070678_100091988 | Ga0070678_1000919883 | 249 |
| 141 | 3300005459 | Ga0068867_100024393 | Ga0068867_1000243934 | 249 |
| 142 | 3300005459 | Ga0068867_100096522 | Ga0068867_1000965222 | 249 |
| 143 | 3300005459 | Ga0068867_100374839 | Ga0068867_1003748392 | 249 |
| 144 | 3300005467 | Ga0070706_100144128 | Ga0070706_1001441282 | 249 |
| 145 | 3300005467 | Ga0070706_100167220 | Ga0070706_1001672202 | 249 |
| 146 | 3300005467 | Ga0070706_100241043 | Ga0070706_1002410431 | 249 |
| 147 | 3300005471 | Ga0070698_100003313 | Ga0070698_1000033136 | 249 |
| 148 | 3300005471 | Ga0070698_100366248 | Ga0070698_1003662482 | 249 |
| 149 | 3300005518 | Ga0070699_100024597 | Ga0070699_1000245973 | 249 |
| 150 | 3300005530 | Ga0070679_100221193 | Ga0070679_1002211932 | 249 |
| 151 | 3300005536 | Ga0070697_100104285 | Ga0070697_1001042852 | 249 |
| 152 | 3300005539 | Ga0068853_100119321 | Ga0068853_1001193213 | 249 |
| 153 | 3300005543 | Ga0070672_100036976 | Ga0070672_1000369765 | 249 |
| 154 | 3300005543 | Ga0070672_100169363 | Ga0070672_1001693632 | 249 |
| 155 | 3300005545 | Ga0070695_100095318 | Ga0070695_1000953183 | 249 |
| 156 | 3300005546 | Ga0070696_100068958 | Ga0070696_1000689582 | 249 |
| 157 | 3300005546 | Ga0070696_100075437 | Ga0070696_1000754373 | 249 |
| 158 | 3300005546 | Ga0070696_100144725 | Ga0070696_1001447252 | 249 |
| 159 | 3300005547 | Ga0070693_100000664 | Ga0070693_1000006646 | 249 |
| 160 | 3300005563 | Ga0068855_100021038 | Ga0068855_1000210383 | 249 |
| 161 | 3300005563 | Ga0068855_100032340 | Ga0068855_1000323402 | 249 |
| 162 | 3300005615 | Ga0070702_100090588 | Ga0070702_1000905882 | 249 |
| 163 | 3300005616 | Ga0068852_100006808 | Ga0068852_1000068086 | 249 |
| 164 | 3300005617 | Ga0068859_100442671 | Ga0068859_1004426711 | 249 |
| 165 | 3300005718 | Ga0068866_10003537 | Ga0068866_100035375 | 249 |
| 166 | 3300005719 | Ga0068861_100000316 | Ga0068861_1000003163 | 249 |
| 167 | 3300005834 | Ga0068851_10017787 | Ga0068851_100177872 | 249 |
| 168 | 3300005841 | Ga0068863_100223289 | Ga0068863_1002232892 | 249 |
| 169 | 3300005844 | Ga0068862_100057288 | Ga0068862_1000572883 | 249 |
| 170 | 3300005844 | Ga0068862_100123419 | Ga0068862_1001234193 | 249 |
| 171 | 3300006058 | Ga0075432_10007467 | Ga0075432_100074674 | 249 |
| 172 | 3300006195 | Ga0075366_10063992 | Ga0075366_100639922 | 249 |
| 173 | 3300006237 | Ga0097621_100030201 | Ga0097621_1000302013 | 249 |
| 174 | 3300006358 | Ga0068871_100010900 | Ga0068871_1000109002 | 249 |
| 175 | 3300006880 | Ga0075429_100069086 | Ga0075429_1000690863 | 249 |
| 176 | 3300006881 | Ga0068865_100003157 | Ga0068865_1000031573 | 249 |
| 177 | 3300006931 | Ga0097620_100010242 | Ga0097620_1000102423 | 249 |
| 178 | 3300006931 | Ga0097620_100442683 | Ga0097620_1004426832 | 249 |
| 179 | 3300009093 | Ga0105240_10071585 | Ga0105240_100715851 | 249 |
| 180 | 3300009093 | Ga0105240_10121999 | Ga0105240_101219991 | 249 |
| 181 | 3300009094 | Ga0111539_10004114 | Ga0111539_1000411412 | 249 |
| 182 | 3300009094 | Ga0111539_10158467 | Ga0111539_101584673 | 249 |
| 183 | 3300009094 | Ga0111539_10207054 | Ga0111539_102070543 | 249 |
| 184 | 3300009094 | Ga0111539_11125707 | Ga0111539_111257072 | 249 |
| 185 | 3300009094 | Ga0111539_11176176 | Ga0111539_111761761 | 249 |
| 186 | 3300009098 | Ga0105245_10108460 | Ga0105245_101084603 | 249 |
| 187 | 3300009148 | Ga0105243_10038652 | Ga0105243_100386523 | 249 |
| 188 | 3300009176 | Ga0105242_10002660 | Ga0105242_1000266010 | 249 |
| 189 | 3300009177 | Ga0105248_10237679 | Ga0105248_102376792 | 249 |
| 190 | 3300009545 | Ga0105237_10261443 | Ga0105237_102614432 | 249 |
| 191 | 3300009553 | Ga0105249_10050559 | Ga0105249_100505593 | 249 |
| 192 | 3300009553 | Ga0105249_10714541 | Ga0105249_107145412 | 249 |
| 193 | 3300010159 | Ga0099796_10143091 | Ga0099796_101430911 | 249 |
| 194 | 3300010375 | Ga0105239_10674763 | Ga0105239_106747632 | 249 |
| 195 | 3300013104 | Ga0157370_10010719 | Ga0157370_100107192 | 249 |
| 196 | 3300013104 | Ga0157370_10349031 | Ga0157370_103490312 | 249 |
| 197 | 3300013297 | Ga0157378_10045990 | Ga0157378_100459903 | 249 |
| 198 | 3300013297 | Ga0157378_10198283 | Ga0157378_101982832 | 249 |
| 199 | 3300013306 | Ga0163162_10242048 | Ga0163162_102420482 | 249 |
| 200 | 3300013308 | Ga0157375_10672425 | Ga0157375_106724252 | 249 |
| 201 | 3300014325 | Ga0163163_11008069 | Ga0163163_110080692 | 249 |
| 202 | 3300014745 | Ga0157377_10006333 | Ga0157377_100063336 | 249 |
| 203 | 3300014968 | Ga0157379_10111123 | Ga0157379_101111233 | 249 |
| 204 | 3300014969 | Ga0157376_10198234 | Ga0157376_101982342 | 249 |
| 205 | 3300017792 | Ga0163161_10509870 | Ga0163161_105098702 | 249 |
| 206 | 3300021361 | Ga0213872_10000191 | Ga0213872_1000019136 | 249 |
| 207 | 3300021361 | Ga0213872_10134565 | Ga0213872_101345651 | 249 |
| 208 | 3300021377 | Ga0213874_10019065 | Ga0213874_100190652 | 249 |
| 209 | 3300021384 | Ga0213876_10010100 | Ga0213876_100101003 | 249 |
| 210 | 3300021384 | Ga0213876_10128763 | Ga0213876_101287632 | 249 |
| 211 | 3300021441 | Ga0213871_10005091 | Ga0213871_100050912 | 249 |
| 212 | 3300021441 | Ga0213871_10020431 | Ga0213871_100204312 | 249 |
| 213 | 3300025294 | Ga0209025_1000040 | Ga0209025_1000040136 | 249 |
| 214 | 3300025315 | Ga0207697_10199249 | Ga0207697_101992491 | 249 |
| 215 | 3300025321 | Ga0207656_10023192 | Ga0207656_100231922 | 249 |
| 216 | 3300025906 | Ga0207699_10025473 | Ga0207699_100254732 | 249 |
| 217 | 3300025907 | Ga0207645_10089973 | Ga0207645_100899732 | 249 |
| 218 | 3300025910 | Ga0207684_10111542 | Ga0207684_101115422 | 249 |
| 219 | 3300025910 | Ga0207684_10434069 | Ga0207684_104340691 | 249 |
| 220 | 3300025912 | Ga0207707_10033902 | Ga0207707_100339024 | 249 |
| 221 | 3300025913 | Ga0207695_10000806 | Ga0207695_1000080660 | 249 |
| 222 | 3300025913 | Ga0207695_10095321 | Ga0207695_100953213 | 249 |
| 223 | 3300025913 | Ga0207695_10584682 | Ga0207695_105846821 | 249 |
| 224 | 3300025917 | Ga0207660_10052150 | Ga0207660_100521502 | 249 |
| 225 | 3300025919 | Ga0207657_10167188 | Ga0207657_101671882 | 249 |
| 226 | 3300025921 | Ga0207652_10136635 | Ga0207652_101366351 | 249 |
| 227 | 3300025923 | Ga0207681_10013955 | Ga0207681_100139555 | 249 |
| 228 | 3300025924 | Ga0207694_10180375 | Ga0207694_101803751 | 249 |
| 229 | 3300025926 | Ga0207659_10035920 | Ga0207659_100359203 | 249 |
| 230 | 3300025927 | Ga0207687_10523119 | Ga0207687_105231192 | 249 |
| 231 | 3300025929 | Ga0207664_10119111 | Ga0207664_101191112 | 249 |
| 232 | 3300025934 | Ga0207686_10051120 | Ga0207686_100511202 | 249 |
| 233 | 3300025934 | Ga0207686_10445358 | Ga0207686_104453582 | 249 |
| 234 | 3300025935 | Ga0207709_10002633 | Ga0207709_1000263310 | 249 |
| 235 | 3300025936 | Ga0207670_10077452 | Ga0207670_100774523 | 249 |
| 236 | 3300025938 | Ga0207704_10022141 | Ga0207704_100221413 | 249 |
| 237 | 3300025941 | Ga0207711_10091298 | Ga0207711_100912982 | 249 |
| 238 | 3300025949 | Ga0207667_10024982 | Ga0207667_100249825 | 249 |
| 239 | 3300025960 | Ga0207651_10442950 | Ga0207651_104429502 | 249 |
| 240 | 3300025961 | Ga0207712_10027674 | Ga0207712_100276743 | 249 |
| 241 | 3300025972 | Ga0207668_10114188 | Ga0207668_101141882 | 249 |
| 242 | 3300025981 | Ga0207640_10329991 | Ga0207640_103299912 | 249 |
| 243 | 3300026023 | Ga0207677_10148576 | Ga0207677_101485761 | 249 |
| 244 | 3300026035 | Ga0207703_10162752 | Ga0207703_101627521 | 249 |
| 245 | 3300026041 | Ga0207639_10217459 | Ga0207639_102174592 | 249 |
| 246 | 3300026075 | Ga0207708_10011960 | Ga0207708_100119603 | 249 |
| 247 | 3300026078 | Ga0207702_10225422 | Ga0207702_102254222 | 249 |
| 248 | 3300026089 | Ga0207648_10004228 | Ga0207648_100042283 | 249 |
| 249 | 3300026089 | Ga0207648_10020098 | Ga0207648_100200983 | 249 |
| 250 | 3300026089 | Ga0207648_10022240 | Ga0207648_100222403 | 249 |
| 251 | 3300026089 | Ga0207648_10127594 | Ga0207648_101275942 | 249 |
| 252 | 3300026089 | Ga0207648_10426923 | Ga0207648_104269232 | 249 |
| 253 | 3300026118 | Ga0207675_100022734 | Ga0207675_1000227344 | 249 |
| 254 | 3300026121 | Ga0207683_10035293 | Ga0207683_100352935 | 249 |
| 255 | 3300027907 | Ga0207428_10017142 | Ga0207428_100171424 | 249 |
| 256 | 3300027907 | Ga0207428_10460627 | Ga0207428_104606271 | 249 |
| 257 | 3300028380 | Ga0268265_10002908 | Ga0268265_100029083 | 249 |
| 258 | 3300028380 | Ga0268265_10151184 | Ga0268265_101511843 | 249 |
| 259 | 3300028380 | Ga0268265_10381476 | Ga0268265_103814761 | 249 |
| 260 | 3300028381 | Ga0268264_10432779 | Ga0268264_104327792 | 249 |
| 261 | 3300031241 | Ga0265325_10072852 | Ga0265325_100728522 | 249 |
| 262 | 3300031247 | Ga0265340_10033158 | Ga0265340_100331582 | 249 |
| 263 | 3300031250 | Ga0265331_10000250 | Ga0265331_1000025059 | 249 |
| 264 | 3300031251 | Ga0265327_10000007 | Ga0265327_10000007496 | 249 |
| 265 | 3300031251 | Ga0265327_10000280 | Ga0265327_1000028099 | 249 |
| 266 | 3300031456 | Ga0307513_10001002 | Ga0307513_1000100224 | 249 |
| 267 | 3300031456 | Ga0307513_10377296 | Ga0307513_103772962 | 249 |
| 268 | 3300031548 | Ga0307408_100287883 | Ga0307408_1002878832 | 249 |
| 269 | 3300031711 | Ga0265314_10154468 | Ga0265314_101544682 | 249 |
| 270 | 3300031824 | Ga0307413_10097044 | Ga0307413_100970442 | 249 |
| 271 | 3300032002 | Ga0307416_100069094 | Ga0307416_1000690943 | 249 |
| 272 | 3300033180 | Ga0307510_10019906 | Ga0307510_100199067 | 249 |
| 273 | 3300034816 | Ga0373930_0013043 | Ga0373930_0013043_530_1279 | 249 |
| 274 | 3300034819 | Ga0373958_0003476 | Ga0373958_0003476_1272_2021 | 249 |
| 275 | 3300035111 | Ga0373923_0167773 | Ga0373923_0167773_13_762 | 249 |
| 276 | 3300035113 | Ga0373936_0003352 | Ga0373936_0003352_1475_2224 | 249 |
| 277 | 3300035691 | Ga0373931_0135708 | Ga0373931_0135708_134_901 | 249 |
| 278 | 3300036401 | Ga0373937_0142189 | Ga0373937_0142189_1083_1832 | 249 |
| 279 | 3300037418 | Ga0395900_0029076 | Ga0395900_0029076_4500_5249 | 249 |
| 280 | 3300037418 | Ga0395900_0225305 | Ga0395900_0225305_84_833 | 249 |
| 281 | 3300037466 | Ga0395898_0200182 | Ga0395898_0200182_257_1006 | 249 |
| 282 | 3300037853 | Ga0436364_0098673 | Ga0436364_0098673_1127_1876 | 249 |
| 283 | 3300038443 | Ga0395901_0016643 | Ga0395901_0016643_1081_1836 | 249 |
| 284 | 3300038443 | Ga0395901_0258871 | Ga0395901_0258871_679_1428 | 249 |
| 285 | 3300039062 | Ga0400483_041511 | Ga0400483_041511_4055_4804 | 249 |
| 286 | 3300039062 | Ga0400483_206794 | Ga0400483_206794_4710_5459 | 249 |
| 287 | 3300039437 | Ga0436365_0503502 | Ga0436365_0503502_1385_2134 | 249 |
| 288 | 3300039437 | Ga0436365_0874983 | Ga0436365_0874983_20114_20863 | 249 |
| 289 | 3300039438 | Ga0436360_0404552 | Ga0436360_0404552_349_1098 | 249 |
| 290 | 3300039438 | Ga0436360_0605189 | Ga0436360_0605189_414_1163 | 249 |
| 291 | 3300039438 | Ga0436360_0614325 | Ga0436360_0614325_1073_1822 | 249 |
| 292 | 3300039438 | Ga0436360_1178753 | Ga0436360_1178753_3963_4712 | 249 |
| 293 | 3300039447 | Ga0436361_0025705 | Ga0436361_0025705_29_778 | 249 |
| 294 | 3300039447 | Ga0436361_0469822 | Ga0436361_0469822_1429_2178 | 249 |
| 295 | 3300039447 | Ga0436361_0672930 | Ga0436361_0672930_114_863 | 249 |
| 296 | 3300039447 | Ga0436361_0788745 | Ga0436361_0788745_32907_33656 | 249 |
| 297 | 3300039447 | Ga0436361_0794633 | Ga0436361_0794633_349_1098 | 249 |
| 298 | 3300039447 | Ga0436361_0885505 | Ga0436361_0885505_1178_1927 | 249 |
| 299 | 3300039447 | Ga0436361_1082188 | Ga0436361_1082188_670_1563 | 249 |
| 300 | 3300039450 | Ga0436363_0854040 | Ga0436363_0854040_11339_12088 | 249 |
| 301 | 3300039453 | Ga0436362_0009912 | Ga0436362_0009912_711_1460 | 249 |
| 302 | 3300039453 | Ga0436362_1093207 | Ga0436362_1093207_246_995 | 249 |
| 303 | 3300039453 | Ga0436362_1161051 | Ga0436362_1161051_286_1035 | 249 |
| 304 | 3300041494 | Ga0451837_0626772 | Ga0451837_0626772_859_1608 | 249 |
| 305 | 3300041505 | Ga0451849_1443180 | Ga0451849_1443180_2534_3283 | 249 |
| 306 | 3300041509 | Ga0451843_1776483 | Ga0451843_1776483_1064_1813 | 249 |
| 307 | 3300042008 | Ga0439450_009520 | Ga0439450_009520_609_1358 | 249 |
| 308 | 3300044656 | Ga0466969_0114506 | Ga0466969_0114506_407_1156 | 249 |
| 309 | 3300044706 | Ga0466964_0072768 | Ga0466964_0072768_289_1038 | 249 |
| 310 | 3300046463 | Ga0495653_0020962 | Ga0495653_0020962_2226_2975 | 249 |
| 311 | 3300046472 | Ga0495580_0007478 | Ga0495580_0007478_6344_7093 | 249 |
| 312 | 3300046473 | Ga0495582_0025557 | Ga0495582_0025557_1073_1822 | 249 |
| 313 | 3300046516 | Ga0495628_0004869 | Ga0495628_0004869_3032_3781 | 249 |
| 314 | 3300046522 | Ga0495643_0014143 | Ga0495643_0014143_2218_2967 | 249 |
| 315 | 3300046524 | Ga0495648_0030142 | Ga0495648_0030142_896_1645 | 249 |
| 316 | 3300046533 | Ga0495640_0148576 | Ga0495640_0148576_557_1306 | 249 |
| 317 | 3300046557 | Ga0495622_0000126 | Ga0495622_0000126_36226_36975 | 249 |
| 318 | 3300046558 | Ga0495633_0094747 | Ga0495633_0094747_318_1067 | 249 |
| 319 | 3300046615 | Ga0495656_0019662 | Ga0495656_0019662_1153_1902 | 249 |
| 320 | 3300046642 | Ga0495634_0142013 | Ga0495634_0142013_204_953 | 249 |
| 321 | 3300046664 | Ga0495659_0019428 | Ga0495659_0019428_1004_1753 | 249 |
| 322 | 3300046680 | Ga0495646_0058453 | Ga0495646_0058453_1520_2269 | 249 |
| 323 | 3300046683 | Ga0495658_0112940 | Ga0495658_0112940_44_793 | 249 |
| 324 | 3300046690 | Ga0495624_0003707 | Ga0495624_0003707_8294_9043 | 249 |
| 325 | 3300046690 | Ga0495624_0059831 | Ga0495624_0059831_967_1716 | 249 |
| 326 | 3300047320 | Ga0495672_0024117 | Ga0495672_0024117_177_926 | 249 |
| 327 | 3300047321 | Ga0495676_0027671 | Ga0495676_0027671_600_1349 | 249 |
| 328 | 3300047322 | Ga0495680_0182815 | Ga0495680_0182815_452_1201 | 249 |
| 329 | 3300047673 | Ga0495593_0010943 | Ga0495593_0010943_1070_1819 | 249 |
| 330 | 3300048088 | Ga0495602_0010213 | Ga0495602_0010213_2833_3582 | 249 |
| 331 | 3300048090 | Ga0495615_0064971 | Ga0495615_0064971_147_896 | 249 |
| 332 | 3300048091 | Ga0495626_0029736 | Ga0495626_0029736_967_1716 | 249 |
| 333 | 3300048904 | Ga0496101_0047366 | Ga0496101_0047366_1529_2278 | 249 |
| 334 | 3300048905 | Ga0496102_0207031 | Ga0496102_0207031_319_1068 | 249 |
| 335 | 3300048907 | Ga0496104_0033852 | Ga0496104_0033852_491_1240 | 249 |
| 336 | 3300048908 | Ga0496105_0250086 | Ga0496105_0250086_279_1028 | 249 |
| 337 | 3300048909 | Ga0496106_0334733 | Ga0496106_0334733_80_829 | 249 |
| 338 | 3300048911 | Ga0496108_0240464 | Ga0496108_0240464_363_1112 | 249 |
| 339 | 3300048912 | Ga0496109_0089142 | Ga0496109_0089142_1667_2416 | 249 |
| 340 | 3300048913 | Ga0496110_0055644 | Ga0496110_0055644_495_1244 | 249 |
| 341 | 3300048917 | Ga0496114_0036117 | Ga0496114_0036117_65_814 | 249 |
| 342 | 3300048917 | Ga0496114_0066918 | Ga0496114_0066918_548_1297 | 249 |
| 343 | 3300048918 | Ga0496115_0163647 | Ga0496115_0163647_811_1560 | 249 |
| 344 | 3300048920 | Ga0496117_0000427 | Ga0496117_0000427_48937_49686 | 249 |
| 345 | 3300048924 | Ga0496121_0072024 | Ga0496121_0072024_941_1690 | 249 |
| 346 | 3300048927 | Ga0496124_0000046 | Ga0496124_0000046_95835_96584 | 249 |
| 347 | 3300048928 | Ga0496125_0000545 | Ga0496125_0000545_27278_28027 | 249 |
| 348 | 3300048929 | Ga0496126_0394898 | Ga0496126_0394898_167_916 | 249 |
| 349 | 3300049568 | Ga0501031_0271311 | Ga0501031_0271311_135_884 | 249 |
| 350 | 3300049570 | Ga0501033_0008244 | Ga0501033_0008244_5016_5765 | 249 |
| 351 | 3300049570 | Ga0501033_0012171 | Ga0501033_0012171_3630_4379 | 249 |
| 352 | 3300049571 | Ga0501034_0003497 | Ga0501034_0003497_14143_14892 | 249 |
| 353 | 3300049571 | Ga0501034_0034901 | Ga0501034_0034901_292_1041 | 249 |
| 354 | 3300049571 | Ga0501034_0073475 | Ga0501034_0073475_2302_3051 | 249 |
| 355 | 3300049571 | Ga0501034_0258542 | Ga0501034_0258542_790_1539 | 249 |
| 356 | 3300049572 | Ga0501036_0000257 | Ga0501036_0000257_19782_20531 | 249 |
| 357 | 3300049573 | Ga0501037_0002777 | Ga0501037_0002777_3056_3805 | 249 |
| 358 | 3300049573 | Ga0501037_0041628 | Ga0501037_0041628_1505_2254 | 249 |
| 359 | 3300049574 | Ga0501038_0015573 | Ga0501038_0015573_1959_2708 | 249 |
| 360 | 3300049574 | Ga0501038_0137858 | Ga0501038_0137858_1002_1751 | 249 |
| 361 | 3300049574 | Ga0501038_0448708 | Ga0501038_0448708_117_866 | 249 |
| 362 | 3300049579 | Ga0501043_0001370 | Ga0501043_0001370_870_1619 | 249 |
| 363 | 3300049579 | Ga0501043_0085430 | Ga0501043_0085430_319_1068 | 249 |
| 364 | 3300049580 | Ga0501046_0001784 | Ga0501046_0001784_929_1678 | 249 |
| 365 | 3300049581 | Ga0501047_0006873 | Ga0501047_0006873_8945_9694 | 249 |
| 366 | 3300049581 | Ga0501047_0063051 | Ga0501047_0063051_1688_2437 | 249 |
| 367 | 3300049581 | Ga0501047_0184266 | Ga0501047_0184266_622_1371 | 249 |
| 368 | 3300049581 | Ga0501047_0399209 | Ga0501047_0399209_40_789 | 249 |
| 369 | 3300049582 | Ga0501048_0169128 | Ga0501048_0169128_782_1531 | 249 |
| 370 | 3300049589 | Ga0501073_0479362 | Ga0501073_0479362_65_814 | 249 |
| 371 | 3300049590 | Ga0501074_0094537 | Ga0501074_0094537_1345_2094 | 249 |
| 372 | 3300049742 | Ga0501080_0006486 | Ga0501080_0006486_8898_9647 | 249 |
| 373 | 3300049742 | Ga0501080_0296413 | Ga0501080_0296413_77_826 | 249 |
| 374 | 3300049744 | Ga0501083_0061714 | Ga0501083_0061714_1674_2423 | 249 |
| 375 | 3300049822 | Ga0501035_0003798 | Ga0501035_0003798_12773_13522 | 249 |
| 376 | 3300049822 | Ga0501035_0222071 | Ga0501035_0222071_851_1600 | 249 |
| 377 | 3300049823 | Ga0501044_0003872 | Ga0501044_0003872_15494_16243 | 249 |
| 378 | 3300049823 | Ga0501044_0006073 | Ga0501044_0006073_8349_9098 | 249 |
| 379 | 3300049823 | Ga0501044_0018509 | Ga0501044_0018509_3412_4161 | 249 |
| 380 | 3300049823 | Ga0501044_0249859 | Ga0501044_0249859_342_1091 | 249 |
| 381 | 3300049823 | Ga0501044_0752675 | Ga0501044_0752675_60_809 | 249 |
| 382 | 3300050493 | nmdc:mga0k408_60154_c2 | nmdc:mga0k408_60154_c2_555_1304 | 249 |
| 383 | 3300050508 | nmdc:mga09592_119231_c1 | nmdc:mga09592_119231_c1_593_1342 | 249 |
| 384 | 3300050511 | nmdc:mga08y16_223668_c1 | nmdc:mga08y16_223668_c1_179_928 | 249 |
| 385 | 3300050511 | nmdc:mga08y16_6264_c1 | nmdc:mga08y16_6264_c1_8699_9448 | 249 |
| 386 | 3300050511 | nmdc:mga08y16_833632_c1 | nmdc:mga08y16_833632_c1_96_845 | 249 |
| 387 | 3300050512 | nmdc:mga0n895_489921_c1 | nmdc:mga0n895_489921_c1_362_1111 | 249 |
| 388 | 3300053090 | Ga0500646_0062098 | Ga0500646_0062098_303_1070 | 249 |
| 389 | 3300053136 | Ga0500559_0003582 | Ga0500559_0003582_6017_6766 | 249 |
| 390 | 3300053153 | Ga0500616_0007439 | Ga0500616_0007439_5392_6144 | 249 |
| 391 | 3300053156 | Ga0500622_0033224 | Ga0500622_0033224_690_1439 | 249 |
| 392 | 3300053157 | Ga0500624_022600 | Ga0500624_022600_107_856 | 249 |
| 393 | 3300054114 | Ga0501084_0265183 | Ga0501084_0265183_210_959 | 249 |
| 394 | 3300001979 | JGI24740J21852_10078825 | JGI24740J21852_100788251 | 250 |
| 395 | 3300005328 | Ga0070676_10010301 | Ga0070676_100103014 | 250 |
| 396 | 3300005328 | Ga0070676_10169957 | Ga0070676_101699572 | 250 |
| 397 | 3300005328 | Ga0070676_10239067 | Ga0070676_102390672 | 250 |
| 398 | 3300005329 | Ga0070683_100008427 | Ga0070683_1000084279 | 250 |
| 399 | 3300005330 | Ga0070690_100056989 | Ga0070690_1000569893 | 250 |
| 400 | 3300005331 | Ga0070670_100192158 | Ga0070670_1001921582 | 250 |
| 401 | 3300005331 | Ga0070670_100257209 | Ga0070670_1002572092 | 250 |
| 402 | 3300005333 | Ga0070677_10000303 | Ga0070677_100003034 | 250 |
| 403 | 3300005334 | Ga0068869_100066857 | Ga0068869_1000668573 | 250 |
| 404 | 3300005335 | Ga0070666_10010571 | Ga0070666_100105714 | 250 |
| 405 | 3300005335 | Ga0070666_10371291 | Ga0070666_103712911 | 250 |
| 406 | 3300005338 | Ga0068868_100000202 | Ga0068868_10000020219 | 250 |
| 407 | 3300005338 | Ga0068868_100426788 | Ga0068868_1004267882 | 250 |
| 408 | 3300005338 | Ga0068868_100551771 | Ga0068868_1005517711 | 250 |
| 409 | 3300005339 | Ga0070660_100004342 | Ga0070660_1000043423 | 250 |
| 410 | 3300005339 | Ga0070660_100054219 | Ga0070660_1000542192 | 250 |
| 411 | 3300005340 | Ga0070689_100517755 | Ga0070689_1005177551 | 250 |
| 412 | 3300005344 | Ga0070661_100002674 | Ga0070661_10000267410 | 250 |
| 413 | 3300005344 | Ga0070661_100005346 | Ga0070661_1000053466 | 250 |
| 414 | 3300005344 | Ga0070661_100053473 | Ga0070661_1000534731 | 250 |
| 415 | 3300005344 | Ga0070661_100189793 | Ga0070661_1001897932 | 250 |
| 416 | 3300005344 | Ga0070661_100234980 | Ga0070661_1002349802 | 250 |
| 417 | 3300005345 | Ga0070692_10012611 | Ga0070692_100126113 | 250 |
| 418 | 3300005347 | Ga0070668_100001226 | Ga0070668_1000012268 | 250 |
| 419 | 3300005347 | Ga0070668_100013228 | Ga0070668_1000132286 | 250 |
| 420 | 3300005347 | Ga0070668_100321385 | Ga0070668_1003213851 | 250 |
| 421 | 3300005354 | Ga0070675_100004894 | Ga0070675_1000048946 | 250 |
| 422 | 3300005354 | Ga0070675_100018428 | Ga0070675_1000184284 | 250 |
| 423 | 3300005354 | Ga0070675_100020120 | Ga0070675_1000201202 | 250 |
| 424 | 3300005354 | Ga0070675_100028350 | Ga0070675_1000283502 | 250 |
| 425 | 3300005355 | Ga0070671_100005030 | Ga0070671_1000050308 | 250 |
| 426 | 3300005355 | Ga0070671_100007991 | Ga0070671_1000079917 | 250 |
| 427 | 3300005355 | Ga0070671_100083526 | Ga0070671_1000835263 | 250 |
| 428 | 3300005356 | Ga0070674_100000310 | Ga0070674_10000031012 | 250 |
| 429 | 3300005356 | Ga0070674_100040277 | Ga0070674_1000402772 | 250 |
| 430 | 3300005356 | Ga0070674_100091895 | Ga0070674_1000918952 | 250 |
| 431 | 3300005364 | Ga0070673_100000377 | Ga0070673_1000003771 | 250 |
| 432 | 3300005364 | Ga0070673_100015977 | Ga0070673_1000159774 | 250 |
| 433 | 3300005364 | Ga0070673_100024384 | Ga0070673_1000243843 | 250 |
| 434 | 3300005364 | Ga0070673_100035279 | Ga0070673_1000352792 | 250 |
| 435 | 3300005364 | Ga0070673_100045407 | Ga0070673_1000454073 | 250 |
| 436 | 3300005366 | Ga0070659_100002822 | Ga0070659_10000282210 | 250 |
| 437 | 3300005366 | Ga0070659_100039163 | Ga0070659_1000391633 | 250 |
| 438 | 3300005366 | Ga0070659_100171595 | Ga0070659_1001715952 | 250 |
| 439 | 3300005367 | Ga0070667_100009129 | Ga0070667_1000091294 | 250 |
| 440 | 3300005367 | Ga0070667_100021029 | Ga0070667_1000210294 | 250 |
| 441 | 3300005434 | Ga0070709_10032614 | Ga0070709_100326142 | 250 |
| 442 | 3300005434 | Ga0070709_10503515 | Ga0070709_105035152 | 250 |
| 443 | 3300005435 | Ga0070714_100001888 | Ga0070714_10000188810 | 250 |
| 444 | 3300005435 | Ga0070714_100112229 | Ga0070714_1001122291 | 250 |
| 445 | 3300005435 | Ga0070714_100448063 | Ga0070714_1004480632 | 250 |
| 446 | 3300005436 | Ga0070713_100051580 | Ga0070713_1000515802 | 250 |
| 447 | 3300005437 | Ga0070710_10013243 | Ga0070710_100132433 | 250 |
| 448 | 3300005455 | Ga0070663_100000590 | Ga0070663_1000005908 | 250 |
| 449 | 3300005455 | Ga0070663_100141421 | Ga0070663_1001414211 | 250 |
| 450 | 3300005455 | Ga0070663_100163345 | Ga0070663_1001633452 | 250 |
| 451 | 3300005455 | Ga0070663_100498446 | Ga0070663_1004984462 | 250 |
| 452 | 3300005456 | Ga0070678_100002811 | Ga0070678_1000028116 | 250 |
| 453 | 3300005457 | Ga0070662_100055724 | Ga0070662_1000557242 | 250 |
| 454 | 3300005458 | Ga0070681_10012100 | Ga0070681_100121007 | 250 |
| 455 | 3300005458 | Ga0070681_10042339 | Ga0070681_100423394 | 250 |
| 456 | 3300005459 | Ga0068867_100004591 | Ga0068867_1000045914 | 250 |
| 457 | 3300005459 | Ga0068867_100017430 | Ga0068867_1000174303 | 250 |
| 458 | 3300005459 | Ga0068867_100030016 | Ga0068867_1000300164 | 250 |
| 459 | 3300005459 | Ga0068867_100383796 | Ga0068867_1003837961 | 250 |
| 460 | 3300005466 | Ga0070685_10014848 | Ga0070685_100148483 | 250 |
| 461 | 3300005518 | Ga0070699_100001885 | Ga0070699_1000018858 | 250 |
| 462 | 3300005530 | Ga0070679_100007564 | Ga0070679_1000075643 | 250 |
| 463 | 3300005530 | Ga0070679_100021550 | Ga0070679_1000215503 | 250 |
| 464 | 3300005530 | Ga0070679_100819547 | Ga0070679_1008195471 | 250 |
| 465 | 3300005530 | Ga0070679_100887894 | Ga0070679_1008878941 | 250 |
| 466 | 3300005535 | Ga0070684_100001171 | Ga0070684_1000011715 | 250 |
| 467 | 3300005535 | Ga0070684_100005136 | Ga0070684_1000051362 | 250 |
| 468 | 3300005539 | Ga0068853_100001630 | Ga0068853_1000016303 | 250 |
| 469 | 3300005539 | Ga0068853_100053634 | Ga0068853_1000536343 | 250 |
| 470 | 3300005539 | Ga0068853_100082326 | Ga0068853_1000823262 | 250 |
| 471 | 3300005539 | Ga0068853_100207744 | Ga0068853_1002077441 | 250 |
| 472 | 3300005539 | Ga0068853_100255155 | Ga0068853_1002551552 | 250 |
| 473 | 3300005539 | Ga0068853_100582658 | Ga0068853_1005826581 | 250 |
| 474 | 3300005543 | Ga0070672_100000154 | Ga0070672_10000015430 | 250 |
| 475 | 3300005543 | Ga0070672_100012524 | Ga0070672_1000125242 | 250 |
| 476 | 3300005543 | Ga0070672_100028014 | Ga0070672_1000280144 | 250 |
| 477 | 3300005543 | Ga0070672_100030677 | Ga0070672_1000306774 | 250 |
| 478 | 3300005543 | Ga0070672_100055143 | Ga0070672_1000551434 | 250 |
| 479 | 3300005543 | Ga0070672_100118285 | Ga0070672_1001182852 | 250 |
| 480 | 3300005547 | Ga0070693_100029155 | Ga0070693_1000291551 | 250 |
| 481 | 3300005548 | Ga0070665_100002599 | Ga0070665_10000259913 | 250 |
| 482 | 3300005548 | Ga0070665_100113299 | Ga0070665_1001132993 | 250 |
| 483 | 3300005563 | Ga0068855_100000453 | Ga0068855_1000004532 | 250 |
| 484 | 3300005563 | Ga0068855_100023304 | Ga0068855_1000233043 | 250 |
| 485 | 3300005563 | Ga0068855_100040480 | Ga0068855_1000404802 | 250 |
| 486 | 3300005563 | Ga0068855_100071949 | Ga0068855_1000719493 | 250 |
| 487 | 3300005564 | Ga0070664_100007881 | Ga0070664_1000078818 | 250 |
| 488 | 3300005564 | Ga0070664_100022623 | Ga0070664_1000226234 | 250 |
| 489 | 3300005564 | Ga0070664_100055758 | Ga0070664_1000557582 | 250 |
| 490 | 3300005564 | Ga0070664_100135705 | Ga0070664_1001357052 | 250 |
| 491 | 3300005564 | Ga0070664_100269620 | Ga0070664_1002696201 | 250 |
| 492 | 3300005577 | Ga0068857_100009699 | Ga0068857_1000096992 | 250 |
| 493 | 3300005577 | Ga0068857_100011559 | Ga0068857_1000115592 | 250 |
| 494 | 3300005578 | Ga0068854_100327529 | Ga0068854_1003275292 | 250 |
| 495 | 3300005614 | Ga0068856_100079751 | Ga0068856_1000797511 | 250 |
| 496 | 3300005614 | Ga0068856_100095318 | Ga0068856_1000953183 | 250 |
| 497 | 3300005614 | Ga0068856_100272361 | Ga0068856_1002723611 | 250 |
| 498 | 3300005614 | Ga0068856_100526687 | Ga0068856_1005266871 | 250 |
| 499 | 3300005616 | Ga0068852_100014848 | Ga0068852_1000148484 | 250 |
| 500 | 3300005616 | Ga0068852_100039716 | Ga0068852_1000397163 | 250 |
| 501 | 3300005616 | Ga0068852_100112109 | Ga0068852_1001121093 | 250 |
| 502 | 3300005616 | Ga0068852_100226062 | Ga0068852_1002260622 | 250 |
| 503 | 3300005616 | Ga0068852_100425308 | Ga0068852_1004253082 | 250 |
| 504 | 3300005617 | Ga0068859_100784661 | Ga0068859_1007846611 | 250 |
| 505 | 3300005618 | Ga0068864_100000871 | Ga0068864_10000087114 | 250 |
| 506 | 3300005618 | Ga0068864_100031930 | Ga0068864_1000319303 | 250 |
| 507 | 3300005618 | Ga0068864_100147230 | Ga0068864_1001472301 | 250 |
| 508 | 3300005718 | Ga0068866_10056517 | Ga0068866_100565172 | 250 |
| 509 | 3300005718 | Ga0068866_10131774 | Ga0068866_101317742 | 250 |
| 510 | 3300005719 | Ga0068861_100004991 | Ga0068861_1000049917 | 250 |
| 511 | 3300005834 | Ga0068851_10000162 | Ga0068851_1000016218 | 250 |
| 512 | 3300005834 | Ga0068851_10004370 | Ga0068851_100043703 | 250 |
| 513 | 3300005840 | Ga0068870_10039511 | Ga0068870_100395111 | 250 |
| 514 | 3300005840 | Ga0068870_10123732 | Ga0068870_101237321 | 250 |
| 515 | 3300005840 | Ga0068870_10306147 | Ga0068870_103061472 | 250 |
| 516 | 3300005841 | Ga0068863_100006936 | Ga0068863_1000069369 | 250 |
| 517 | 3300005841 | Ga0068863_100010991 | Ga0068863_1000109917 | 250 |
| 518 | 3300005841 | Ga0068863_100108141 | Ga0068863_1001081412 | 250 |
| 519 | 3300005842 | Ga0068858_100072757 | Ga0068858_1000727572 | 250 |
| 520 | 3300005843 | Ga0068860_100074217 | Ga0068860_1000742172 | 250 |
| 521 | 3300005843 | Ga0068860_100243430 | Ga0068860_1002434302 | 250 |
| 522 | 3300006237 | Ga0097621_100009127 | Ga0097621_1000091272 | 250 |
| 523 | 3300006871 | Ga0075434_100609147 | Ga0075434_1006091472 | 250 |
| 524 | 3300006881 | Ga0068865_100012280 | Ga0068865_1000122801 | 250 |
| 525 | 3300006914 | Ga0075436_100227664 | Ga0075436_1002276643 | 250 |
| 526 | 3300006931 | Ga0097620_100784535 | Ga0097620_1007845352 | 250 |
| 527 | 3300009093 | Ga0105240_10005556 | Ga0105240_1000555618 | 250 |
| 528 | 3300009093 | Ga0105240_10009189 | Ga0105240_1000918910 | 250 |
| 529 | 3300009098 | Ga0105245_10202208 | Ga0105245_102022082 | 250 |
| 530 | 3300009174 | Ga0105241_10001153 | Ga0105241_1000115310 | 250 |
| 531 | 3300009177 | Ga0105248_10015640 | Ga0105248_100156403 | 250 |
| 532 | 3300009177 | Ga0105248_10096242 | Ga0105248_100962422 | 250 |
| 533 | 3300009545 | Ga0105237_10006464 | Ga0105237_1000646410 | 250 |
| 534 | 3300009551 | Ga0105238_10002904 | Ga0105238_1000290414 | 250 |
| 535 | 3300009551 | Ga0105238_10014966 | Ga0105238_100149663 | 250 |
| 536 | 3300010375 | Ga0105239_10021891 | Ga0105239_100218912 | 250 |
| 537 | 3300010375 | Ga0105239_10449320 | Ga0105239_104493202 | 250 |
| 538 | 3300013100 | Ga0157373_10001625 | Ga0157373_1000162510 | 250 |
| 539 | 3300013100 | Ga0157373_10002315 | Ga0157373_100023154 | 250 |
| 540 | 3300013100 | Ga0157373_10131286 | Ga0157373_101312862 | 250 |
| 541 | 3300013102 | Ga0157371_10006118 | Ga0157371_100061183 | 250 |
| 542 | 3300013102 | Ga0157371_10198392 | Ga0157371_101983922 | 250 |
| 543 | 3300013104 | Ga0157370_10013088 | Ga0157370_100130882 | 250 |
| 544 | 3300013104 | Ga0157370_10039789 | Ga0157370_100397892 | 250 |
| 545 | 3300013104 | Ga0157370_10041188 | Ga0157370_100411883 | 250 |
| 546 | 3300013104 | Ga0157370_10092245 | Ga0157370_100922451 | 250 |
| 547 | 3300013104 | Ga0157370_10515518 | Ga0157370_105155181 | 250 |
| 548 | 3300013105 | Ga0157369_10018507 | Ga0157369_100185072 | 250 |
| 549 | 3300013105 | Ga0157369_10086410 | Ga0157369_100864103 | 250 |
| 550 | 3300013296 | Ga0157374_10002469 | Ga0157374_1000246914 | 250 |
| 551 | 3300013296 | Ga0157374_10024112 | Ga0157374_100241123 | 250 |
| 552 | 3300013296 | Ga0157374_10310029 | Ga0157374_103100292 | 250 |
| 553 | 3300013296 | Ga0157374_10494809 | Ga0157374_104948092 | 250 |
| 554 | 3300013296 | Ga0157374_10523599 | Ga0157374_105235991 | 250 |
| 555 | 3300013297 | Ga0157378_10254941 | Ga0157378_102549411 | 250 |
| 556 | 3300013297 | Ga0157378_10739708 | Ga0157378_107397082 | 250 |
| 557 | 3300013297 | Ga0157378_10751920 | Ga0157378_107519201 | 250 |
| 558 | 3300013306 | Ga0163162_10014407 | Ga0163162_100144078 | 250 |
| 559 | 3300013306 | Ga0163162_10133422 | Ga0163162_101334223 | 250 |
| 560 | 3300013306 | Ga0163162_10142267 | Ga0163162_101422671 | 250 |
| 561 | 3300013307 | Ga0157372_10008916 | Ga0157372_100089165 | 250 |
| 562 | 3300013307 | Ga0157372_10048489 | Ga0157372_100484893 | 250 |
| 563 | 3300013307 | Ga0157372_10175351 | Ga0157372_101753513 | 250 |
| 564 | 3300013308 | Ga0157375_10001062 | Ga0157375_1000106220 | 250 |
| 565 | 3300013308 | Ga0157375_10008634 | Ga0157375_100086342 | 250 |
| 566 | 3300014497 | Ga0182008_10088059 | Ga0182008_100880591 | 250 |
| 567 | 3300014497 | Ga0182008_10094444 | Ga0182008_100944442 | 250 |
| 568 | 3300014969 | Ga0157376_10032804 | Ga0157376_100328043 | 250 |
| 569 | 3300017792 | Ga0163161_10012661 | Ga0163161_100126615 | 250 |
| 570 | 3300017792 | Ga0163161_10189905 | Ga0163161_101899052 | 250 |
| 571 | 3300025315 | Ga0207697_10005684 | Ga0207697_100056843 | 250 |
| 572 | 3300025321 | Ga0207656_10000949 | Ga0207656_100009493 | 250 |
| 573 | 3300025321 | Ga0207656_10001351 | Ga0207656_100013515 | 250 |
| 574 | 3300025321 | Ga0207656_10115911 | Ga0207656_101159111 | 250 |
| 575 | 3300025893 | Ga0207682_10000069 | Ga0207682_100000696 | 250 |
| 576 | 3300025893 | Ga0207682_10044012 | Ga0207682_100440121 | 250 |
| 577 | 3300025899 | Ga0207642_10057581 | Ga0207642_100575812 | 250 |
| 578 | 3300025901 | Ga0207688_10059946 | Ga0207688_100599463 | 250 |
| 579 | 3300025903 | Ga0207680_10013991 | Ga0207680_100139911 | 250 |
| 580 | 3300025903 | Ga0207680_10168905 | Ga0207680_101689052 | 250 |
| 581 | 3300025907 | Ga0207645_10001232 | Ga0207645_100012329 | 250 |
| 582 | 3300025907 | Ga0207645_10002497 | Ga0207645_100024979 | 250 |
| 583 | 3300025909 | Ga0207705_10020554 | Ga0207705_100205543 | 250 |
| 584 | 3300025909 | Ga0207705_10645846 | Ga0207705_106458461 | 250 |
| 585 | 3300025911 | Ga0207654_10008354 | Ga0207654_100083542 | 250 |
| 586 | 3300025912 | Ga0207707_10006272 | Ga0207707_100062723 | 250 |
| 587 | 3300025912 | Ga0207707_10012306 | Ga0207707_100123063 | 250 |
| 588 | 3300025912 | Ga0207707_10110405 | Ga0207707_101104051 | 250 |
| 589 | 3300025912 | Ga0207707_10336073 | Ga0207707_103360732 | 250 |
| 590 | 3300025913 | Ga0207695_10001360 | Ga0207695_1000136028 | 250 |
| 591 | 3300025913 | Ga0207695_10006983 | Ga0207695_100069833 | 250 |
| 592 | 3300025913 | Ga0207695_10020583 | Ga0207695_100205831 | 250 |
| 593 | 3300025913 | Ga0207695_10099641 | Ga0207695_100996413 | 250 |
| 594 | 3300025914 | Ga0207671_10028983 | Ga0207671_100289833 | 250 |
| 595 | 3300025915 | Ga0207693_10108979 | Ga0207693_101089791 | 250 |
| 596 | 3300025916 | Ga0207663_10289578 | Ga0207663_102895782 | 250 |
| 597 | 3300025917 | Ga0207660_10003252 | Ga0207660_100032527 | 250 |
| 598 | 3300025917 | Ga0207660_10043284 | Ga0207660_100432841 | 250 |
| 599 | 3300025917 | Ga0207660_10594690 | Ga0207660_105946901 | 250 |
| 600 | 3300025919 | Ga0207657_10000524 | Ga0207657_1000052416 | 250 |
| 601 | 3300025919 | Ga0207657_10122371 | Ga0207657_101223712 | 250 |
| 602 | 3300025920 | Ga0207649_10002238 | Ga0207649_100022383 | 250 |
| 603 | 3300025920 | Ga0207649_10015519 | Ga0207649_100155193 | 250 |
| 604 | 3300025920 | Ga0207649_10225976 | Ga0207649_102259761 | 250 |
| 605 | 3300025921 | Ga0207652_10058808 | Ga0207652_100588083 | 250 |
| 606 | 3300025924 | Ga0207694_10001760 | Ga0207694_100017602 | 250 |
| 607 | 3300025924 | Ga0207694_10004511 | Ga0207694_100045116 | 250 |
| 608 | 3300025924 | Ga0207694_10146019 | Ga0207694_101460192 | 250 |
| 609 | 3300025925 | Ga0207650_10005184 | Ga0207650_100051847 | 250 |
| 610 | 3300025925 | Ga0207650_10008066 | Ga0207650_100080665 | 250 |
| 611 | 3300025925 | Ga0207650_10133200 | Ga0207650_101332002 | 250 |
| 612 | 3300025925 | Ga0207650_10593141 | Ga0207650_105931411 | 250 |
| 613 | 3300025926 | Ga0207659_10023091 | Ga0207659_100230912 | 250 |
| 614 | 3300025927 | Ga0207687_10517100 | Ga0207687_105171001 | 250 |
| 615 | 3300025928 | Ga0207700_10021182 | Ga0207700_100211822 | 250 |
| 616 | 3300025929 | Ga0207664_10003618 | Ga0207664_1000361810 | 250 |
| 617 | 3300025929 | Ga0207664_10231373 | Ga0207664_102313731 | 250 |
| 618 | 3300025931 | Ga0207644_10008388 | Ga0207644_100083882 | 250 |
| 619 | 3300025931 | Ga0207644_10169098 | Ga0207644_101690982 | 250 |
| 620 | 3300025932 | Ga0207690_10004332 | Ga0207690_100043322 | 250 |
| 621 | 3300025932 | Ga0207690_10135756 | Ga0207690_101357561 | 250 |
| 622 | 3300025933 | Ga0207706_10076464 | Ga0207706_100764643 | 250 |
| 623 | 3300025935 | Ga0207709_10102956 | Ga0207709_101029563 | 250 |
| 624 | 3300025935 | Ga0207709_10558088 | Ga0207709_105580882 | 250 |
| 625 | 3300025936 | Ga0207670_10519936 | Ga0207670_105199362 | 250 |
| 626 | 3300025937 | Ga0207669_10076299 | Ga0207669_100762993 | 250 |
| 627 | 3300025938 | Ga0207704_10115350 | Ga0207704_101153501 | 250 |
| 628 | 3300025940 | Ga0207691_10000343 | Ga0207691_1000034337 | 250 |
| 629 | 3300025940 | Ga0207691_10000826 | Ga0207691_100008268 | 250 |
| 630 | 3300025940 | Ga0207691_10001614 | Ga0207691_1000161413 | 250 |
| 631 | 3300025940 | Ga0207691_10007847 | Ga0207691_100078473 | 250 |
| 632 | 3300025940 | Ga0207691_10091643 | Ga0207691_100916432 | 250 |
| 633 | 3300025940 | Ga0207691_10211364 | Ga0207691_102113642 | 250 |
| 634 | 3300025941 | Ga0207711_10072118 | Ga0207711_100721183 | 250 |
| 635 | 3300025941 | Ga0207711_10446166 | Ga0207711_104461661 | 250 |
| 636 | 3300025942 | Ga0207689_10021920 | Ga0207689_100219203 | 250 |
| 637 | 3300025945 | Ga0207679_10002888 | Ga0207679_100028881 | 250 |
| 638 | 3300025945 | Ga0207679_10023404 | Ga0207679_100234042 | 250 |
| 639 | 3300025945 | Ga0207679_10054441 | Ga0207679_100544412 | 250 |
| 640 | 3300025945 | Ga0207679_10205861 | Ga0207679_102058611 | 250 |
| 641 | 3300025945 | Ga0207679_10206787 | Ga0207679_102067872 | 250 |
| 642 | 3300025945 | Ga0207679_10222219 | Ga0207679_102222192 | 250 |
| 643 | 3300025945 | Ga0207679_10264469 | Ga0207679_102644691 | 250 |
| 644 | 3300025949 | Ga0207667_10005070 | Ga0207667_100050703 | 250 |
| 645 | 3300025949 | Ga0207667_10005399 | Ga0207667_100053999 | 250 |
| 646 | 3300025949 | Ga0207667_10023396 | Ga0207667_100233962 | 250 |
| 647 | 3300025949 | Ga0207667_10035108 | Ga0207667_100351081 | 250 |
| 648 | 3300025960 | Ga0207651_10000672 | Ga0207651_100006724 | 250 |
| 649 | 3300025960 | Ga0207651_10022567 | Ga0207651_100225673 | 250 |
| 650 | 3300025960 | Ga0207651_10086815 | Ga0207651_100868152 | 250 |
| 651 | 3300025960 | Ga0207651_10095402 | Ga0207651_100954022 | 250 |
| 652 | 3300025960 | Ga0207651_10872936 | Ga0207651_108729361 | 250 |
| 653 | 3300025972 | Ga0207668_10038769 | Ga0207668_100387692 | 250 |
| 654 | 3300025972 | Ga0207668_10181768 | Ga0207668_101817682 | 250 |
| 655 | 3300025981 | Ga0207640_10009128 | Ga0207640_100091283 | 250 |
| 656 | 3300025981 | Ga0207640_10357053 | Ga0207640_103570531 | 250 |
| 657 | 3300025986 | Ga0207658_10001180 | Ga0207658_1000118013 | 250 |
| 658 | 3300025986 | Ga0207658_10093617 | Ga0207658_100936172 | 250 |
| 659 | 3300026023 | Ga0207677_10004841 | Ga0207677_100048413 | 250 |
| 660 | 3300026023 | Ga0207677_10120538 | Ga0207677_101205383 | 250 |
| 661 | 3300026023 | Ga0207677_10276451 | Ga0207677_102764511 | 250 |
| 662 | 3300026023 | Ga0207677_10572532 | Ga0207677_105725321 | 250 |
| 663 | 3300026035 | Ga0207703_10062768 | Ga0207703_100627682 | 250 |
| 664 | 3300026041 | Ga0207639_10042766 | Ga0207639_100427663 | 250 |
| 665 | 3300026041 | Ga0207639_10154037 | Ga0207639_101540372 | 250 |
| 666 | 3300026041 | Ga0207639_10273461 | Ga0207639_102734612 | 250 |
| 667 | 3300026041 | Ga0207639_10276853 | Ga0207639_102768532 | 250 |
| 668 | 3300026067 | Ga0207678_10000974 | Ga0207678_100009748 | 250 |
| 669 | 3300026067 | Ga0207678_10111746 | Ga0207678_101117461 | 250 |
| 670 | 3300026067 | Ga0207678_10172888 | Ga0207678_101728882 | 250 |
| 671 | 3300026067 | Ga0207678_10599802 | Ga0207678_105998021 | 250 |
| 672 | 3300026078 | Ga0207702_10010434 | Ga0207702_100104341 | 250 |
| 673 | 3300026078 | Ga0207702_10016629 | Ga0207702_100166294 | 250 |
| 674 | 3300026078 | Ga0207702_10203534 | Ga0207702_102035342 | 250 |
| 675 | 3300026078 | Ga0207702_10225287 | Ga0207702_102252872 | 250 |
| 676 | 3300026078 | Ga0207702_10253264 | Ga0207702_102532642 | 250 |
| 677 | 3300026078 | Ga0207702_10269471 | Ga0207702_102694712 | 250 |
| 678 | 3300026088 | Ga0207641_10119950 | Ga0207641_101199502 | 250 |
| 679 | 3300026088 | Ga0207641_10218621 | Ga0207641_102186211 | 250 |
| 680 | 3300026089 | Ga0207648_10002497 | Ga0207648_100024976 | 250 |
| 681 | 3300026089 | Ga0207648_10012406 | Ga0207648_100124064 | 250 |
| 682 | 3300026089 | Ga0207648_10389729 | Ga0207648_103897292 | 250 |
| 683 | 3300026095 | Ga0207676_10000548 | Ga0207676_1000054829 | 250 |
| 684 | 3300026095 | Ga0207676_10075779 | Ga0207676_100757792 | 250 |
| 685 | 3300026095 | Ga0207676_10455771 | Ga0207676_104557711 | 250 |
| 686 | 3300026116 | Ga0207674_10000045 | Ga0207674_1000004577 | 250 |
| 687 | 3300026118 | Ga0207675_100017006 | Ga0207675_1000170064 | 250 |
| 688 | 3300026118 | Ga0207675_100105148 | Ga0207675_1001051484 | 250 |
| 689 | 3300026121 | Ga0207683_10000009 | Ga0207683_1000000965 | 250 |
| 690 | 3300026121 | Ga0207683_10000182 | Ga0207683_1000018243 | 250 |
| 691 | 3300026142 | Ga0207698_10001283 | Ga0207698_100012833 | 250 |
| 692 | 3300026142 | Ga0207698_10029233 | Ga0207698_100292334 | 250 |
| 693 | 3300026142 | Ga0207698_10434707 | Ga0207698_104347072 | 250 |
| 694 | 3300027424 | Ga0209984_1011506 | Ga0209984_10115062 | 250 |
| 695 | 3300027876 | Ga0209974_10004711 | Ga0209974_100047112 | 250 |
| 696 | 3300028381 | Ga0268264_10039584 | Ga0268264_100395844 | 250 |
| 697 | 3300028381 | Ga0268264_10858882 | Ga0268264_108588821 | 250 |
| 698 | 3300031548 | Ga0307408_100029509 | Ga0307408_1000295093 | 250 |
| 699 | 3300031731 | Ga0307405_10002589 | Ga0307405_100025891 | 250 |
| 700 | 3300031824 | Ga0307413_10028792 | Ga0307413_100287922 | 250 |
| 701 | 3300031852 | Ga0307410_10017443 | Ga0307410_100174433 | 250 |
| 702 | 3300031901 | Ga0307406_10049422 | Ga0307406_100494223 | 250 |
| 703 | 3300031903 | Ga0307407_10100077 | Ga0307407_101000772 | 250 |
| 704 | 3300031911 | Ga0307412_10050730 | Ga0307412_100507303 | 250 |
| 705 | 3300031995 | Ga0307409_100195811 | Ga0307409_1001958112 | 250 |
| 706 | 3300031995 | Ga0307409_100256209 | Ga0307409_1002562092 | 250 |
| 707 | 3300032002 | Ga0307416_100085395 | Ga0307416_1000853953 | 250 |
| 708 | 3300032005 | Ga0307411_10003144 | Ga0307411_100031441 | 250 |
| 709 | 3300032005 | Ga0307411_10089629 | Ga0307411_100896293 | 250 |
| 710 | 3300036401 | Ga0373937_0196697 | Ga0373937_0196697_425_1177 | 250 |
| 711 | 3300037471 | Ga0395905_0014988 | Ga0395905_0014988_1098_1850 | 250 |
| 712 | 3300038443 | Ga0395901_0171472 | Ga0395901_0171472_1509_2261 | 250 |
| 713 | 3300039062 | Ga0400483_068901 | Ga0400483_068901_226_978 | 250 |
| 714 | 3300045051 | Ga0451576_0233789 | Ga0451576_0233789_155_907 | 250 |
| 715 | 3300048909 | Ga0496106_0005904 | Ga0496106_0005904_435_1187 | 250 |
| 716 | 3300048912 | Ga0496109_0666179 | Ga0496109_0666179_31_783 | 250 |
| 717 | 3300048913 | Ga0496110_0274091 | Ga0496110_0274091_35_787 | 250 |
| 718 | 3300048913 | Ga0496110_0292116 | Ga0496110_0292116_89_841 | 250 |
| 719 | 3300048915 | Ga0496112_0305970 | Ga0496112_0305970_597_1349 | 250 |
| 720 | 3300048917 | Ga0496114_0369051 | Ga0496114_0369051_16_768 | 250 |
| 721 | 3300049585 | Ga0501069_0005141 | Ga0501069_0005141_5024_5776 | 250 |
| 722 | 3300049586 | Ga0501070_0003776 | Ga0501070_0003776_123_875 | 250 |
| 723 | 3300049587 | Ga0501071_0305798 | Ga0501071_0305798_123_875 | 250 |
| 724 | 3300049589 | Ga0501073_0015471 | Ga0501073_0015471_2175_2927 | 250 |
| 725 | 3300049590 | Ga0501074_0022336 | Ga0501074_0022336_292_1134 | 250 |
| 726 | 3300049741 | Ga0501079_0029442 | Ga0501079_0029442_1399_2151 | 250 |
| 727 | 3300049742 | Ga0501080_0084524 | Ga0501080_0084524_157_909 | 250 |
| 728 | 3300049744 | Ga0501083_0022836 | Ga0501083_0022836_3380_4222 | 250 |
| 729 | 3300049744 | Ga0501083_0039192 | Ga0501083_0039192_2148_2900 | 250 |
| 730 | 3300049823 | Ga0501044_0183067 | Ga0501044_0183067_945_1697 | 250 |
| 731 | 3300050507 | nmdc:mga05p37_223159_c1 | nmdc:mga05p37_223159_c1_736_1488 | 250 |
| 732 | 3300050513 | nmdc:mga0rr50_57969_c1 | nmdc:mga0rr50_57969_c1_1002_1796 | 250 |
| 733 | 3300054114 | Ga0501084_0351336 | Ga0501084_0351336_321_1163 | 250 |
| 734 | 3300060353 | Ga0501082_0062503 | Ga0501082_0062503_2309_3151 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1t9g-assembly1.cif.gz_S | structure of the human mcad:etf complex | 0.9621 | 1 | 223 |
| 1t9g-assembly1.cif.gz_S | structure of the human mcad:etf complex | 0.9375 | 1 | 223 |
| 2a1t-assembly1.cif.gz_S | structure of the human mcad:etf e165betaa complex | 0.9249 | 2 | 241 |
| 1o95-assembly1.cif.gz_E | ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein | 0.9191 | 1 | 222 |
| 2a1t-assembly1.cif.gz_S | structure of the human mcad:etf e165betaa complex | 0.9099 | 2 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t9gS00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9621 | 1 | 223 | 3.40.50.620 |
| 1t9gS00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9375 | 1 | 223 | 3.40.50.620 |
| 1o94C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.916 | 1 | 210 | 3.40.50.620 |
| af_Q54YZ4_1_250_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.9119 | 2 | 246 | 3.40.50.620 |
| af_A4I154_9_258_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8984 | 1 | 248 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H2PLR8-F1-model_v4 | Electron transfer flavoprotein beta subunit | 0.9961 | 1 | 113 |
GO:0009055
|
| AF-A0A3D5N4G0-F1-model_v4 | Electron transfer flavoprotein subunit beta | 0.9961 | 1 | 100 |
GO:0009055
|
| AF-A0A7W9RY60-F1-model_v4 | Electron transfer flavoprotein alpha/beta subunit | 0.996 | 1 | 110 |
GO:0009055
|
| AF-A0A368TRL3-F1-model_v4 | Electron transfer flavoprotein subunit beta/FixA family protein | 0.9947 | 1 | 110 |
GO:0009055
|
| AF-A0A4S8F3U0-F1-model_v4 | Electron transfer flavoprotein subunit beta/FixA family protein | 0.9934 | 2 | 116 |
GO:0009055
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar