F478158

General Info

Members Datasets Scaffolds Average Seq Length
734 332 713 250

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0016643|Ga0395901_0016643_1081_1836
Length 251
Sequence MKILVPVKRVVDYNVKVRVKSDGSGVDIANVKMSMNPFDEIAVEEAVRLKEAGVATEIVAVSCGVTQCQETLRTAMAIGADRAILVETPADLELQPLAVAKLLKAVVDKEQPQLVILGKQAIDDDCNQTGQMLAALLDWPQATFASKLTVADGKASVTREVDGGLETLSLTLPAIVTTDLRLNEPRYVTLPNIMKAKKKPLDTVQPADLGVDVAPRLKTLKVAEPPKRSAGIKVPDVATLVDKLKNEAKVI

Samples

Sample ID Description Type Environment
1 2534681786 Brucella suis 92/29 Isolate Unclassified
2 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
3 2595698237 Methylobacterium sp. UNCCL125 Isolate Unclassified
4 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
5 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
6 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
7 2751185800 Brucella pituitosa AA2 Isolate Unclassified
8 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
9 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
10 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
11 2842711865 Duganella sp. R-73148 Isolate Unclassified
12 2854911287 Brucella lupini LUP21 Isolate Unclassified
13 2855730933 Achromobacter sp. HZ28 Isolate Nodule
14 2855767633 Achromobacter sp. HZ34 Isolate Nodule
15 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
16 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
17 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
18 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
19 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
47 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
48 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
49 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
113 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
114 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
115 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
128 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
194 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
197 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
198 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
199 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
200 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
216 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
217 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
232 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
233 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
234 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
235 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
236 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
240 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
243 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
261 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
262 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
269 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
270 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
277 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
278 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
281 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
298 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
299 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
310 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
315 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
316 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
317 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
318 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
319 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
320 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
321 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
322 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
323 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
324 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
325 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
326 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
327 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
328 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
329 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
330 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
331 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
332 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97
Metatranscriptomes 0.14
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.86
Nodule 0.41
Rhizoplane 2.32
Rhizosphere 89.65
Stem 0
Stem Tuber 0
Unclassified 4.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10078825 3300001979 Bacteria 867
2 Ga0070658_10007411 3300005327 Bacteria 8859
3 Ga0070676_10010301 3300005328 Bacteria 5069
4 Ga0070676_10169957 3300005328 Bacteria 1409
5 Ga0070676_10239067 3300005328 Bacteria 1207
6 Ga0070683_100008427 3300005329 Bacteria 8756
7 Ga0070690_100056989 3300005330 Bacteria 2507
8 Ga0070670_100192158 3300005331 Bacteria 1773
9 Ga0070670_100257209 3300005331 Bacteria 1522
10 Ga0070677_10000303 3300005333 Bacteria 17204
11 Ga0070677_10020974 3300005333 Bacteria 2390
12 Ga0068869_100066857 3300005334 Bacteria 2650
13 Ga0070666_10007495 3300005335 Bacteria 6726
14 Ga0070666_10010571 3300005335 Bacteria 5776
15 Ga0070666_10371291 3300005335 Bacteria 1026
16 Ga0070680_100073271 3300005336 Bacteria 2816
17 Ga0068868_100000202 3300005338 Bacteria 40069
18 Ga0068868_100426788 3300005338 Bacteria 1149
19 Ga0068868_100551771 3300005338 Bacteria 1016
20 Ga0070660_100004342 3300005339 Bacteria 9795
21 Ga0070660_100012151 3300005339 Bacteria 6148
22 Ga0070660_100054219 3300005339 Bacteria 3095
23 Ga0070660_100063163 3300005339 Bacteria 2878
24 Ga0070660_100166387 3300005339 Bacteria 1779
25 Ga0070689_100068704 3300005340 Bacteria 2764
26 Ga0070689_100084918 3300005340 Bacteria 2489
27 Ga0070689_100517755 3300005340 Bacteria 1024
28 Ga0070661_100002674 3300005344 Bacteria 12199
29 Ga0070661_100005346 3300005344 Bacteria 8859
30 Ga0070661_100053473 3300005344 Bacteria 2956
31 Ga0070661_100189793 3300005344 Bacteria 1567
32 Ga0070661_100234980 3300005344 Bacteria 1410
33 Ga0070692_10012611 3300005345 Bacteria 3918
34 Ga0070668_100001226 3300005347 Bacteria 18239
35 Ga0070668_100013228 3300005347 Bacteria 6155
36 Ga0070668_100021611 3300005347 Bacteria 4861
37 Ga0070668_100030266 3300005347 Bacteria 4116
38 Ga0070668_100321385 3300005347 Bacteria 1303
39 Ga0070669_100011290 3300005353 Bacteria 6342
40 Ga0070669_100135950 3300005353 Bacteria 1891
41 Ga0070675_100004894 3300005354 Bacteria 10218
42 Ga0070675_100018428 3300005354 Bacteria 5555
43 Ga0070675_100020120 3300005354 Bacteria 5325
44 Ga0070675_100028350 3300005354 Bacteria 4507
45 Ga0070675_100189929 3300005354 Bacteria 1779
46 Ga0070671_100005030 3300005355 Bacteria 10541
47 Ga0070671_100007991 3300005355 Bacteria 8466
48 Ga0070671_100083526 3300005355 Bacteria 2670
49 Ga0070674_100000310 3300005356 Bacteria 23996
50 Ga0070674_100040277 3300005356 Bacteria 3160
51 Ga0070674_100091895 3300005356 Bacteria 2193
52 Ga0070674_100138643 3300005356 Bacteria 1823
53 Ga0070673_100000377 3300005364 Bacteria 23358
54 Ga0070673_100015977 3300005364 Bacteria 5291
55 Ga0070673_100024384 3300005364 Bacteria 4435
56 Ga0070673_100035279 3300005364 Bacteria 3791
57 Ga0070673_100045407 3300005364 Bacteria 3407
58 Ga0070673_100171359 3300005364 Bacteria 1853
59 Ga0070659_100002822 3300005366 Bacteria 12364
60 Ga0070659_100039163 3300005366 Bacteria 3699
61 Ga0070659_100171595 3300005366 Bacteria 1777
62 Ga0070667_100009129 3300005367 Bacteria 8205
63 Ga0070667_100021029 3300005367 Bacteria 5421
64 Ga0070667_100126024 3300005367 Bacteria 2231
65 Ga0070667_100322824 3300005367 Bacteria 1393
66 Ga0070709_10032614 3300005434 Bacteria 3142
67 Ga0070709_10503515 3300005434 Bacteria 920
68 Ga0070714_100001888 3300005435 Bacteria 15291
69 Ga0070714_100112229 3300005435 Bacteria 2415
70 Ga0070714_100143716 3300005435 Bacteria 2144
71 Ga0070714_100448063 3300005435 Bacteria 1226
72 Ga0070713_100051580 3300005436 Bacteria 3402
73 Ga0070710_10013243 3300005437 Bacteria 4124
74 Ga0070705_100107555 3300005440 Bacteria 1775
75 Ga0070700_100000389 3300005441 Bacteria 22607
76 Ga0070694_100123770 3300005444 Bacteria 1859
77 Ga0070708_100052118 3300005445 Bacteria 3627
78 Ga0070663_100000590 3300005455 Bacteria 19317
79 Ga0070663_100141421 3300005455 Bacteria 1838
80 Ga0070663_100163345 3300005455 Bacteria 1716
81 Ga0070663_100498446 3300005455 Bacteria 1011
82 Ga0070678_100002811 3300005456 Bacteria 9619
83 Ga0070678_100091988 3300005456 Bacteria 2329
84 Ga0070662_100055724 3300005457 Bacteria 2869
85 Ga0070662_100121970 3300005457 Bacteria 1999
86 Ga0070681_10012100 3300005458 Bacteria 8556
87 Ga0070681_10042339 3300005458 Bacteria 4564
88 Ga0070681_10113222 3300005458 Bacteria 2653
89 Ga0068867_100004591 3300005459 Bacteria 9712
90 Ga0068867_100017430 3300005459 Bacteria 5103
91 Ga0068867_100024393 3300005459 Bacteria 4333
92 Ga0068867_100030016 3300005459 Bacteria 3920
93 Ga0068867_100096522 3300005459 Bacteria 2251
94 Ga0068867_100374839 3300005459 Bacteria 1194
95 Ga0068867_100383796 3300005459 Bacteria 1181
96 Ga0070685_10014848 3300005466 Bacteria 4130
97 Ga0070706_100144128 3300005467 Bacteria 2224
98 Ga0070706_100167220 3300005467 Bacteria 2053
99 Ga0070706_100241043 3300005467 Bacteria 1688
100 Ga0070698_100003313 3300005471 Bacteria 17719
101 Ga0070698_100366248 3300005471 Bacteria 1373
102 Ga0070699_100001885 3300005518 Bacteria 18942
103 Ga0070699_100024597 3300005518 Bacteria 5191
104 Ga0070679_100005852 3300005530 Bacteria 11410
105 Ga0070679_100007564 3300005530 Bacteria 10161
106 Ga0070679_100021550 3300005530 Bacteria 6293
107 Ga0070679_100221193 3300005530 Bacteria 1854
108 Ga0070679_100819547 3300005530 Bacteria 874
109 Ga0070679_100887894 3300005530 Bacteria 835
110 Ga0070684_100001171 3300005535 Bacteria 18817
111 Ga0070684_100005136 3300005535 Bacteria 10008
112 Ga0070697_100104285 3300005536 Bacteria 2358
113 Ga0068853_100001630 3300005539 Bacteria 16404
114 Ga0068853_100053634 3300005539 Bacteria 3472
115 Ga0068853_100082326 3300005539 Bacteria 2819
116 Ga0068853_100119321 3300005539 Bacteria 2351
117 Ga0068853_100207744 3300005539 Bacteria 1784
118 Ga0068853_100255155 3300005539 Bacteria 1611
119 Ga0068853_100349604 3300005539 Bacteria 1375
120 Ga0068853_100582658 3300005539 Bacteria 1062
121 Ga0070672_100000154 3300005543 Bacteria 37910
122 Ga0070672_100012524 3300005543 Bacteria 5959
123 Ga0070672_100028014 3300005543 Bacteria 4210
124 Ga0070672_100030677 3300005543 Bacteria 4041
125 Ga0070672_100036976 3300005543 Bacteria 3723
126 Ga0070672_100055143 3300005543 Bacteria 3113
127 Ga0070672_100118285 3300005543 Bacteria 2167
128 Ga0070672_100169363 3300005543 Bacteria 1816
129 Ga0070695_100095318 3300005545 Bacteria 1994
130 Ga0070696_100068958 3300005546 Bacteria 2484
131 Ga0070696_100075437 3300005546 Bacteria 2379
132 Ga0070696_100144725 3300005546 Bacteria 1740
133 Ga0070693_100000664 3300005547 Bacteria 15219
134 Ga0070693_100029155 3300005547 Bacteria 3008
135 Ga0070665_100001485 3300005548 Bacteria 27386
136 Ga0070665_100002599 3300005548 Bacteria 19719
137 Ga0070665_100016813 3300005548 Bacteria 7334
138 Ga0070665_100113299 3300005548 Bacteria 2715
139 Ga0070665_100453913 3300005548 Bacteria 1291
140 Ga0068855_100000453 3300005563 Bacteria 50677
141 Ga0068855_100021038 3300005563 Bacteria 7823
142 Ga0068855_100023304 3300005563 Bacteria 7414
143 Ga0068855_100032340 3300005563 Bacteria 6247
144 Ga0068855_100040480 3300005563 Bacteria 5531
145 Ga0068855_100071949 3300005563 Bacteria 4019
146 Ga0068855_100202606 3300005563 Bacteria 2233
147 Ga0070664_100007881 3300005564 Bacteria 8603
148 Ga0070664_100022623 3300005564 Bacteria 5183
149 Ga0070664_100055758 3300005564 Bacteria 3357
150 Ga0070664_100135705 3300005564 Bacteria 2163
151 Ga0070664_100269620 3300005564 Bacteria 1533
152 Ga0068857_100009699 3300005577 Bacteria 8366
153 Ga0068857_100011559 3300005577 Bacteria 7680
154 Ga0068854_100327529 3300005578 Bacteria 1247
155 Ga0068856_100079751 3300005614 Bacteria 3246
156 Ga0068856_100095318 3300005614 Bacteria 2964
157 Ga0068856_100130033 3300005614 Bacteria 2522
158 Ga0068856_100272361 3300005614 Bacteria 1709
159 Ga0068856_100526687 3300005614 Bacteria 1203
160 Ga0070702_100090588 3300005615 Bacteria 1854
161 Ga0068852_100006808 3300005616 Bacteria 8298
162 Ga0068852_100014848 3300005616 Bacteria 6018
163 Ga0068852_100039716 3300005616 Bacteria 3964
164 Ga0068852_100112109 3300005616 Bacteria 2481
165 Ga0068852_100172530 3300005616 Bacteria 2028
166 Ga0068852_100226062 3300005616 Bacteria 1782
167 Ga0068852_100425308 3300005616 Bacteria 1311
168 Ga0068852_100510253 3300005616 Bacteria 1198
169 Ga0068859_100442671 3300005617 Bacteria 1396
170 Ga0068859_100784661 3300005617 Bacteria 1041
171 Ga0068864_100000871 3300005618 Bacteria 25420
172 Ga0068864_100031930 3300005618 Bacteria 4471
173 Ga0068864_100147230 3300005618 Bacteria 2130
174 Ga0068866_10003537 3300005718 Bacteria 6399
175 Ga0068866_10056517 3300005718 Bacteria 2018
176 Ga0068866_10131774 3300005718 Bacteria 1423
177 Ga0068861_100000316 3300005719 Bacteria 27077
178 Ga0068861_100004991 3300005719 Bacteria 8943
179 Ga0068851_10000162 3300005834 Bacteria 34956
180 Ga0068851_10004370 3300005834 Bacteria 6363
181 Ga0068851_10017787 3300005834 Bacteria 3419
182 Ga0068870_10039511 3300005840 Bacteria 2442
183 Ga0068870_10123732 3300005840 Bacteria 1493
184 Ga0068870_10306147 3300005840 Bacteria 1005
185 Ga0068863_100006936 3300005841 Bacteria 11104
186 Ga0068863_100010991 3300005841 Bacteria 8779
187 Ga0068863_100108141 3300005841 Bacteria 2647
188 Ga0068863_100223289 3300005841 Bacteria 1815
189 Ga0068858_100072757 3300005842 Bacteria 3189
190 Ga0068858_100150752 3300005842 Bacteria 2186
191 Ga0068860_100074217 3300005843 Bacteria 3234
192 Ga0068860_100243430 3300005843 Bacteria 1750
193 Ga0068862_100057288 3300005844 Bacteria 3341
194 Ga0068862_100123419 3300005844 Bacteria 2285
195 Ga0075364_10209920 3300006051 Bacteria 1320
196 Ga0075432_10007467 3300006058 Bacteria 3724
197 Ga0075362_10043316 3300006177 Bacteria 1993
198 Ga0075366_10063992 3300006195 Bacteria 2187
199 Ga0097621_100009127 3300006237 Bacteria 7186
200 Ga0097621_100030201 3300006237 Bacteria 4287
201 Ga0068871_100010900 3300006358 Bacteria 6655
202 Ga0068871_100075325 3300006358 Bacteria 2786
203 Ga0075434_100609147 3300006871 Bacteria 1111
204 Ga0075429_100069086 3300006880 Bacteria 3076
205 Ga0068865_100003157 3300006881 Bacteria 9864
206 Ga0068865_100012280 3300006881 Bacteria 5387
207 Ga0075436_100018225 3300006914 Bacteria 4808
208 Ga0075436_100227664 3300006914 Bacteria 1324
209 Ga0097620_100010242 3300006931 Bacteria 9436
210 Ga0097620_100442683 3300006931 Bacteria 1396
211 Ga0097620_100784535 3300006931 Bacteria 1041
212 Ga0105240_10005452 3300009093 Bacteria 18958
213 Ga0105240_10005556 3300009093 Bacteria 18767
214 Ga0105240_10009189 3300009093 Bacteria 14018
215 Ga0105240_10071585 3300009093 Bacteria 4287
216 Ga0105240_10121999 3300009093 Bacteria 3137
217 Ga0105240_10696894 3300009093 Bacteria 1109
218 Ga0111539_10004114 3300009094 Bacteria 19083
219 Ga0111539_10158467 3300009094 Bacteria 2648
220 Ga0111539_10207054 3300009094 Bacteria 2286
221 Ga0111539_11125707 3300009094 Bacteria 912
222 Ga0111539_11176176 3300009094 Bacteria 891
223 Ga0105245_10108460 3300009098 Bacteria 2579
224 Ga0105245_10202208 3300009098 Bacteria 1908
225 Ga0105243_10038652 3300009148 Bacteria 3717
226 Ga0105241_10001153 3300009174 Bacteria 20106
227 Ga0105241_10286296 3300009174 Bacteria 1409
228 Ga0105242_10002660 3300009176 Bacteria 14000
229 Ga0105248_10015640 3300009177 Bacteria 8364
230 Ga0105248_10096242 3300009177 Bacteria 3334
231 Ga0105248_10237679 3300009177 Bacteria 2051
232 Ga0105237_10006464 3300009545 Bacteria 12995
233 Ga0105237_10261443 3300009545 Bacteria 1733
234 Ga0105237_10299783 3300009545 Bacteria 1610
235 Ga0105237_10423989 3300009545 Bacteria 1336
236 Ga0105238_10002904 3300009551 Bacteria 17122
237 Ga0105238_10014966 3300009551 Bacteria 7854
238 Ga0105238_10070887 3300009551 Bacteria 3483
239 Ga0105238_10085095 3300009551 Bacteria 3151
240 Ga0105249_10050559 3300009553 Bacteria 3789
241 Ga0105249_10714541 3300009553 Bacteria 1063
242 Ga0099796_10143091 3300010159 Bacteria 936
243 Ga0105239_10021891 3300010375 Bacteria 7048
244 Ga0105239_10037066 3300010375 Bacteria 5349
245 Ga0105239_10449320 3300010375 Bacteria 1462
246 Ga0105239_10674763 3300010375 Bacteria 1181
247 Ga0157373_10001625 3300013100 Bacteria 17155
248 Ga0157373_10002315 3300013100 Bacteria 14434
249 Ga0157373_10131286 3300013100 Bacteria 1762
250 Ga0157371_10006118 3300013102 Bacteria 10004
251 Ga0157371_10198392 3300013102 Bacteria 1438
252 Ga0157370_10010719 3300013104 Bacteria 9640
253 Ga0157370_10013088 3300013104 Bacteria 8563
254 Ga0157370_10039789 3300013104 Bacteria 4542
255 Ga0157370_10041188 3300013104 Bacteria 4459
256 Ga0157370_10047695 3300013104 Bacteria 4105
257 Ga0157370_10066646 3300013104 Bacteria 3404
258 Ga0157370_10092245 3300013104 Bacteria 2843
259 Ga0157370_10349031 3300013104 Bacteria 1364
260 Ga0157370_10515518 3300013104 Bacteria 1098
261 Ga0157369_10018507 3300013105 Bacteria 7809
262 Ga0157369_10068397 3300013105 Bacteria 3816
263 Ga0157369_10086410 3300013105 Bacteria 3350
264 Ga0157369_10419440 3300013105 Bacteria 1387
265 Ga0157374_10002469 3300013296 Bacteria 15618
266 Ga0157374_10024112 3300013296 Bacteria 5450
267 Ga0157374_10310029 3300013296 Bacteria 1562
268 Ga0157374_10494809 3300013296 Bacteria 1227
269 Ga0157374_10523599 3300013296 Bacteria 1192
270 Ga0157378_10045990 3300013297 Bacteria 3880
271 Ga0157378_10198283 3300013297 Bacteria 1897
272 Ga0157378_10254941 3300013297 Bacteria 1681
273 Ga0157378_10739708 3300013297 Bacteria 1006
274 Ga0157378_10751920 3300013297 Bacteria 998
275 Ga0163162_10014407 3300013306 Bacteria 7727
276 Ga0163162_10133422 3300013306 Bacteria 2593
277 Ga0163162_10142267 3300013306 Bacteria 2513
278 Ga0163162_10242048 3300013306 Bacteria 1935
279 Ga0157372_10008916 3300013307 Bacteria 10656
280 Ga0157372_10028729 3300013307 Bacteria 6071
281 Ga0157372_10048489 3300013307 Bacteria 4721
282 Ga0157372_10106261 3300013307 Bacteria 3211
283 Ga0157372_10175351 3300013307 Bacteria 2481
284 Ga0157375_10001062 3300013308 Bacteria 23741
285 Ga0157375_10008634 3300013308 Bacteria 8923
286 Ga0157375_10672425 3300013308 Bacteria 1190
287 Ga0163163_11008069 3300014325 Bacteria 896
288 Ga0182008_10088059 3300014497 Bacteria 1530
289 Ga0182008_10094444 3300014497 Bacteria 1475
290 Ga0157377_10006333 3300014745 Bacteria 5637
291 Ga0157379_10111123 3300014968 Bacteria 2461
292 Ga0157376_10032804 3300014969 Bacteria 4173
293 Ga0157376_10198234 3300014969 Bacteria 1845
294 Ga0163161_10012661 3300017792 Bacteria 5859
295 Ga0163161_10189905 3300017792 Bacteria 1579
296 Ga0163161_10509870 3300017792 Bacteria 981
297 Ga0206351_10961181 3300020077 Eukaryota 831
298 Ga0213872_10000191 3300021361 Bacteria 54643
299 Ga0213872_10134565 3300021361 Bacteria 1087
300 Ga0213874_10019065 3300021377 Bacteria 1863
301 Ga0213876_10010100 3300021384 Bacteria 5073
302 Ga0213876_10128763 3300021384 Bacteria 1345
303 Ga0213871_10005091 3300021441 Bacteria 2686
304 Ga0213871_10020431 3300021441 Bacteria 1640
305 Ga0209025_1000040 3300025294 Bacteria 376228
306 Ga0207697_10005684 3300025315 Bacteria 5754
307 Ga0207697_10199249 3300025315 Bacteria 880
308 Ga0207656_10000949 3300025321 Bacteria 9470
309 Ga0207656_10001351 3300025321 Bacteria 8089
310 Ga0207656_10023192 3300025321 Bacteria 2496
311 Ga0207656_10115911 3300025321 Bacteria 1243
312 Ga0207682_10000069 3300025893 Bacteria 45399
313 Ga0207682_10044012 3300025893 Bacteria 1829
314 Ga0207642_10057581 3300025899 Bacteria 1789
315 Ga0207688_10059946 3300025901 Bacteria 2143
316 Ga0207680_10013991 3300025903 Bacteria 4137
317 Ga0207680_10168905 3300025903 Bacteria 1472
318 Ga0207699_10025473 3300025906 Bacteria 3248
319 Ga0207645_10001232 3300025907 Bacteria 21068
320 Ga0207645_10002497 3300025907 Bacteria 14438
321 Ga0207645_10089973 3300025907 Bacteria 1974
322 Ga0207705_10020554 3300025909 Bacteria 4714
323 Ga0207705_10028966 3300025909 Bacteria 3949
324 Ga0207705_10029460 3300025909 Bacteria 3913
325 Ga0207705_10645846 3300025909 Bacteria 823
326 Ga0207684_10111542 3300025910 Bacteria 2341
327 Ga0207684_10434069 3300025910 Bacteria 1128
328 Ga0207654_10008354 3300025911 Bacteria 5229
329 Ga0207707_10006272 3300025912 Bacteria 10385
330 Ga0207707_10012306 3300025912 Bacteria 7436
331 Ga0207707_10033902 3300025912 Bacteria 4468
332 Ga0207707_10110405 3300025912 Bacteria 2404
333 Ga0207707_10336073 3300025912 Bacteria 1303
334 Ga0207695_10000806 3300025913 Bacteria 58371
335 Ga0207695_10001360 3300025913 Bacteria 41481
336 Ga0207695_10006983 3300025913 Bacteria 14490
337 Ga0207695_10020583 3300025913 Bacteria 7553
338 Ga0207695_10094842 3300025913 Bacteria 2990
339 Ga0207695_10095321 3300025913 Bacteria 2980
340 Ga0207695_10099641 3300025913 Bacteria 2903
341 Ga0207695_10201036 3300025913 Bacteria 1907
342 Ga0207695_10584682 3300025913 Bacteria 998
343 Ga0207671_10028983 3300025914 Bacteria 4135
344 Ga0207693_10108979 3300025915 Bacteria 2172
345 Ga0207663_10289578 3300025916 Bacteria 1219
346 Ga0207660_10003252 3300025917 Bacteria 10643
347 Ga0207660_10043284 3300025917 Bacteria 3164
348 Ga0207660_10052150 3300025917 Bacteria 2911
349 Ga0207660_10090744 3300025917 Bacteria 2264
350 Ga0207660_10594690 3300025917 Bacteria 901
351 Ga0207657_10000524 3300025919 Bacteria 40619
352 Ga0207657_10022610 3300025919 Bacteria 5878
353 Ga0207657_10122371 3300025919 Bacteria 2140
354 Ga0207657_10167188 3300025919 Bacteria 1783
355 Ga0207657_10269930 3300025919 Bacteria 1352
356 Ga0207649_10002238 3300025920 Bacteria 10931
357 Ga0207649_10015519 3300025920 Bacteria 4280
358 Ga0207649_10225976 3300025920 Bacteria 1336
359 Ga0207652_10008722 3300025921 Bacteria 8160
360 Ga0207652_10058808 3300025921 Bacteria 3312
361 Ga0207652_10059551 3300025921 Bacteria 3292
362 Ga0207652_10136635 3300025921 Bacteria 2189
363 Ga0207681_10013955 3300025923 Bacteria 4978
364 Ga0207681_10104032 3300025923 Bacteria 2053
365 Ga0207694_10001760 3300025924 Bacteria 18157
366 Ga0207694_10004511 3300025924 Bacteria 10863
367 Ga0207694_10146019 3300025924 Bacteria 1904
368 Ga0207694_10180375 3300025924 Bacteria 1712
369 Ga0207694_10240098 3300025924 Bacteria 1481
370 Ga0207650_10005184 3300025925 Bacteria 8891
371 Ga0207650_10008066 3300025925 Bacteria 7176
372 Ga0207650_10133200 3300025925 Bacteria 1947
373 Ga0207650_10593141 3300025925 Bacteria 931
374 Ga0207659_10023091 3300025926 Bacteria 4148
375 Ga0207659_10035920 3300025926 Bacteria 3429
376 Ga0207687_10168112 3300025927 Bacteria 1689
377 Ga0207687_10517100 3300025927 Bacteria 998
378 Ga0207687_10523119 3300025927 Bacteria 992
379 Ga0207700_10021182 3300025928 Bacteria 4432
380 Ga0207664_10003618 3300025929 Bacteria 10344
381 Ga0207664_10095049 3300025929 Bacteria 2451
382 Ga0207664_10119111 3300025929 Bacteria 2207
383 Ga0207664_10231373 3300025929 Bacteria 1607
384 Ga0207644_10008388 3300025931 Bacteria 6762
385 Ga0207644_10169098 3300025931 Bacteria 1705
386 Ga0207690_10004332 3300025932 Bacteria 8383
387 Ga0207690_10135756 3300025932 Bacteria 1806
388 Ga0207706_10076464 3300025933 Bacteria 2944
389 Ga0207686_10051120 3300025934 Bacteria 2573
390 Ga0207686_10445358 3300025934 Bacteria 995
391 Ga0207709_10002633 3300025935 Bacteria 11161
392 Ga0207709_10102956 3300025935 Bacteria 1891
393 Ga0207709_10558088 3300025935 Bacteria 902
394 Ga0207670_10077452 3300025936 Bacteria 2316
395 Ga0207670_10519936 3300025936 Bacteria 969
396 Ga0207669_10076299 3300025937 Bacteria 2127
397 Ga0207704_10022141 3300025938 Bacteria 3399
398 Ga0207704_10115350 3300025938 Bacteria 1825
399 Ga0207691_10000343 3300025940 Bacteria 46843
400 Ga0207691_10000826 3300025940 Bacteria 30881
401 Ga0207691_10001614 3300025940 Bacteria 22406
402 Ga0207691_10007847 3300025940 Bacteria 10281
403 Ga0207691_10091643 3300025940 Bacteria 2723
404 Ga0207691_10211364 3300025940 Bacteria 1685
405 Ga0207711_10072118 3300025941 Bacteria 2999
406 Ga0207711_10091298 3300025941 Bacteria 2678
407 Ga0207711_10142215 3300025941 Bacteria 2159
408 Ga0207711_10446166 3300025941 Bacteria 1204
409 Ga0207689_10021920 3300025942 Bacteria 5373
410 Ga0207679_10002888 3300025945 Bacteria 10658
411 Ga0207679_10023404 3300025945 Bacteria 4223
412 Ga0207679_10054441 3300025945 Bacteria 2945
413 Ga0207679_10205861 3300025945 Bacteria 1647
414 Ga0207679_10206787 3300025945 Bacteria 1643
415 Ga0207679_10222219 3300025945 Bacteria 1590
416 Ga0207679_10264469 3300025945 Bacteria 1468
417 Ga0207667_10005070 3300025949 Bacteria 16094
418 Ga0207667_10005399 3300025949 Bacteria 15585
419 Ga0207667_10023396 3300025949 Bacteria 6803
420 Ga0207667_10024982 3300025949 Bacteria 6549
421 Ga0207667_10035108 3300025949 Bacteria 5380
422 Ga0207667_10173798 3300025949 Bacteria 2214
423 Ga0207651_10000672 3300025960 Bacteria 14616
424 Ga0207651_10022567 3300025960 Bacteria 3851
425 Ga0207651_10086815 3300025960 Bacteria 2275
426 Ga0207651_10095402 3300025960 Bacteria 2190
427 Ga0207651_10442950 3300025960 Bacteria 1113
428 Ga0207651_10872936 3300025960 Bacteria 800
429 Ga0207712_10027674 3300025961 Bacteria 3787
430 Ga0207668_10038769 3300025972 Bacteria 3201
431 Ga0207668_10114188 3300025972 Bacteria 2032
432 Ga0207668_10181768 3300025972 Bacteria 1659
433 Ga0207640_10009128 3300025981 Bacteria 5538
434 Ga0207640_10329991 3300025981 Bacteria 1218
435 Ga0207640_10357053 3300025981 Bacteria 1176
436 Ga0207658_10001180 3300025986 Bacteria 20855
437 Ga0207658_10093617 3300025986 Bacteria 2336
438 Ga0207677_10004841 3300026023 Bacteria 7265
439 Ga0207677_10120538 3300026023 Bacteria 1972
440 Ga0207677_10148576 3300026023 Bacteria 1804
441 Ga0207677_10276451 3300026023 Bacteria 1376
442 Ga0207677_10572532 3300026023 Bacteria 987
443 Ga0207703_10062768 3300026035 Bacteria 3044
444 Ga0207703_10162752 3300026035 Bacteria 1955
445 Ga0207639_10042766 3300026041 Bacteria 3397
446 Ga0207639_10154037 3300026041 Bacteria 1928
447 Ga0207639_10217459 3300026041 Bacteria 1648
448 Ga0207639_10273461 3300026041 Bacteria 1483
449 Ga0207639_10276853 3300026041 Bacteria 1474
450 Ga0207678_10000974 3300026067 Bacteria 26088
451 Ga0207678_10111746 3300026067 Bacteria 2331
452 Ga0207678_10172888 3300026067 Bacteria 1844
453 Ga0207678_10599802 3300026067 Bacteria 965
454 Ga0207708_10011960 3300026075 Bacteria 6465
455 Ga0207702_10010434 3300026078 Bacteria 7771
456 Ga0207702_10016629 3300026078 Bacteria 6087
457 Ga0207702_10203534 3300026078 Bacteria 1836
458 Ga0207702_10225287 3300026078 Bacteria 1749
459 Ga0207702_10225422 3300026078 Bacteria 1749
460 Ga0207702_10253264 3300026078 Bacteria 1654
461 Ga0207702_10269471 3300026078 Bacteria 1605
462 Ga0207641_10119950 3300026088 Bacteria 2345
463 Ga0207641_10218621 3300026088 Bacteria 1765
464 Ga0207648_10002497 3300026089 Bacteria 19743
465 Ga0207648_10004228 3300026089 Bacteria 14837
466 Ga0207648_10012406 3300026089 Bacteria 7978
467 Ga0207648_10020098 3300026089 Bacteria 6022
468 Ga0207648_10022240 3300026089 Bacteria 5697
469 Ga0207648_10127594 3300026089 Bacteria 2238
470 Ga0207648_10389729 3300026089 Bacteria 1261
471 Ga0207648_10426923 3300026089 Bacteria 1204
472 Ga0207676_10000548 3300026095 Bacteria 31359
473 Ga0207676_10075779 3300026095 Bacteria 2715
474 Ga0207676_10455771 3300026095 Bacteria 1206
475 Ga0207674_10000045 3300026116 Bacteria 122251
476 Ga0207674_10436833 3300026116 Bacteria 1265
477 Ga0207675_100017006 3300026118 Bacteria 6796
478 Ga0207675_100022734 3300026118 Bacteria 5834
479 Ga0207675_100105148 3300026118 Bacteria 2661
480 Ga0207683_10000009 3300026121 Bacteria 150281
481 Ga0207683_10000182 3300026121 Bacteria 54134
482 Ga0207683_10035293 3300026121 Bacteria 4348
483 Ga0207698_10001283 3300026142 Bacteria 14640
484 Ga0207698_10029233 3300026142 Bacteria 3943
485 Ga0207698_10316101 3300026142 Bacteria 1460
486 Ga0207698_10434707 3300026142 Bacteria 1263
487 Ga0209984_1011506 3300027424 Bacteria 1146
488 Ga0209974_10004711 3300027876 Bacteria 4846
489 Ga0207428_10017142 3300027907 Bacteria 6224
490 Ga0207428_10460627 3300027907 Bacteria 926
491 Ga0268266_10000551 3300028379 Bacteria 52218
492 Ga0268266_10032142 3300028379 Bacteria 4458
493 Ga0268265_10002908 3300028380 Bacteria 12578
494 Ga0268265_10151184 3300028380 Bacteria 1958
495 Ga0268265_10381476 3300028380 Bacteria 1297
496 Ga0268264_10039584 3300028381 Bacteria 3895
497 Ga0268264_10432779 3300028381 Bacteria 1271
498 Ga0268264_10858882 3300028381 Bacteria 909
499 Ga0265330_10069042 3300031235 Bacteria 1530
500 Ga0265325_10007961 3300031241 Bacteria 6294
501 Ga0265325_10072852 3300031241 Bacteria 1721
502 Ga0265340_10002715 3300031247 Bacteria 10073
503 Ga0265340_10033158 3300031247 Bacteria 2573
504 Ga0265340_10083189 3300031247 Bacteria 1504
505 Ga0265339_10007542 3300031249 Bacteria 7014
506 Ga0265331_10000250 3300031250 Bacteria 63883
507 Ga0265327_10000007 3300031251 Bacteria 678515
508 Ga0265327_10000280 3300031251 Bacteria 100757
509 Ga0265316_10055609 3300031344 Bacteria 3094
510 Ga0307513_10001002 3300031456 Bacteria 40842
511 Ga0307513_10361575 3300031456 Bacteria 1196
512 Ga0307513_10377296 3300031456 Bacteria 1158
513 Ga0307408_100029509 3300031548 Bacteria 3801
514 Ga0307408_100287883 3300031548 Bacteria 1371
515 Ga0265313_10008203 3300031595 Bacteria 6978
516 Ga0265313_10020281 3300031595 Bacteria 3671
517 Ga0265314_10154468 3300031711 Bacteria 1403
518 Ga0265342_10062731 3300031712 Bacteria 2186
519 Ga0307405_10002589 3300031731 Bacteria 8020
520 Ga0307413_10028792 3300031824 Bacteria 3100
521 Ga0307413_10097044 3300031824 Bacteria 1937
522 Ga0307410_10017443 3300031852 Bacteria 4312
523 Ga0307406_10049422 3300031901 Bacteria 2661
524 Ga0307407_10100077 3300031903 Bacteria 1797
525 Ga0307412_10050730 3300031911 Bacteria 2740
526 Ga0307409_100195811 3300031995 Bacteria 1803
527 Ga0307409_100256209 3300031995 Bacteria 1603
528 Ga0307416_100069094 3300032002 Bacteria 2922
529 Ga0307416_100085395 3300032002 Bacteria 2686
530 Ga0307411_10003144 3300032005 Bacteria 7573
531 Ga0307411_10043493 3300032005 Bacteria 2874
532 Ga0307411_10089629 3300032005 Bacteria 2143
533 Ga0307510_10019906 3300033180 Bacteria 7860
534 Ga0373930_0013043 3300034816 Bacteria 1526
535 Ga0373958_0003476 3300034819 Bacteria 2274
536 Ga0373923_0167773 3300035111 Bacteria 1004
537 Ga0373936_0003352 3300035113 Bacteria 6002
538 Ga0373931_0135708 3300035691 Bacteria 1420
539 Ga0373937_0142189 3300036401 Bacteria 2245
540 Ga0373937_0196697 3300036401 Bacteria 1895
541 Ga0395900_0029076 3300037418 Bacteria 5669
542 Ga0395900_0225305 3300037418 Bacteria 1888
543 Ga0395898_0200182 3300037466 Bacteria 1907
544 Ga0395905_0014988 3300037471 Bacteria 7393
545 Ga0395905_0025761 3300037471 Bacteria 5545
546 Ga0436364_0098673 3300037853 Bacteria 6312
547 Ga0395901_0016643 3300038443 Bacteria 7491
548 Ga0395901_0171472 3300038443 Bacteria 2277
549 Ga0395901_0258871 3300038443 Bacteria 1811
550 Ga0400483_041511 3300039062 Bacteria 11733
551 Ga0400483_068901 3300039062 Bacteria 1132
552 Ga0400483_206794 3300039062 Bacteria 8594
553 Ga0436365_0503502 3300039437 Bacteria 2683
554 Ga0436365_0874983 3300039437 Bacteria 53988
555 Ga0436360_0404552 3300039438 Bacteria 2610
556 Ga0436360_0605189 3300039438 Bacteria 1492
557 Ga0436360_0614325 3300039438 Bacteria 2486
558 Ga0436360_1178753 3300039438 Bacteria 8244
559 Ga0436361_0025705 3300039447 Bacteria 809
560 Ga0436361_0469822 3300039447 Bacteria 6391
561 Ga0436361_0672930 3300039447 Bacteria 1141
562 Ga0436361_0788745 3300039447 Bacteria 34906
563 Ga0436361_0794633 3300039447 Bacteria 1356
564 Ga0436361_0885505 3300039447 Bacteria 4065
565 Ga0436361_1082188 3300039447 Bacteria 1795
566 Ga0436363_0854040 3300039450 Bacteria 16936
567 Ga0436362_0009912 3300039453 Bacteria 1529
568 Ga0436362_1093207 3300039453 Bacteria 1383
569 Ga0436362_1161051 3300039453 Bacteria 1132
570 Ga0451837_0626772 3300041494 Bacteria 2044
571 Ga0451849_1443180 3300041505 Bacteria 4173
572 Ga0451843_1776483 3300041509 Bacteria 2786
573 Ga0439450_009520 3300042008 Bacteria 1847
574 Ga0466969_0000722 3300044656 Bacteria 17863
575 Ga0466969_0114506 3300044656 Bacteria 1260
576 Ga0466966_0005576 3300044684 Bacteria 8276
577 Ga0466961_0001425 3300044693 Bacteria 14831
578 Ga0466964_0072768 3300044706 Bacteria 1457
579 Ga0466971_0009671 3300044719 Bacteria 4207
580 Ga0466957_0029156 3300044842 Bacteria 3289
581 Ga0466959_0000040 3300045049 Bacteria 101109
582 Ga0451576_0233789 3300045051 Bacteria 1920
583 Ga0466958_0026837 3300045836 Bacteria 3404
584 Ga0466967_0115997 3300045976 Bacteria 2467
585 Ga0495653_0020962 3300046463 Bacteria 5296
586 Ga0495580_0007478 3300046472 Bacteria 8778
587 Ga0495582_0025557 3300046473 Bacteria 3235
588 Ga0495628_0004869 3300046516 Bacteria 11820
589 Ga0495643_0014143 3300046522 Bacteria 4755
590 Ga0495648_0030142 3300046524 Bacteria 3592
591 Ga0495640_0148576 3300046533 Bacteria 1507
592 Ga0495622_0000126 3300046557 Bacteria 66247
593 Ga0495633_0094747 3300046558 Bacteria 1387
594 Ga0495656_0019662 3300046615 Bacteria 2609
595 Ga0495668_0153531 3300046616 Bacteria 1261
596 Ga0495634_0142013 3300046642 Bacteria 1524
597 Ga0495659_0019428 3300046664 Bacteria 2274
598 Ga0495646_0058453 3300046680 Bacteria 2305
599 Ga0495658_0112940 3300046683 Bacteria 1635
600 Ga0495624_0003707 3300046690 Bacteria 11296
601 Ga0495624_0059831 3300046690 Bacteria 2389
602 Ga0495660_0012577 3300046810 Bacteria 4913
603 Ga0495672_0024117 3300047320 Bacteria 3926
604 Ga0495676_0027671 3300047321 Bacteria 4858
605 Ga0495680_0182815 3300047322 Bacteria 1512
606 Ga0495686_0003731 3300047472 Bacteria 12996
607 Ga0495593_0010943 3300047673 Bacteria 5224
608 Ga0495602_0010213 3300048088 Bacteria 9745
609 Ga0495615_0064971 3300048090 Bacteria 972
610 Ga0495626_0029736 3300048091 Bacteria 2641
611 Ga0496101_0047366 3300048904 Bacteria 3086
612 Ga0496102_0207031 3300048905 Bacteria 1849
613 Ga0496104_0033852 3300048907 Bacteria 4762
614 Ga0496105_0250086 3300048908 Bacteria 1436
615 Ga0496106_0005904 3300048909 Bacteria 9050
616 Ga0496106_0334733 3300048909 Bacteria 1215
617 Ga0496108_0240464 3300048911 Bacteria 1575
618 Ga0496109_0089142 3300048912 Bacteria 2851
619 Ga0496109_0666179 3300048912 Bacteria 978
620 Ga0496110_0055644 3300048913 Bacteria 3481
621 Ga0496110_0274091 3300048913 Bacteria 1536
622 Ga0496110_0292116 3300048913 Bacteria 1485
623 Ga0496112_0305970 3300048915 Bacteria 1535
624 Ga0496114_0036117 3300048917 Bacteria 4085
625 Ga0496114_0066918 3300048917 Bacteria 3013
626 Ga0496114_0369051 3300048917 Bacteria 1270
627 Ga0496115_0163647 3300048918 Bacteria 1839
628 Ga0496117_0000427 3300048920 Bacteria 70530
629 Ga0496121_0072024 3300048924 Bacteria 2776
630 Ga0496124_0000046 3300048927 Bacteria 287043
631 Ga0496125_0000545 3300048928 Bacteria 64939
632 Ga0496126_0394898 3300048929 Bacteria 1123
633 Ga0501031_0271311 3300049568 Bacteria 1101
634 Ga0501033_0008244 3300049570 Bacteria 8066
635 Ga0501033_0012171 3300049570 Bacteria 6568
636 Ga0501034_0003497 3300049571 Bacteria 17835
637 Ga0501034_0034901 3300049571 Bacteria 5100
638 Ga0501034_0073475 3300049571 Bacteria 3428
639 Ga0501034_0083970 3300049571 Bacteria 3187
640 Ga0501034_0258542 3300049571 Bacteria 1684
641 Ga0501036_0000257 3300049572 Bacteria 36095
642 Ga0501037_0002777 3300049573 Bacteria 12676
643 Ga0501037_0041628 3300049573 Bacteria 3378
644 Ga0501037_0218121 3300049573 Bacteria 1343
645 Ga0501038_0015573 3300049574 Bacteria 6912
646 Ga0501038_0137858 3300049574 Bacteria 1998
647 Ga0501038_0448708 3300049574 Bacteria 992
648 Ga0501043_0001370 3300049579 Bacteria 21370
649 Ga0501043_0085430 3300049579 Bacteria 2480
650 Ga0501046_0001784 3300049580 Bacteria 20535
651 Ga0501047_0006873 3300049581 Bacteria 10691
652 Ga0501047_0063051 3300049581 Bacteria 3575
653 Ga0501047_0184266 3300049581 Bacteria 1953
654 Ga0501047_0399209 3300049581 Bacteria 1208
655 Ga0501048_0169128 3300049582 Bacteria 1548
656 Ga0501069_0005141 3300049585 Bacteria 6793
657 Ga0501070_0003776 3300049586 Bacteria 13081
658 Ga0501071_0305798 3300049587 Bacteria 1206
659 Ga0501073_0015471 3300049589 Bacteria 5535
660 Ga0501073_0479362 3300049589 Bacteria 860
661 Ga0501074_0022336 3300049590 Bacteria 4596
662 Ga0501074_0094537 3300049590 Bacteria 2140
663 Ga0501076_0510148 3300049592 Bacteria 991
664 Ga0501079_0029442 3300049741 Bacteria 4216
665 Ga0501080_0006486 3300049742 Bacteria 10508
666 Ga0501080_0084524 3300049742 Bacteria 2949
667 Ga0501080_0296413 3300049742 Bacteria 1467
668 Ga0501083_0022836 3300049744 Bacteria 4340
669 Ga0501083_0039192 3300049744 Bacteria 3218
670 Ga0501083_0061714 3300049744 Bacteria 2502
671 Ga0501083_0221679 3300049744 Bacteria 1232
672 Ga0501035_0003798 3300049822 Bacteria 14391
673 Ga0501035_0222071 3300049822 Bacteria 1613
674 Ga0501044_0003872 3300049823 Bacteria 16771
675 Ga0501044_0006073 3300049823 Bacteria 13326
676 Ga0501044_0018509 3300049823 Bacteria 7462
677 Ga0501044_0183067 3300049823 Bacteria 2061
678 Ga0501044_0249859 3300049823 Bacteria 1715
679 Ga0501044_0752675 3300049823 Bacteria 856
680 Ga0501045_0211595 3300049824 Bacteria 1444
681 nmdc:mga03683_4675_c1 3300050489 Bacteria 4564
682 nmdc:mga00v17_27_c2 3300050491 Bacteria 60228
683 nmdc:mga00v17_34091_c1 3300050491 Bacteria 3021
684 nmdc:mga0k408_60154_c2 3300050493 Bacteria 1379
685 nmdc:mga05p37_223159_c1 3300050507 Bacteria 2273
686 nmdc:mga09592_119231_c1 3300050508 Bacteria 2265
687 nmdc:mga08y16_223668_c1 3300050511 Bacteria 1948
688 nmdc:mga08y16_6264_c1 3300050511 Bacteria 12472
689 nmdc:mga08y16_833632_c1 3300050511 Bacteria 913
690 nmdc:mga0n895_201090_c1 3300050512 Bacteria 2023
691 nmdc:mga0n895_489921_c1 3300050512 Bacteria 1239
692 nmdc:mga0rr50_57969_c1 3300050513 Bacteria 2900
693 nmdc:mga08x19_12019_c1 3300050514 Bacteria 5210
694 nmdc:mga08x19_194951_c1 3300050514 Bacteria 1387
695 Ga0500643_000374 3300053087 Bacteria 34998
696 Ga0500643_020753 3300053087 Bacteria 2140
697 Ga0500646_0062098 3300053090 Bacteria 1102
698 Ga0500554_003869 3300053102 Bacteria 3109
699 Ga0500559_0003582 3300053136 Bacteria 7596
700 Ga0500568_0000668 3300053139 Bacteria 24820
701 Ga0500616_0007439 3300053153 Bacteria 6956
702 Ga0500616_0026014 3300053153 Bacteria 3244
703 Ga0500622_0033224 3300053156 Bacteria 2704
704 Ga0500624_022600 3300053157 Bacteria 1024
705 Ga0500627_0179372 3300053158 Bacteria 953
706 Ga0500645_001741 3300053730 Bacteria 10557
707 Ga0500645_001866 3300053730 Bacteria 10084
708 Ga0501084_0075279 3300054114 Bacteria 2828
709 Ga0501084_0265183 3300054114 Bacteria 1450
710 Ga0501084_0351336 3300054114 Bacteria 1245
711 Ga0501082_0062503 3300060353 Bacteria 3205
712 Ga0466962_0000450 3300061719 Bacteria 17837
713 Ga0530510_0191115 3300061734 Bacteria 1520

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049744 Ga0501083_0221679 Ga0501083_0221679_492_1220 242
2 3300005347 Ga0070668_100021611 Ga0070668_1000216114 243
3 3300005353 Ga0070669_100135950 Ga0070669_1001359502 243
4 3300005364 Ga0070673_100171359 Ga0070673_1001713593 243
5 3300005457 Ga0070662_100121970 Ga0070662_1001219702 243
6 3300005616 Ga0068852_100510253 Ga0068852_1005102532 243
7 3300006358 Ga0068871_100075325 Ga0068871_1000753254 243
8 3300025923 Ga0207681_10104032 Ga0207681_101040323 243
9 3300010375 Ga0105239_10037066 Ga0105239_100370663 244
10 3300054114 Ga0501084_0075279 Ga0501084_0075279_249_983 244
11 iso_pu_bacteria 2534681786 2535485421 244
12 iso_pu_bacteria 2751185800 2753360354 244
13 iso_pu_bacteria 2758568016 2758640380 244
14 iso_pu_bacteria 2758568016 2758642790 244
15 iso_pu_bacteria 2854911287 2854911670 244
16 iso_pu_bacteria 2854911287 2854913567 244
17 iso_pu_bacteria 2537561587 2537876257 245
18 iso_pu_bacteria 2595698237 2596374431 245
19 iso_pu_bacteria 2738541281 2738743189 245
20 iso_pu_bacteria 2738543032 2739352806 245
21 iso_pu_bacteria 2739367655 2739612421 245
22 iso_pu_bacteria 2791355137 2792835520 245
23 iso_pu_bacteria 2842698319 2842700470 245
24 iso_pu_bacteria 2842711865 2842715345 245
25 iso_pu_bacteria 2855730933 2855736496 245
26 iso_pu_bacteria 2855767633 2855773433 245
27 iso_pu_bacteria 2857542790 2857546698 245
28 iso_pu_bacteria 2881412998 2881418611 245
29 iso_pu_bacteria 2915650412 2915650445 245
30 iso_pu_bacteria 2924754689 2924754960 245
31 iso_pu_bacteria 8002392321 8002394802 245
32 3300009093 Ga0105240_10005452 Ga0105240_100054524 247
33 3300009545 Ga0105237_10423989 Ga0105237_104239892 247
34 3300013104 Ga0157370_10047695 Ga0157370_100476953 247
35 3300013105 Ga0157369_10419440 Ga0157369_104194402 247
36 3300013307 Ga0157372_10106261 Ga0157372_101062613 247
37 3300025913 Ga0207695_10094842 Ga0207695_100948423 247
38 3300025929 Ga0207664_10095049 Ga0207664_100950492 247
39 3300025949 Ga0207667_10173798 Ga0207667_101737983 247
40 3300050514 nmdc:mga08x19_194951_c1 nmdc:mga08x19_194951_c1_39_782 247
41 3300005327 Ga0070658_10007411 Ga0070658_100074115 248
42 3300005335 Ga0070666_10007495 Ga0070666_100074955 248
43 3300005336 Ga0070680_100073271 Ga0070680_1000732713 248
44 3300005339 Ga0070660_100012151 Ga0070660_1000121515 248
45 3300005339 Ga0070660_100063163 Ga0070660_1000631633 248
46 3300005367 Ga0070667_100322824 Ga0070667_1003228241 248
47 3300005440 Ga0070705_100107555 Ga0070705_1001075552 248
48 3300005458 Ga0070681_10113222 Ga0070681_101132223 248
49 3300005530 Ga0070679_100005852 Ga0070679_10000585214 248
50 3300005539 Ga0068853_100349604 Ga0068853_1003496041 248
51 3300005548 Ga0070665_100001485 Ga0070665_10000148526 248
52 3300005548 Ga0070665_100016813 Ga0070665_1000168137 248
53 3300005548 Ga0070665_100453913 Ga0070665_1004539131 248
54 3300005563 Ga0068855_100202606 Ga0068855_1002026063 248
55 3300005614 Ga0068856_100130033 Ga0068856_1001300332 248
56 3300005616 Ga0068852_100172530 Ga0068852_1001725302 248
57 3300005842 Ga0068858_100150752 Ga0068858_1001507522 248
58 3300006051 Ga0075364_10209920 Ga0075364_102099201 248
59 3300006177 Ga0075362_10043316 Ga0075362_100433161 248
60 3300006914 Ga0075436_100018225 Ga0075436_1000182253 248
61 3300009093 Ga0105240_10696894 Ga0105240_106968941 248
62 3300009174 Ga0105241_10286296 Ga0105241_102862962 248
63 3300009545 Ga0105237_10299783 Ga0105237_102997832 248
64 3300009551 Ga0105238_10070887 Ga0105238_100708874 248
65 3300009551 Ga0105238_10085095 Ga0105238_100850952 248
66 3300013104 Ga0157370_10066646 Ga0157370_100666463 248
67 3300013105 Ga0157369_10068397 Ga0157369_100683973 248
68 3300013307 Ga0157372_10028729 Ga0157372_100287293 248
69 3300020077 Ga0206351_10961181 Ga0206351_109611811 248
70 3300025909 Ga0207705_10028966 Ga0207705_100289664 248
71 3300025909 Ga0207705_10029460 Ga0207705_100294607 248
72 3300025913 Ga0207695_10201036 Ga0207695_102010362 248
73 3300025917 Ga0207660_10090744 Ga0207660_100907443 248
74 3300025919 Ga0207657_10022610 Ga0207657_100226107 248
75 3300025919 Ga0207657_10269930 Ga0207657_102699302 248
76 3300025921 Ga0207652_10008722 Ga0207652_100087222 248
77 3300025921 Ga0207652_10059551 Ga0207652_100595513 248
78 3300025924 Ga0207694_10240098 Ga0207694_102400982 248
79 3300025927 Ga0207687_10168112 Ga0207687_101681122 248
80 3300025941 Ga0207711_10142215 Ga0207711_101422153 248
81 3300026116 Ga0207674_10436833 Ga0207674_104368332 248
82 3300026142 Ga0207698_10316101 Ga0207698_103161011 248
83 3300028379 Ga0268266_10000551 Ga0268266_100005518 248
84 3300028379 Ga0268266_10032142 Ga0268266_100321425 248
85 3300031235 Ga0265330_10069042 Ga0265330_100690422 248
86 3300031241 Ga0265325_10007961 Ga0265325_100079616 248
87 3300031247 Ga0265340_10002715 Ga0265340_100027154 248
88 3300031247 Ga0265340_10083189 Ga0265340_100831892 248
89 3300031249 Ga0265339_10007542 Ga0265339_100075425 248
90 3300031344 Ga0265316_10055609 Ga0265316_100556094 248
91 3300031456 Ga0307513_10361575 Ga0307513_103615751 248
92 3300031595 Ga0265313_10008203 Ga0265313_100082032 248
93 3300031595 Ga0265313_10020281 Ga0265313_100202812 248
94 3300031712 Ga0265342_10062731 Ga0265342_100627313 248
95 3300032005 Ga0307411_10043493 Ga0307411_100434932 248
96 3300037471 Ga0395905_0025761 Ga0395905_0025761_2793_3539 248
97 3300044656 Ga0466969_0000722 Ga0466969_0000722_14594_15340 248
98 3300044684 Ga0466966_0005576 Ga0466966_0005576_5840_6586 248
99 3300044693 Ga0466961_0001425 Ga0466961_0001425_13839_14585 248
100 3300044719 Ga0466971_0009671 Ga0466971_0009671_560_1306 248
101 3300044842 Ga0466957_0029156 Ga0466957_0029156_1362_2108 248
102 3300045049 Ga0466959_0000040 Ga0466959_0000040_74250_74996 248
103 3300045836 Ga0466958_0026837 Ga0466958_0026837_561_1307 248
104 3300045976 Ga0466967_0115997 Ga0466967_0115997_831_1577 248
105 3300046616 Ga0495668_0153531 Ga0495668_0153531_438_1184 248
106 3300046810 Ga0495660_0012577 Ga0495660_0012577_357_1103 248
107 3300047472 Ga0495686_0003731 Ga0495686_0003731_1040_1786 248
108 3300049571 Ga0501034_0083970 Ga0501034_0083970_2176_2922 248
109 3300049573 Ga0501037_0218121 Ga0501037_0218121_501_1247 248
110 3300049592 Ga0501076_0510148 Ga0501076_0510148_113_859 248
111 3300049824 Ga0501045_0211595 Ga0501045_0211595_513_1259 248
112 3300050489 nmdc:mga03683_4675_c1 nmdc:mga03683_4675_c1_1323_2069 248
113 3300050491 nmdc:mga00v17_27_c2 nmdc:mga00v17_27_c2_600_1346 248
114 3300050491 nmdc:mga00v17_34091_c1 nmdc:mga00v17_34091_c1_1632_2378 248
115 3300050512 nmdc:mga0n895_201090_c1 nmdc:mga0n895_201090_c1_853_1602 248
116 3300050514 nmdc:mga08x19_12019_c1 nmdc:mga08x19_12019_c1_2826_3575 248
117 3300053087 Ga0500643_000374 Ga0500643_000374_14769_15515 248
118 3300053087 Ga0500643_020753 Ga0500643_020753_474_1220 248
119 3300053102 Ga0500554_003869 Ga0500554_003869_699_1445 248
120 3300053139 Ga0500568_0000668 Ga0500568_0000668_6398_7204 248
121 3300053153 Ga0500616_0026014 Ga0500616_0026014_347_1093 248
122 3300053158 Ga0500627_0179372 Ga0500627_0179372_65_811 248
123 3300053730 Ga0500645_001741 Ga0500645_001741_733_1479 248
124 3300053730 Ga0500645_001866 Ga0500645_001866_6442_7188 248
125 3300061719 Ga0466962_0000450 Ga0466962_0000450_2365_3111 248
126 3300061734 Ga0530510_0191115 Ga0530510_0191115_130_876 248
127 3300005333 Ga0070677_10020974 Ga0070677_100209743 249
128 3300005339 Ga0070660_100166387 Ga0070660_1001663872 249
129 3300005340 Ga0070689_100068704 Ga0070689_1000687041 249
130 3300005340 Ga0070689_100084918 Ga0070689_1000849183 249
131 3300005347 Ga0070668_100030266 Ga0070668_1000302662 249
132 3300005353 Ga0070669_100011290 Ga0070669_1000112902 249
133 3300005354 Ga0070675_100189929 Ga0070675_1001899292 249
134 3300005356 Ga0070674_100138643 Ga0070674_1001386432 249
135 3300005367 Ga0070667_100126024 Ga0070667_1001260242 249
136 3300005435 Ga0070714_100143716 Ga0070714_1001437162 249
137 3300005441 Ga0070700_100000389 Ga0070700_10000038917 249
138 3300005444 Ga0070694_100123770 Ga0070694_1001237702 249
139 3300005445 Ga0070708_100052118 Ga0070708_1000521183 249
140 3300005456 Ga0070678_100091988 Ga0070678_1000919883 249
141 3300005459 Ga0068867_100024393 Ga0068867_1000243934 249
142 3300005459 Ga0068867_100096522 Ga0068867_1000965222 249
143 3300005459 Ga0068867_100374839 Ga0068867_1003748392 249
144 3300005467 Ga0070706_100144128 Ga0070706_1001441282 249
145 3300005467 Ga0070706_100167220 Ga0070706_1001672202 249
146 3300005467 Ga0070706_100241043 Ga0070706_1002410431 249
147 3300005471 Ga0070698_100003313 Ga0070698_1000033136 249
148 3300005471 Ga0070698_100366248 Ga0070698_1003662482 249
149 3300005518 Ga0070699_100024597 Ga0070699_1000245973 249
150 3300005530 Ga0070679_100221193 Ga0070679_1002211932 249
151 3300005536 Ga0070697_100104285 Ga0070697_1001042852 249
152 3300005539 Ga0068853_100119321 Ga0068853_1001193213 249
153 3300005543 Ga0070672_100036976 Ga0070672_1000369765 249
154 3300005543 Ga0070672_100169363 Ga0070672_1001693632 249
155 3300005545 Ga0070695_100095318 Ga0070695_1000953183 249
156 3300005546 Ga0070696_100068958 Ga0070696_1000689582 249
157 3300005546 Ga0070696_100075437 Ga0070696_1000754373 249
158 3300005546 Ga0070696_100144725 Ga0070696_1001447252 249
159 3300005547 Ga0070693_100000664 Ga0070693_1000006646 249
160 3300005563 Ga0068855_100021038 Ga0068855_1000210383 249
161 3300005563 Ga0068855_100032340 Ga0068855_1000323402 249
162 3300005615 Ga0070702_100090588 Ga0070702_1000905882 249
163 3300005616 Ga0068852_100006808 Ga0068852_1000068086 249
164 3300005617 Ga0068859_100442671 Ga0068859_1004426711 249
165 3300005718 Ga0068866_10003537 Ga0068866_100035375 249
166 3300005719 Ga0068861_100000316 Ga0068861_1000003163 249
167 3300005834 Ga0068851_10017787 Ga0068851_100177872 249
168 3300005841 Ga0068863_100223289 Ga0068863_1002232892 249
169 3300005844 Ga0068862_100057288 Ga0068862_1000572883 249
170 3300005844 Ga0068862_100123419 Ga0068862_1001234193 249
171 3300006058 Ga0075432_10007467 Ga0075432_100074674 249
172 3300006195 Ga0075366_10063992 Ga0075366_100639922 249
173 3300006237 Ga0097621_100030201 Ga0097621_1000302013 249
174 3300006358 Ga0068871_100010900 Ga0068871_1000109002 249
175 3300006880 Ga0075429_100069086 Ga0075429_1000690863 249
176 3300006881 Ga0068865_100003157 Ga0068865_1000031573 249
177 3300006931 Ga0097620_100010242 Ga0097620_1000102423 249
178 3300006931 Ga0097620_100442683 Ga0097620_1004426832 249
179 3300009093 Ga0105240_10071585 Ga0105240_100715851 249
180 3300009093 Ga0105240_10121999 Ga0105240_101219991 249
181 3300009094 Ga0111539_10004114 Ga0111539_1000411412 249
182 3300009094 Ga0111539_10158467 Ga0111539_101584673 249
183 3300009094 Ga0111539_10207054 Ga0111539_102070543 249
184 3300009094 Ga0111539_11125707 Ga0111539_111257072 249
185 3300009094 Ga0111539_11176176 Ga0111539_111761761 249
186 3300009098 Ga0105245_10108460 Ga0105245_101084603 249
187 3300009148 Ga0105243_10038652 Ga0105243_100386523 249
188 3300009176 Ga0105242_10002660 Ga0105242_1000266010 249
189 3300009177 Ga0105248_10237679 Ga0105248_102376792 249
190 3300009545 Ga0105237_10261443 Ga0105237_102614432 249
191 3300009553 Ga0105249_10050559 Ga0105249_100505593 249
192 3300009553 Ga0105249_10714541 Ga0105249_107145412 249
193 3300010159 Ga0099796_10143091 Ga0099796_101430911 249
194 3300010375 Ga0105239_10674763 Ga0105239_106747632 249
195 3300013104 Ga0157370_10010719 Ga0157370_100107192 249
196 3300013104 Ga0157370_10349031 Ga0157370_103490312 249
197 3300013297 Ga0157378_10045990 Ga0157378_100459903 249
198 3300013297 Ga0157378_10198283 Ga0157378_101982832 249
199 3300013306 Ga0163162_10242048 Ga0163162_102420482 249
200 3300013308 Ga0157375_10672425 Ga0157375_106724252 249
201 3300014325 Ga0163163_11008069 Ga0163163_110080692 249
202 3300014745 Ga0157377_10006333 Ga0157377_100063336 249
203 3300014968 Ga0157379_10111123 Ga0157379_101111233 249
204 3300014969 Ga0157376_10198234 Ga0157376_101982342 249
205 3300017792 Ga0163161_10509870 Ga0163161_105098702 249
206 3300021361 Ga0213872_10000191 Ga0213872_1000019136 249
207 3300021361 Ga0213872_10134565 Ga0213872_101345651 249
208 3300021377 Ga0213874_10019065 Ga0213874_100190652 249
209 3300021384 Ga0213876_10010100 Ga0213876_100101003 249
210 3300021384 Ga0213876_10128763 Ga0213876_101287632 249
211 3300021441 Ga0213871_10005091 Ga0213871_100050912 249
212 3300021441 Ga0213871_10020431 Ga0213871_100204312 249
213 3300025294 Ga0209025_1000040 Ga0209025_1000040136 249
214 3300025315 Ga0207697_10199249 Ga0207697_101992491 249
215 3300025321 Ga0207656_10023192 Ga0207656_100231922 249
216 3300025906 Ga0207699_10025473 Ga0207699_100254732 249
217 3300025907 Ga0207645_10089973 Ga0207645_100899732 249
218 3300025910 Ga0207684_10111542 Ga0207684_101115422 249
219 3300025910 Ga0207684_10434069 Ga0207684_104340691 249
220 3300025912 Ga0207707_10033902 Ga0207707_100339024 249
221 3300025913 Ga0207695_10000806 Ga0207695_1000080660 249
222 3300025913 Ga0207695_10095321 Ga0207695_100953213 249
223 3300025913 Ga0207695_10584682 Ga0207695_105846821 249
224 3300025917 Ga0207660_10052150 Ga0207660_100521502 249
225 3300025919 Ga0207657_10167188 Ga0207657_101671882 249
226 3300025921 Ga0207652_10136635 Ga0207652_101366351 249
227 3300025923 Ga0207681_10013955 Ga0207681_100139555 249
228 3300025924 Ga0207694_10180375 Ga0207694_101803751 249
229 3300025926 Ga0207659_10035920 Ga0207659_100359203 249
230 3300025927 Ga0207687_10523119 Ga0207687_105231192 249
231 3300025929 Ga0207664_10119111 Ga0207664_101191112 249
232 3300025934 Ga0207686_10051120 Ga0207686_100511202 249
233 3300025934 Ga0207686_10445358 Ga0207686_104453582 249
234 3300025935 Ga0207709_10002633 Ga0207709_1000263310 249
235 3300025936 Ga0207670_10077452 Ga0207670_100774523 249
236 3300025938 Ga0207704_10022141 Ga0207704_100221413 249
237 3300025941 Ga0207711_10091298 Ga0207711_100912982 249
238 3300025949 Ga0207667_10024982 Ga0207667_100249825 249
239 3300025960 Ga0207651_10442950 Ga0207651_104429502 249
240 3300025961 Ga0207712_10027674 Ga0207712_100276743 249
241 3300025972 Ga0207668_10114188 Ga0207668_101141882 249
242 3300025981 Ga0207640_10329991 Ga0207640_103299912 249
243 3300026023 Ga0207677_10148576 Ga0207677_101485761 249
244 3300026035 Ga0207703_10162752 Ga0207703_101627521 249
245 3300026041 Ga0207639_10217459 Ga0207639_102174592 249
246 3300026075 Ga0207708_10011960 Ga0207708_100119603 249
247 3300026078 Ga0207702_10225422 Ga0207702_102254222 249
248 3300026089 Ga0207648_10004228 Ga0207648_100042283 249
249 3300026089 Ga0207648_10020098 Ga0207648_100200983 249
250 3300026089 Ga0207648_10022240 Ga0207648_100222403 249
251 3300026089 Ga0207648_10127594 Ga0207648_101275942 249
252 3300026089 Ga0207648_10426923 Ga0207648_104269232 249
253 3300026118 Ga0207675_100022734 Ga0207675_1000227344 249
254 3300026121 Ga0207683_10035293 Ga0207683_100352935 249
255 3300027907 Ga0207428_10017142 Ga0207428_100171424 249
256 3300027907 Ga0207428_10460627 Ga0207428_104606271 249
257 3300028380 Ga0268265_10002908 Ga0268265_100029083 249
258 3300028380 Ga0268265_10151184 Ga0268265_101511843 249
259 3300028380 Ga0268265_10381476 Ga0268265_103814761 249
260 3300028381 Ga0268264_10432779 Ga0268264_104327792 249
261 3300031241 Ga0265325_10072852 Ga0265325_100728522 249
262 3300031247 Ga0265340_10033158 Ga0265340_100331582 249
263 3300031250 Ga0265331_10000250 Ga0265331_1000025059 249
264 3300031251 Ga0265327_10000007 Ga0265327_10000007496 249
265 3300031251 Ga0265327_10000280 Ga0265327_1000028099 249
266 3300031456 Ga0307513_10001002 Ga0307513_1000100224 249
267 3300031456 Ga0307513_10377296 Ga0307513_103772962 249
268 3300031548 Ga0307408_100287883 Ga0307408_1002878832 249
269 3300031711 Ga0265314_10154468 Ga0265314_101544682 249
270 3300031824 Ga0307413_10097044 Ga0307413_100970442 249
271 3300032002 Ga0307416_100069094 Ga0307416_1000690943 249
272 3300033180 Ga0307510_10019906 Ga0307510_100199067 249
273 3300034816 Ga0373930_0013043 Ga0373930_0013043_530_1279 249
274 3300034819 Ga0373958_0003476 Ga0373958_0003476_1272_2021 249
275 3300035111 Ga0373923_0167773 Ga0373923_0167773_13_762 249
276 3300035113 Ga0373936_0003352 Ga0373936_0003352_1475_2224 249
277 3300035691 Ga0373931_0135708 Ga0373931_0135708_134_901 249
278 3300036401 Ga0373937_0142189 Ga0373937_0142189_1083_1832 249
279 3300037418 Ga0395900_0029076 Ga0395900_0029076_4500_5249 249
280 3300037418 Ga0395900_0225305 Ga0395900_0225305_84_833 249
281 3300037466 Ga0395898_0200182 Ga0395898_0200182_257_1006 249
282 3300037853 Ga0436364_0098673 Ga0436364_0098673_1127_1876 249
283 3300038443 Ga0395901_0016643 Ga0395901_0016643_1081_1836 249
284 3300038443 Ga0395901_0258871 Ga0395901_0258871_679_1428 249
285 3300039062 Ga0400483_041511 Ga0400483_041511_4055_4804 249
286 3300039062 Ga0400483_206794 Ga0400483_206794_4710_5459 249
287 3300039437 Ga0436365_0503502 Ga0436365_0503502_1385_2134 249
288 3300039437 Ga0436365_0874983 Ga0436365_0874983_20114_20863 249
289 3300039438 Ga0436360_0404552 Ga0436360_0404552_349_1098 249
290 3300039438 Ga0436360_0605189 Ga0436360_0605189_414_1163 249
291 3300039438 Ga0436360_0614325 Ga0436360_0614325_1073_1822 249
292 3300039438 Ga0436360_1178753 Ga0436360_1178753_3963_4712 249
293 3300039447 Ga0436361_0025705 Ga0436361_0025705_29_778 249
294 3300039447 Ga0436361_0469822 Ga0436361_0469822_1429_2178 249
295 3300039447 Ga0436361_0672930 Ga0436361_0672930_114_863 249
296 3300039447 Ga0436361_0788745 Ga0436361_0788745_32907_33656 249
297 3300039447 Ga0436361_0794633 Ga0436361_0794633_349_1098 249
298 3300039447 Ga0436361_0885505 Ga0436361_0885505_1178_1927 249
299 3300039447 Ga0436361_1082188 Ga0436361_1082188_670_1563 249
300 3300039450 Ga0436363_0854040 Ga0436363_0854040_11339_12088 249
301 3300039453 Ga0436362_0009912 Ga0436362_0009912_711_1460 249
302 3300039453 Ga0436362_1093207 Ga0436362_1093207_246_995 249
303 3300039453 Ga0436362_1161051 Ga0436362_1161051_286_1035 249
304 3300041494 Ga0451837_0626772 Ga0451837_0626772_859_1608 249
305 3300041505 Ga0451849_1443180 Ga0451849_1443180_2534_3283 249
306 3300041509 Ga0451843_1776483 Ga0451843_1776483_1064_1813 249
307 3300042008 Ga0439450_009520 Ga0439450_009520_609_1358 249
308 3300044656 Ga0466969_0114506 Ga0466969_0114506_407_1156 249
309 3300044706 Ga0466964_0072768 Ga0466964_0072768_289_1038 249
310 3300046463 Ga0495653_0020962 Ga0495653_0020962_2226_2975 249
311 3300046472 Ga0495580_0007478 Ga0495580_0007478_6344_7093 249
312 3300046473 Ga0495582_0025557 Ga0495582_0025557_1073_1822 249
313 3300046516 Ga0495628_0004869 Ga0495628_0004869_3032_3781 249
314 3300046522 Ga0495643_0014143 Ga0495643_0014143_2218_2967 249
315 3300046524 Ga0495648_0030142 Ga0495648_0030142_896_1645 249
316 3300046533 Ga0495640_0148576 Ga0495640_0148576_557_1306 249
317 3300046557 Ga0495622_0000126 Ga0495622_0000126_36226_36975 249
318 3300046558 Ga0495633_0094747 Ga0495633_0094747_318_1067 249
319 3300046615 Ga0495656_0019662 Ga0495656_0019662_1153_1902 249
320 3300046642 Ga0495634_0142013 Ga0495634_0142013_204_953 249
321 3300046664 Ga0495659_0019428 Ga0495659_0019428_1004_1753 249
322 3300046680 Ga0495646_0058453 Ga0495646_0058453_1520_2269 249
323 3300046683 Ga0495658_0112940 Ga0495658_0112940_44_793 249
324 3300046690 Ga0495624_0003707 Ga0495624_0003707_8294_9043 249
325 3300046690 Ga0495624_0059831 Ga0495624_0059831_967_1716 249
326 3300047320 Ga0495672_0024117 Ga0495672_0024117_177_926 249
327 3300047321 Ga0495676_0027671 Ga0495676_0027671_600_1349 249
328 3300047322 Ga0495680_0182815 Ga0495680_0182815_452_1201 249
329 3300047673 Ga0495593_0010943 Ga0495593_0010943_1070_1819 249
330 3300048088 Ga0495602_0010213 Ga0495602_0010213_2833_3582 249
331 3300048090 Ga0495615_0064971 Ga0495615_0064971_147_896 249
332 3300048091 Ga0495626_0029736 Ga0495626_0029736_967_1716 249
333 3300048904 Ga0496101_0047366 Ga0496101_0047366_1529_2278 249
334 3300048905 Ga0496102_0207031 Ga0496102_0207031_319_1068 249
335 3300048907 Ga0496104_0033852 Ga0496104_0033852_491_1240 249
336 3300048908 Ga0496105_0250086 Ga0496105_0250086_279_1028 249
337 3300048909 Ga0496106_0334733 Ga0496106_0334733_80_829 249
338 3300048911 Ga0496108_0240464 Ga0496108_0240464_363_1112 249
339 3300048912 Ga0496109_0089142 Ga0496109_0089142_1667_2416 249
340 3300048913 Ga0496110_0055644 Ga0496110_0055644_495_1244 249
341 3300048917 Ga0496114_0036117 Ga0496114_0036117_65_814 249
342 3300048917 Ga0496114_0066918 Ga0496114_0066918_548_1297 249
343 3300048918 Ga0496115_0163647 Ga0496115_0163647_811_1560 249
344 3300048920 Ga0496117_0000427 Ga0496117_0000427_48937_49686 249
345 3300048924 Ga0496121_0072024 Ga0496121_0072024_941_1690 249
346 3300048927 Ga0496124_0000046 Ga0496124_0000046_95835_96584 249
347 3300048928 Ga0496125_0000545 Ga0496125_0000545_27278_28027 249
348 3300048929 Ga0496126_0394898 Ga0496126_0394898_167_916 249
349 3300049568 Ga0501031_0271311 Ga0501031_0271311_135_884 249
350 3300049570 Ga0501033_0008244 Ga0501033_0008244_5016_5765 249
351 3300049570 Ga0501033_0012171 Ga0501033_0012171_3630_4379 249
352 3300049571 Ga0501034_0003497 Ga0501034_0003497_14143_14892 249
353 3300049571 Ga0501034_0034901 Ga0501034_0034901_292_1041 249
354 3300049571 Ga0501034_0073475 Ga0501034_0073475_2302_3051 249
355 3300049571 Ga0501034_0258542 Ga0501034_0258542_790_1539 249
356 3300049572 Ga0501036_0000257 Ga0501036_0000257_19782_20531 249
357 3300049573 Ga0501037_0002777 Ga0501037_0002777_3056_3805 249
358 3300049573 Ga0501037_0041628 Ga0501037_0041628_1505_2254 249
359 3300049574 Ga0501038_0015573 Ga0501038_0015573_1959_2708 249
360 3300049574 Ga0501038_0137858 Ga0501038_0137858_1002_1751 249
361 3300049574 Ga0501038_0448708 Ga0501038_0448708_117_866 249
362 3300049579 Ga0501043_0001370 Ga0501043_0001370_870_1619 249
363 3300049579 Ga0501043_0085430 Ga0501043_0085430_319_1068 249
364 3300049580 Ga0501046_0001784 Ga0501046_0001784_929_1678 249
365 3300049581 Ga0501047_0006873 Ga0501047_0006873_8945_9694 249
366 3300049581 Ga0501047_0063051 Ga0501047_0063051_1688_2437 249
367 3300049581 Ga0501047_0184266 Ga0501047_0184266_622_1371 249
368 3300049581 Ga0501047_0399209 Ga0501047_0399209_40_789 249
369 3300049582 Ga0501048_0169128 Ga0501048_0169128_782_1531 249
370 3300049589 Ga0501073_0479362 Ga0501073_0479362_65_814 249
371 3300049590 Ga0501074_0094537 Ga0501074_0094537_1345_2094 249
372 3300049742 Ga0501080_0006486 Ga0501080_0006486_8898_9647 249
373 3300049742 Ga0501080_0296413 Ga0501080_0296413_77_826 249
374 3300049744 Ga0501083_0061714 Ga0501083_0061714_1674_2423 249
375 3300049822 Ga0501035_0003798 Ga0501035_0003798_12773_13522 249
376 3300049822 Ga0501035_0222071 Ga0501035_0222071_851_1600 249
377 3300049823 Ga0501044_0003872 Ga0501044_0003872_15494_16243 249
378 3300049823 Ga0501044_0006073 Ga0501044_0006073_8349_9098 249
379 3300049823 Ga0501044_0018509 Ga0501044_0018509_3412_4161 249
380 3300049823 Ga0501044_0249859 Ga0501044_0249859_342_1091 249
381 3300049823 Ga0501044_0752675 Ga0501044_0752675_60_809 249
382 3300050493 nmdc:mga0k408_60154_c2 nmdc:mga0k408_60154_c2_555_1304 249
383 3300050508 nmdc:mga09592_119231_c1 nmdc:mga09592_119231_c1_593_1342 249
384 3300050511 nmdc:mga08y16_223668_c1 nmdc:mga08y16_223668_c1_179_928 249
385 3300050511 nmdc:mga08y16_6264_c1 nmdc:mga08y16_6264_c1_8699_9448 249
386 3300050511 nmdc:mga08y16_833632_c1 nmdc:mga08y16_833632_c1_96_845 249
387 3300050512 nmdc:mga0n895_489921_c1 nmdc:mga0n895_489921_c1_362_1111 249
388 3300053090 Ga0500646_0062098 Ga0500646_0062098_303_1070 249
389 3300053136 Ga0500559_0003582 Ga0500559_0003582_6017_6766 249
390 3300053153 Ga0500616_0007439 Ga0500616_0007439_5392_6144 249
391 3300053156 Ga0500622_0033224 Ga0500622_0033224_690_1439 249
392 3300053157 Ga0500624_022600 Ga0500624_022600_107_856 249
393 3300054114 Ga0501084_0265183 Ga0501084_0265183_210_959 249
394 3300001979 JGI24740J21852_10078825 JGI24740J21852_100788251 250
395 3300005328 Ga0070676_10010301 Ga0070676_100103014 250
396 3300005328 Ga0070676_10169957 Ga0070676_101699572 250
397 3300005328 Ga0070676_10239067 Ga0070676_102390672 250
398 3300005329 Ga0070683_100008427 Ga0070683_1000084279 250
399 3300005330 Ga0070690_100056989 Ga0070690_1000569893 250
400 3300005331 Ga0070670_100192158 Ga0070670_1001921582 250
401 3300005331 Ga0070670_100257209 Ga0070670_1002572092 250
402 3300005333 Ga0070677_10000303 Ga0070677_100003034 250
403 3300005334 Ga0068869_100066857 Ga0068869_1000668573 250
404 3300005335 Ga0070666_10010571 Ga0070666_100105714 250
405 3300005335 Ga0070666_10371291 Ga0070666_103712911 250
406 3300005338 Ga0068868_100000202 Ga0068868_10000020219 250
407 3300005338 Ga0068868_100426788 Ga0068868_1004267882 250
408 3300005338 Ga0068868_100551771 Ga0068868_1005517711 250
409 3300005339 Ga0070660_100004342 Ga0070660_1000043423 250
410 3300005339 Ga0070660_100054219 Ga0070660_1000542192 250
411 3300005340 Ga0070689_100517755 Ga0070689_1005177551 250
412 3300005344 Ga0070661_100002674 Ga0070661_10000267410 250
413 3300005344 Ga0070661_100005346 Ga0070661_1000053466 250
414 3300005344 Ga0070661_100053473 Ga0070661_1000534731 250
415 3300005344 Ga0070661_100189793 Ga0070661_1001897932 250
416 3300005344 Ga0070661_100234980 Ga0070661_1002349802 250
417 3300005345 Ga0070692_10012611 Ga0070692_100126113 250
418 3300005347 Ga0070668_100001226 Ga0070668_1000012268 250
419 3300005347 Ga0070668_100013228 Ga0070668_1000132286 250
420 3300005347 Ga0070668_100321385 Ga0070668_1003213851 250
421 3300005354 Ga0070675_100004894 Ga0070675_1000048946 250
422 3300005354 Ga0070675_100018428 Ga0070675_1000184284 250
423 3300005354 Ga0070675_100020120 Ga0070675_1000201202 250
424 3300005354 Ga0070675_100028350 Ga0070675_1000283502 250
425 3300005355 Ga0070671_100005030 Ga0070671_1000050308 250
426 3300005355 Ga0070671_100007991 Ga0070671_1000079917 250
427 3300005355 Ga0070671_100083526 Ga0070671_1000835263 250
428 3300005356 Ga0070674_100000310 Ga0070674_10000031012 250
429 3300005356 Ga0070674_100040277 Ga0070674_1000402772 250
430 3300005356 Ga0070674_100091895 Ga0070674_1000918952 250
431 3300005364 Ga0070673_100000377 Ga0070673_1000003771 250
432 3300005364 Ga0070673_100015977 Ga0070673_1000159774 250
433 3300005364 Ga0070673_100024384 Ga0070673_1000243843 250
434 3300005364 Ga0070673_100035279 Ga0070673_1000352792 250
435 3300005364 Ga0070673_100045407 Ga0070673_1000454073 250
436 3300005366 Ga0070659_100002822 Ga0070659_10000282210 250
437 3300005366 Ga0070659_100039163 Ga0070659_1000391633 250
438 3300005366 Ga0070659_100171595 Ga0070659_1001715952 250
439 3300005367 Ga0070667_100009129 Ga0070667_1000091294 250
440 3300005367 Ga0070667_100021029 Ga0070667_1000210294 250
441 3300005434 Ga0070709_10032614 Ga0070709_100326142 250
442 3300005434 Ga0070709_10503515 Ga0070709_105035152 250
443 3300005435 Ga0070714_100001888 Ga0070714_10000188810 250
444 3300005435 Ga0070714_100112229 Ga0070714_1001122291 250
445 3300005435 Ga0070714_100448063 Ga0070714_1004480632 250
446 3300005436 Ga0070713_100051580 Ga0070713_1000515802 250
447 3300005437 Ga0070710_10013243 Ga0070710_100132433 250
448 3300005455 Ga0070663_100000590 Ga0070663_1000005908 250
449 3300005455 Ga0070663_100141421 Ga0070663_1001414211 250
450 3300005455 Ga0070663_100163345 Ga0070663_1001633452 250
451 3300005455 Ga0070663_100498446 Ga0070663_1004984462 250
452 3300005456 Ga0070678_100002811 Ga0070678_1000028116 250
453 3300005457 Ga0070662_100055724 Ga0070662_1000557242 250
454 3300005458 Ga0070681_10012100 Ga0070681_100121007 250
455 3300005458 Ga0070681_10042339 Ga0070681_100423394 250
456 3300005459 Ga0068867_100004591 Ga0068867_1000045914 250
457 3300005459 Ga0068867_100017430 Ga0068867_1000174303 250
458 3300005459 Ga0068867_100030016 Ga0068867_1000300164 250
459 3300005459 Ga0068867_100383796 Ga0068867_1003837961 250
460 3300005466 Ga0070685_10014848 Ga0070685_100148483 250
461 3300005518 Ga0070699_100001885 Ga0070699_1000018858 250
462 3300005530 Ga0070679_100007564 Ga0070679_1000075643 250
463 3300005530 Ga0070679_100021550 Ga0070679_1000215503 250
464 3300005530 Ga0070679_100819547 Ga0070679_1008195471 250
465 3300005530 Ga0070679_100887894 Ga0070679_1008878941 250
466 3300005535 Ga0070684_100001171 Ga0070684_1000011715 250
467 3300005535 Ga0070684_100005136 Ga0070684_1000051362 250
468 3300005539 Ga0068853_100001630 Ga0068853_1000016303 250
469 3300005539 Ga0068853_100053634 Ga0068853_1000536343 250
470 3300005539 Ga0068853_100082326 Ga0068853_1000823262 250
471 3300005539 Ga0068853_100207744 Ga0068853_1002077441 250
472 3300005539 Ga0068853_100255155 Ga0068853_1002551552 250
473 3300005539 Ga0068853_100582658 Ga0068853_1005826581 250
474 3300005543 Ga0070672_100000154 Ga0070672_10000015430 250
475 3300005543 Ga0070672_100012524 Ga0070672_1000125242 250
476 3300005543 Ga0070672_100028014 Ga0070672_1000280144 250
477 3300005543 Ga0070672_100030677 Ga0070672_1000306774 250
478 3300005543 Ga0070672_100055143 Ga0070672_1000551434 250
479 3300005543 Ga0070672_100118285 Ga0070672_1001182852 250
480 3300005547 Ga0070693_100029155 Ga0070693_1000291551 250
481 3300005548 Ga0070665_100002599 Ga0070665_10000259913 250
482 3300005548 Ga0070665_100113299 Ga0070665_1001132993 250
483 3300005563 Ga0068855_100000453 Ga0068855_1000004532 250
484 3300005563 Ga0068855_100023304 Ga0068855_1000233043 250
485 3300005563 Ga0068855_100040480 Ga0068855_1000404802 250
486 3300005563 Ga0068855_100071949 Ga0068855_1000719493 250
487 3300005564 Ga0070664_100007881 Ga0070664_1000078818 250
488 3300005564 Ga0070664_100022623 Ga0070664_1000226234 250
489 3300005564 Ga0070664_100055758 Ga0070664_1000557582 250
490 3300005564 Ga0070664_100135705 Ga0070664_1001357052 250
491 3300005564 Ga0070664_100269620 Ga0070664_1002696201 250
492 3300005577 Ga0068857_100009699 Ga0068857_1000096992 250
493 3300005577 Ga0068857_100011559 Ga0068857_1000115592 250
494 3300005578 Ga0068854_100327529 Ga0068854_1003275292 250
495 3300005614 Ga0068856_100079751 Ga0068856_1000797511 250
496 3300005614 Ga0068856_100095318 Ga0068856_1000953183 250
497 3300005614 Ga0068856_100272361 Ga0068856_1002723611 250
498 3300005614 Ga0068856_100526687 Ga0068856_1005266871 250
499 3300005616 Ga0068852_100014848 Ga0068852_1000148484 250
500 3300005616 Ga0068852_100039716 Ga0068852_1000397163 250
501 3300005616 Ga0068852_100112109 Ga0068852_1001121093 250
502 3300005616 Ga0068852_100226062 Ga0068852_1002260622 250
503 3300005616 Ga0068852_100425308 Ga0068852_1004253082 250
504 3300005617 Ga0068859_100784661 Ga0068859_1007846611 250
505 3300005618 Ga0068864_100000871 Ga0068864_10000087114 250
506 3300005618 Ga0068864_100031930 Ga0068864_1000319303 250
507 3300005618 Ga0068864_100147230 Ga0068864_1001472301 250
508 3300005718 Ga0068866_10056517 Ga0068866_100565172 250
509 3300005718 Ga0068866_10131774 Ga0068866_101317742 250
510 3300005719 Ga0068861_100004991 Ga0068861_1000049917 250
511 3300005834 Ga0068851_10000162 Ga0068851_1000016218 250
512 3300005834 Ga0068851_10004370 Ga0068851_100043703 250
513 3300005840 Ga0068870_10039511 Ga0068870_100395111 250
514 3300005840 Ga0068870_10123732 Ga0068870_101237321 250
515 3300005840 Ga0068870_10306147 Ga0068870_103061472 250
516 3300005841 Ga0068863_100006936 Ga0068863_1000069369 250
517 3300005841 Ga0068863_100010991 Ga0068863_1000109917 250
518 3300005841 Ga0068863_100108141 Ga0068863_1001081412 250
519 3300005842 Ga0068858_100072757 Ga0068858_1000727572 250
520 3300005843 Ga0068860_100074217 Ga0068860_1000742172 250
521 3300005843 Ga0068860_100243430 Ga0068860_1002434302 250
522 3300006237 Ga0097621_100009127 Ga0097621_1000091272 250
523 3300006871 Ga0075434_100609147 Ga0075434_1006091472 250
524 3300006881 Ga0068865_100012280 Ga0068865_1000122801 250
525 3300006914 Ga0075436_100227664 Ga0075436_1002276643 250
526 3300006931 Ga0097620_100784535 Ga0097620_1007845352 250
527 3300009093 Ga0105240_10005556 Ga0105240_1000555618 250
528 3300009093 Ga0105240_10009189 Ga0105240_1000918910 250
529 3300009098 Ga0105245_10202208 Ga0105245_102022082 250
530 3300009174 Ga0105241_10001153 Ga0105241_1000115310 250
531 3300009177 Ga0105248_10015640 Ga0105248_100156403 250
532 3300009177 Ga0105248_10096242 Ga0105248_100962422 250
533 3300009545 Ga0105237_10006464 Ga0105237_1000646410 250
534 3300009551 Ga0105238_10002904 Ga0105238_1000290414 250
535 3300009551 Ga0105238_10014966 Ga0105238_100149663 250
536 3300010375 Ga0105239_10021891 Ga0105239_100218912 250
537 3300010375 Ga0105239_10449320 Ga0105239_104493202 250
538 3300013100 Ga0157373_10001625 Ga0157373_1000162510 250
539 3300013100 Ga0157373_10002315 Ga0157373_100023154 250
540 3300013100 Ga0157373_10131286 Ga0157373_101312862 250
541 3300013102 Ga0157371_10006118 Ga0157371_100061183 250
542 3300013102 Ga0157371_10198392 Ga0157371_101983922 250
543 3300013104 Ga0157370_10013088 Ga0157370_100130882 250
544 3300013104 Ga0157370_10039789 Ga0157370_100397892 250
545 3300013104 Ga0157370_10041188 Ga0157370_100411883 250
546 3300013104 Ga0157370_10092245 Ga0157370_100922451 250
547 3300013104 Ga0157370_10515518 Ga0157370_105155181 250
548 3300013105 Ga0157369_10018507 Ga0157369_100185072 250
549 3300013105 Ga0157369_10086410 Ga0157369_100864103 250
550 3300013296 Ga0157374_10002469 Ga0157374_1000246914 250
551 3300013296 Ga0157374_10024112 Ga0157374_100241123 250
552 3300013296 Ga0157374_10310029 Ga0157374_103100292 250
553 3300013296 Ga0157374_10494809 Ga0157374_104948092 250
554 3300013296 Ga0157374_10523599 Ga0157374_105235991 250
555 3300013297 Ga0157378_10254941 Ga0157378_102549411 250
556 3300013297 Ga0157378_10739708 Ga0157378_107397082 250
557 3300013297 Ga0157378_10751920 Ga0157378_107519201 250
558 3300013306 Ga0163162_10014407 Ga0163162_100144078 250
559 3300013306 Ga0163162_10133422 Ga0163162_101334223 250
560 3300013306 Ga0163162_10142267 Ga0163162_101422671 250
561 3300013307 Ga0157372_10008916 Ga0157372_100089165 250
562 3300013307 Ga0157372_10048489 Ga0157372_100484893 250
563 3300013307 Ga0157372_10175351 Ga0157372_101753513 250
564 3300013308 Ga0157375_10001062 Ga0157375_1000106220 250
565 3300013308 Ga0157375_10008634 Ga0157375_100086342 250
566 3300014497 Ga0182008_10088059 Ga0182008_100880591 250
567 3300014497 Ga0182008_10094444 Ga0182008_100944442 250
568 3300014969 Ga0157376_10032804 Ga0157376_100328043 250
569 3300017792 Ga0163161_10012661 Ga0163161_100126615 250
570 3300017792 Ga0163161_10189905 Ga0163161_101899052 250
571 3300025315 Ga0207697_10005684 Ga0207697_100056843 250
572 3300025321 Ga0207656_10000949 Ga0207656_100009493 250
573 3300025321 Ga0207656_10001351 Ga0207656_100013515 250
574 3300025321 Ga0207656_10115911 Ga0207656_101159111 250
575 3300025893 Ga0207682_10000069 Ga0207682_100000696 250
576 3300025893 Ga0207682_10044012 Ga0207682_100440121 250
577 3300025899 Ga0207642_10057581 Ga0207642_100575812 250
578 3300025901 Ga0207688_10059946 Ga0207688_100599463 250
579 3300025903 Ga0207680_10013991 Ga0207680_100139911 250
580 3300025903 Ga0207680_10168905 Ga0207680_101689052 250
581 3300025907 Ga0207645_10001232 Ga0207645_100012329 250
582 3300025907 Ga0207645_10002497 Ga0207645_100024979 250
583 3300025909 Ga0207705_10020554 Ga0207705_100205543 250
584 3300025909 Ga0207705_10645846 Ga0207705_106458461 250
585 3300025911 Ga0207654_10008354 Ga0207654_100083542 250
586 3300025912 Ga0207707_10006272 Ga0207707_100062723 250
587 3300025912 Ga0207707_10012306 Ga0207707_100123063 250
588 3300025912 Ga0207707_10110405 Ga0207707_101104051 250
589 3300025912 Ga0207707_10336073 Ga0207707_103360732 250
590 3300025913 Ga0207695_10001360 Ga0207695_1000136028 250
591 3300025913 Ga0207695_10006983 Ga0207695_100069833 250
592 3300025913 Ga0207695_10020583 Ga0207695_100205831 250
593 3300025913 Ga0207695_10099641 Ga0207695_100996413 250
594 3300025914 Ga0207671_10028983 Ga0207671_100289833 250
595 3300025915 Ga0207693_10108979 Ga0207693_101089791 250
596 3300025916 Ga0207663_10289578 Ga0207663_102895782 250
597 3300025917 Ga0207660_10003252 Ga0207660_100032527 250
598 3300025917 Ga0207660_10043284 Ga0207660_100432841 250
599 3300025917 Ga0207660_10594690 Ga0207660_105946901 250
600 3300025919 Ga0207657_10000524 Ga0207657_1000052416 250
601 3300025919 Ga0207657_10122371 Ga0207657_101223712 250
602 3300025920 Ga0207649_10002238 Ga0207649_100022383 250
603 3300025920 Ga0207649_10015519 Ga0207649_100155193 250
604 3300025920 Ga0207649_10225976 Ga0207649_102259761 250
605 3300025921 Ga0207652_10058808 Ga0207652_100588083 250
606 3300025924 Ga0207694_10001760 Ga0207694_100017602 250
607 3300025924 Ga0207694_10004511 Ga0207694_100045116 250
608 3300025924 Ga0207694_10146019 Ga0207694_101460192 250
609 3300025925 Ga0207650_10005184 Ga0207650_100051847 250
610 3300025925 Ga0207650_10008066 Ga0207650_100080665 250
611 3300025925 Ga0207650_10133200 Ga0207650_101332002 250
612 3300025925 Ga0207650_10593141 Ga0207650_105931411 250
613 3300025926 Ga0207659_10023091 Ga0207659_100230912 250
614 3300025927 Ga0207687_10517100 Ga0207687_105171001 250
615 3300025928 Ga0207700_10021182 Ga0207700_100211822 250
616 3300025929 Ga0207664_10003618 Ga0207664_1000361810 250
617 3300025929 Ga0207664_10231373 Ga0207664_102313731 250
618 3300025931 Ga0207644_10008388 Ga0207644_100083882 250
619 3300025931 Ga0207644_10169098 Ga0207644_101690982 250
620 3300025932 Ga0207690_10004332 Ga0207690_100043322 250
621 3300025932 Ga0207690_10135756 Ga0207690_101357561 250
622 3300025933 Ga0207706_10076464 Ga0207706_100764643 250
623 3300025935 Ga0207709_10102956 Ga0207709_101029563 250
624 3300025935 Ga0207709_10558088 Ga0207709_105580882 250
625 3300025936 Ga0207670_10519936 Ga0207670_105199362 250
626 3300025937 Ga0207669_10076299 Ga0207669_100762993 250
627 3300025938 Ga0207704_10115350 Ga0207704_101153501 250
628 3300025940 Ga0207691_10000343 Ga0207691_1000034337 250
629 3300025940 Ga0207691_10000826 Ga0207691_100008268 250
630 3300025940 Ga0207691_10001614 Ga0207691_1000161413 250
631 3300025940 Ga0207691_10007847 Ga0207691_100078473 250
632 3300025940 Ga0207691_10091643 Ga0207691_100916432 250
633 3300025940 Ga0207691_10211364 Ga0207691_102113642 250
634 3300025941 Ga0207711_10072118 Ga0207711_100721183 250
635 3300025941 Ga0207711_10446166 Ga0207711_104461661 250
636 3300025942 Ga0207689_10021920 Ga0207689_100219203 250
637 3300025945 Ga0207679_10002888 Ga0207679_100028881 250
638 3300025945 Ga0207679_10023404 Ga0207679_100234042 250
639 3300025945 Ga0207679_10054441 Ga0207679_100544412 250
640 3300025945 Ga0207679_10205861 Ga0207679_102058611 250
641 3300025945 Ga0207679_10206787 Ga0207679_102067872 250
642 3300025945 Ga0207679_10222219 Ga0207679_102222192 250
643 3300025945 Ga0207679_10264469 Ga0207679_102644691 250
644 3300025949 Ga0207667_10005070 Ga0207667_100050703 250
645 3300025949 Ga0207667_10005399 Ga0207667_100053999 250
646 3300025949 Ga0207667_10023396 Ga0207667_100233962 250
647 3300025949 Ga0207667_10035108 Ga0207667_100351081 250
648 3300025960 Ga0207651_10000672 Ga0207651_100006724 250
649 3300025960 Ga0207651_10022567 Ga0207651_100225673 250
650 3300025960 Ga0207651_10086815 Ga0207651_100868152 250
651 3300025960 Ga0207651_10095402 Ga0207651_100954022 250
652 3300025960 Ga0207651_10872936 Ga0207651_108729361 250
653 3300025972 Ga0207668_10038769 Ga0207668_100387692 250
654 3300025972 Ga0207668_10181768 Ga0207668_101817682 250
655 3300025981 Ga0207640_10009128 Ga0207640_100091283 250
656 3300025981 Ga0207640_10357053 Ga0207640_103570531 250
657 3300025986 Ga0207658_10001180 Ga0207658_1000118013 250
658 3300025986 Ga0207658_10093617 Ga0207658_100936172 250
659 3300026023 Ga0207677_10004841 Ga0207677_100048413 250
660 3300026023 Ga0207677_10120538 Ga0207677_101205383 250
661 3300026023 Ga0207677_10276451 Ga0207677_102764511 250
662 3300026023 Ga0207677_10572532 Ga0207677_105725321 250
663 3300026035 Ga0207703_10062768 Ga0207703_100627682 250
664 3300026041 Ga0207639_10042766 Ga0207639_100427663 250
665 3300026041 Ga0207639_10154037 Ga0207639_101540372 250
666 3300026041 Ga0207639_10273461 Ga0207639_102734612 250
667 3300026041 Ga0207639_10276853 Ga0207639_102768532 250
668 3300026067 Ga0207678_10000974 Ga0207678_100009748 250
669 3300026067 Ga0207678_10111746 Ga0207678_101117461 250
670 3300026067 Ga0207678_10172888 Ga0207678_101728882 250
671 3300026067 Ga0207678_10599802 Ga0207678_105998021 250
672 3300026078 Ga0207702_10010434 Ga0207702_100104341 250
673 3300026078 Ga0207702_10016629 Ga0207702_100166294 250
674 3300026078 Ga0207702_10203534 Ga0207702_102035342 250
675 3300026078 Ga0207702_10225287 Ga0207702_102252872 250
676 3300026078 Ga0207702_10253264 Ga0207702_102532642 250
677 3300026078 Ga0207702_10269471 Ga0207702_102694712 250
678 3300026088 Ga0207641_10119950 Ga0207641_101199502 250
679 3300026088 Ga0207641_10218621 Ga0207641_102186211 250
680 3300026089 Ga0207648_10002497 Ga0207648_100024976 250
681 3300026089 Ga0207648_10012406 Ga0207648_100124064 250
682 3300026089 Ga0207648_10389729 Ga0207648_103897292 250
683 3300026095 Ga0207676_10000548 Ga0207676_1000054829 250
684 3300026095 Ga0207676_10075779 Ga0207676_100757792 250
685 3300026095 Ga0207676_10455771 Ga0207676_104557711 250
686 3300026116 Ga0207674_10000045 Ga0207674_1000004577 250
687 3300026118 Ga0207675_100017006 Ga0207675_1000170064 250
688 3300026118 Ga0207675_100105148 Ga0207675_1001051484 250
689 3300026121 Ga0207683_10000009 Ga0207683_1000000965 250
690 3300026121 Ga0207683_10000182 Ga0207683_1000018243 250
691 3300026142 Ga0207698_10001283 Ga0207698_100012833 250
692 3300026142 Ga0207698_10029233 Ga0207698_100292334 250
693 3300026142 Ga0207698_10434707 Ga0207698_104347072 250
694 3300027424 Ga0209984_1011506 Ga0209984_10115062 250
695 3300027876 Ga0209974_10004711 Ga0209974_100047112 250
696 3300028381 Ga0268264_10039584 Ga0268264_100395844 250
697 3300028381 Ga0268264_10858882 Ga0268264_108588821 250
698 3300031548 Ga0307408_100029509 Ga0307408_1000295093 250
699 3300031731 Ga0307405_10002589 Ga0307405_100025891 250
700 3300031824 Ga0307413_10028792 Ga0307413_100287922 250
701 3300031852 Ga0307410_10017443 Ga0307410_100174433 250
702 3300031901 Ga0307406_10049422 Ga0307406_100494223 250
703 3300031903 Ga0307407_10100077 Ga0307407_101000772 250
704 3300031911 Ga0307412_10050730 Ga0307412_100507303 250
705 3300031995 Ga0307409_100195811 Ga0307409_1001958112 250
706 3300031995 Ga0307409_100256209 Ga0307409_1002562092 250
707 3300032002 Ga0307416_100085395 Ga0307416_1000853953 250
708 3300032005 Ga0307411_10003144 Ga0307411_100031441 250
709 3300032005 Ga0307411_10089629 Ga0307411_100896293 250
710 3300036401 Ga0373937_0196697 Ga0373937_0196697_425_1177 250
711 3300037471 Ga0395905_0014988 Ga0395905_0014988_1098_1850 250
712 3300038443 Ga0395901_0171472 Ga0395901_0171472_1509_2261 250
713 3300039062 Ga0400483_068901 Ga0400483_068901_226_978 250
714 3300045051 Ga0451576_0233789 Ga0451576_0233789_155_907 250
715 3300048909 Ga0496106_0005904 Ga0496106_0005904_435_1187 250
716 3300048912 Ga0496109_0666179 Ga0496109_0666179_31_783 250
717 3300048913 Ga0496110_0274091 Ga0496110_0274091_35_787 250
718 3300048913 Ga0496110_0292116 Ga0496110_0292116_89_841 250
719 3300048915 Ga0496112_0305970 Ga0496112_0305970_597_1349 250
720 3300048917 Ga0496114_0369051 Ga0496114_0369051_16_768 250
721 3300049585 Ga0501069_0005141 Ga0501069_0005141_5024_5776 250
722 3300049586 Ga0501070_0003776 Ga0501070_0003776_123_875 250
723 3300049587 Ga0501071_0305798 Ga0501071_0305798_123_875 250
724 3300049589 Ga0501073_0015471 Ga0501073_0015471_2175_2927 250
725 3300049590 Ga0501074_0022336 Ga0501074_0022336_292_1134 250
726 3300049741 Ga0501079_0029442 Ga0501079_0029442_1399_2151 250
727 3300049742 Ga0501080_0084524 Ga0501080_0084524_157_909 250
728 3300049744 Ga0501083_0022836 Ga0501083_0022836_3380_4222 250
729 3300049744 Ga0501083_0039192 Ga0501083_0039192_2148_2900 250
730 3300049823 Ga0501044_0183067 Ga0501044_0183067_945_1697 250
731 3300050507 nmdc:mga05p37_223159_c1 nmdc:mga05p37_223159_c1_736_1488 250
732 3300050513 nmdc:mga0rr50_57969_c1 nmdc:mga0rr50_57969_c1_1002_1796 250
733 3300054114 Ga0501084_0351336 Ga0501084_0351336_321_1163 250
734 3300060353 Ga0501082_0062503 Ga0501082_0062503_2309_3151 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01012

ETF

Electron transfer flavoprotein domain

25

209

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9621 1 223
1t9g-assembly1.cif.gz_S structure of the human mcad:etf complex 0.9375 1 223
2a1t-assembly1.cif.gz_S structure of the human mcad:etf e165betaa complex 0.9249 2 241
1o95-assembly1.cif.gz_E ternary complex between trimethylamine dehydrogenase and electron transferring flavoprotein 0.9191 1 222
2a1t-assembly1.cif.gz_S structure of the human mcad:etf e165betaa complex 0.9099 2 241
ID Description Score Start End Superfamily
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9621 1 223 3.40.50.620
1t9gS00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9375 1 223 3.40.50.620
1o94C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.916 1 210 3.40.50.620
af_Q54YZ4_1_250_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9119 2 246 3.40.50.620
af_A4I154_9_258_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8984 1 248 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1H2PLR8-F1-model_v4 Electron transfer flavoprotein beta subunit 0.9961 1 113 GO:0009055
AF-A0A3D5N4G0-F1-model_v4 Electron transfer flavoprotein subunit beta 0.9961 1 100 GO:0009055
AF-A0A7W9RY60-F1-model_v4 Electron transfer flavoprotein alpha/beta subunit 0.996 1 110 GO:0009055
AF-A0A368TRL3-F1-model_v4 Electron transfer flavoprotein subunit beta/FixA family protein 0.9947 1 110 GO:0009055
AF-A0A4S8F3U0-F1-model_v4 Electron transfer flavoprotein subunit beta/FixA family protein 0.9934 2 116 GO:0009055

Feature Viewer

pLDDT pTM Quality
90.92 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map