F478161
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 734 | 340 | 734 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300044735|Ga0466968_0019351|Ga0466968_0019351_1294_2424 |
| Length | 376 |
| Sequence | MKAMERGMDVKRKLSAQQLAGLAALLVIACVLPFVLGNYTVFQLTMAMSYAIALLGLNMLTGYNGQISLGHGAFFAIGAYTAAILMDKANWPYWATIPAAGIVCLAAGFLFGLPALRLEGLYLALATFALGVAMPQILKYKGFEHWTGGSMGVVIMKPDPPAGIPLNQDQWLYFFTLLWVVILFVAGWNILRGRVGRALVAIRDHPIAAQAMGVNTAMYKSLTFGVSALYTGIAGALAAIGVQFASPDSFSVFLSLTLLVGVVVGGLASISGAFYGALFIQFIPNIADRISKAAPWAIYGVFLIAFMYLMPSGVAGLIAMVRRRFVKVPVQVQERKQDDDSTQDPRDRRSHARGPVPEHRVRAIEEGNQDRADHAV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 55 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 56 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 57 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 84 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 181 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 184 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 198 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 199 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 200 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 201 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 202 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 205 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 207 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 208 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 209 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 210 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 211 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 212 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 215 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 216 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 217 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 219 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 221 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 222 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 223 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 224 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 225 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 226 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 227 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 228 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 229 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 230 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 231 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 232 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 233 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 234 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 235 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 236 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 237 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 238 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 239 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 240 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 241 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 244 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 282 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 283 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 292 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 315 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 317 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 334 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 335 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 339 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 340 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.36 |
| Nodule | 0 |
| Rhizoplane | 4.09 |
| Rhizosphere | 90.46 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.09 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10313918 | 3300005327 | Bacteria | 1338 |
| 2 | Ga0070676_10008106 | 3300005328 | Bacteria | 5650 |
| 3 | Ga0070690_100005969 | 3300005330 | Bacteria | 6877 |
| 4 | Ga0070670_100002757 | 3300005331 | Bacteria | 14508 |
| 5 | Ga0070670_100009195 | 3300005331 | Bacteria | 8445 |
| 6 | Ga0070670_100068783 | 3300005331 | Bacteria | 3039 |
| 7 | Ga0070670_100142133 | 3300005331 | Bacteria | 2076 |
| 8 | Ga0070670_100173000 | 3300005331 | Bacteria | 1873 |
| 9 | Ga0070670_100222170 | 3300005331 | Bacteria | 1643 |
| 10 | Ga0070670_100246288 | 3300005331 | Bacteria | 1556 |
| 11 | Ga0070670_100375779 | 3300005331 | Bacteria | 1251 |
| 12 | Ga0070677_10002411 | 3300005333 | Bacteria | 5965 |
| 13 | Ga0070677_10017059 | 3300005333 | Bacteria | 2593 |
| 14 | Ga0068869_100002122 | 3300005334 | Bacteria | 11923 |
| 15 | Ga0068869_100004332 | 3300005334 | Bacteria | 8810 |
| 16 | Ga0068869_100019219 | 3300005334 | Bacteria | 4663 |
| 17 | Ga0070666_10001889 | 3300005335 | Bacteria | 12748 |
| 18 | Ga0070666_10004949 | 3300005335 | Bacteria | 8151 |
| 19 | Ga0070680_100035618 | 3300005336 | Bacteria | 4019 |
| 20 | Ga0070680_100080743 | 3300005336 | Bacteria | 2682 |
| 21 | Ga0070680_100148819 | 3300005336 | Bacteria | 1965 |
| 22 | Ga0070682_100078008 | 3300005337 | Bacteria | 2136 |
| 23 | Ga0068868_100006941 | 3300005338 | Bacteria | 8048 |
| 24 | Ga0068868_100120478 | 3300005338 | Bacteria | 2140 |
| 25 | Ga0070660_100149037 | 3300005339 | Bacteria | 1880 |
| 26 | Ga0070689_100228459 | 3300005340 | Bacteria | 1529 |
| 27 | Ga0070687_100034083 | 3300005343 | Bacteria | 2518 |
| 28 | Ga0070668_100130216 | 3300005347 | Bacteria | 2019 |
| 29 | Ga0070669_100004770 | 3300005353 | Bacteria | 9779 |
| 30 | Ga0070669_100161509 | 3300005353 | Bacteria | 1741 |
| 31 | Ga0070675_100002630 | 3300005354 | Bacteria | 13494 |
| 32 | Ga0070675_100027777 | 3300005354 | Bacteria | 4549 |
| 33 | Ga0070675_100061955 | 3300005354 | Bacteria | 3090 |
| 34 | Ga0070675_100123555 | 3300005354 | Bacteria | 2201 |
| 35 | Ga0070671_100021081 | 3300005355 | Bacteria | 5320 |
| 36 | Ga0070671_100036410 | 3300005355 | Bacteria | 4081 |
| 37 | Ga0070671_100245386 | 3300005355 | Bacteria | 1520 |
| 38 | Ga0070671_100317408 | 3300005355 | Bacteria | 1327 |
| 39 | Ga0070674_100056559 | 3300005356 | Bacteria | 2720 |
| 40 | Ga0070673_100274156 | 3300005364 | Bacteria | 1477 |
| 41 | Ga0070688_100026960 | 3300005365 | Bacteria | 3419 |
| 42 | Ga0070659_100024761 | 3300005366 | Bacteria | 4603 |
| 43 | Ga0070667_100030785 | 3300005367 | Bacteria | 4475 |
| 44 | Ga0070667_100091932 | 3300005367 | Bacteria | 2610 |
| 45 | Ga0070667_100093719 | 3300005367 | Bacteria | 2587 |
| 46 | Ga0070667_100165616 | 3300005367 | Bacteria | 1949 |
| 47 | Ga0070711_100059630 | 3300005439 | Bacteria | 2650 |
| 48 | Ga0070705_100087470 | 3300005440 | Bacteria | 1932 |
| 49 | Ga0070705_100099966 | 3300005440 | Bacteria | 1829 |
| 50 | Ga0070705_100100317 | 3300005440 | Bacteria | 1827 |
| 51 | Ga0070700_100003507 | 3300005441 | Bacteria | 8091 |
| 52 | Ga0070700_100077649 | 3300005441 | Bacteria | 2136 |
| 53 | Ga0070700_100265184 | 3300005441 | Bacteria | 1238 |
| 54 | Ga0070694_100005593 | 3300005444 | Bacteria | 7617 |
| 55 | Ga0070694_100008469 | 3300005444 | Bacteria | 6291 |
| 56 | Ga0070708_100071167 | 3300005445 | Bacteria | 3130 |
| 57 | Ga0070663_100007618 | 3300005455 | Bacteria | 6604 |
| 58 | Ga0070663_100284924 | 3300005455 | Bacteria | 1318 |
| 59 | Ga0070678_100002569 | 3300005456 | Bacteria | 9969 |
| 60 | Ga0070678_100012645 | 3300005456 | Bacteria | 5259 |
| 61 | Ga0070678_100020488 | 3300005456 | Bacteria | 4340 |
| 62 | Ga0070678_100036514 | 3300005456 | Bacteria | 3441 |
| 63 | Ga0070678_100108183 | 3300005456 | Bacteria | 2170 |
| 64 | Ga0070662_100014240 | 3300005457 | Bacteria | 5308 |
| 65 | Ga0070662_100014845 | 3300005457 | Bacteria | 5208 |
| 66 | Ga0070662_100020143 | 3300005457 | Bacteria | 4539 |
| 67 | Ga0070662_100171509 | 3300005457 | Bacteria | 1704 |
| 68 | Ga0070662_100394058 | 3300005457 | Bacteria | 1142 |
| 69 | Ga0070681_10009509 | 3300005458 | Bacteria | 9567 |
| 70 | Ga0070681_10012298 | 3300005458 | Bacteria | 8489 |
| 71 | Ga0070681_10022535 | 3300005458 | Bacteria | 6325 |
| 72 | Ga0068867_100001086 | 3300005459 | Bacteria | 18625 |
| 73 | Ga0068867_100006301 | 3300005459 | Bacteria | 8395 |
| 74 | Ga0068867_100051748 | 3300005459 | Bacteria | 3030 |
| 75 | Ga0068867_100088689 | 3300005459 | Bacteria | 2344 |
| 76 | Ga0068867_100327287 | 3300005459 | Bacteria | 1271 |
| 77 | Ga0070685_10091391 | 3300005466 | Bacteria | 1843 |
| 78 | Ga0070685_10114797 | 3300005466 | Bacteria | 1665 |
| 79 | Ga0070706_100056652 | 3300005467 | Bacteria | 3616 |
| 80 | Ga0070706_100069571 | 3300005467 | Bacteria | 3255 |
| 81 | Ga0070706_100184916 | 3300005467 | Bacteria | 1947 |
| 82 | Ga0070707_100125374 | 3300005468 | Bacteria | 2494 |
| 83 | Ga0070707_100337339 | 3300005468 | Bacteria | 1465 |
| 84 | Ga0070698_100128136 | 3300005471 | Bacteria | 2494 |
| 85 | Ga0070699_100012263 | 3300005518 | Bacteria | 7394 |
| 86 | Ga0070679_100004740 | 3300005530 | Bacteria | 12542 |
| 87 | Ga0070679_100008970 | 3300005530 | Bacteria | 9437 |
| 88 | Ga0070679_100199967 | 3300005530 | Bacteria | 1965 |
| 89 | Ga0070679_100458460 | 3300005530 | Bacteria | 1219 |
| 90 | Ga0070697_100028919 | 3300005536 | Bacteria | 4441 |
| 91 | Ga0070697_100038033 | 3300005536 | Bacteria | 3887 |
| 92 | Ga0068853_100019417 | 3300005539 | Bacteria | 5634 |
| 93 | Ga0070672_100004725 | 3300005543 | Bacteria | 8940 |
| 94 | Ga0070672_100009264 | 3300005543 | Bacteria | 6780 |
| 95 | Ga0070672_100051990 | 3300005543 | Bacteria | 3197 |
| 96 | Ga0070672_100055033 | 3300005543 | Bacteria | 3116 |
| 97 | Ga0070672_100154305 | 3300005543 | Bacteria | 1901 |
| 98 | Ga0070686_100012900 | 3300005544 | Bacteria | 4771 |
| 99 | Ga0070695_100019186 | 3300005545 | Bacteria | 4160 |
| 100 | Ga0070695_100101915 | 3300005545 | Bacteria | 1935 |
| 101 | Ga0070695_100108643 | 3300005545 | Bacteria | 1879 |
| 102 | Ga0070695_100287097 | 3300005545 | Bacteria | 1211 |
| 103 | Ga0070696_100071825 | 3300005546 | Bacteria | 2436 |
| 104 | Ga0070693_100100341 | 3300005547 | Bacteria | 1762 |
| 105 | Ga0070665_100165095 | 3300005548 | Bacteria | 2216 |
| 106 | Ga0070704_100038987 | 3300005549 | Bacteria | 3259 |
| 107 | Ga0068855_100004439 | 3300005563 | Bacteria | 17139 |
| 108 | Ga0068855_100009666 | 3300005563 | Bacteria | 11637 |
| 109 | Ga0068855_100081449 | 3300005563 | Bacteria | 3752 |
| 110 | Ga0070664_100053624 | 3300005564 | Bacteria | 3419 |
| 111 | Ga0070664_100085179 | 3300005564 | Bacteria | 2729 |
| 112 | Ga0070664_100144464 | 3300005564 | Bacteria | 2097 |
| 113 | Ga0070664_100232032 | 3300005564 | Bacteria | 1654 |
| 114 | Ga0068857_100198475 | 3300005577 | Bacteria | 1828 |
| 115 | Ga0068854_100014049 | 3300005578 | Bacteria | 5271 |
| 116 | Ga0068856_100002754 | 3300005614 | Bacteria | 18000 |
| 117 | Ga0068856_100021873 | 3300005614 | Bacteria | 6216 |
| 118 | Ga0070702_100049806 | 3300005615 | Bacteria | 2390 |
| 119 | Ga0068852_100012855 | 3300005616 | Bacteria | 6382 |
| 120 | Ga0068852_100014774 | 3300005616 | Bacteria | 6028 |
| 121 | Ga0068852_100126502 | 3300005616 | Bacteria | 2348 |
| 122 | Ga0068852_100211164 | 3300005616 | Bacteria | 1841 |
| 123 | Ga0068859_100007812 | 3300005617 | Bacteria | 10858 |
| 124 | Ga0068859_100029524 | 3300005617 | Bacteria | 5502 |
| 125 | Ga0068859_100128891 | 3300005617 | Bacteria | 2601 |
| 126 | Ga0068859_100232145 | 3300005617 | Bacteria | 1933 |
| 127 | Ga0068864_100001309 | 3300005618 | Bacteria | 20721 |
| 128 | Ga0068864_100014331 | 3300005618 | Bacteria | 6585 |
| 129 | Ga0068864_100067142 | 3300005618 | Bacteria | 3114 |
| 130 | Ga0068864_100142059 | 3300005618 | Bacteria | 2166 |
| 131 | Ga0068864_100275623 | 3300005618 | Bacteria | 1568 |
| 132 | Ga0068866_10044520 | 3300005718 | Bacteria | 2221 |
| 133 | Ga0068866_10131322 | 3300005718 | Bacteria | 1425 |
| 134 | Ga0068861_100002723 | 3300005719 | Bacteria | 11577 |
| 135 | Ga0068861_100006046 | 3300005719 | Bacteria | 8233 |
| 136 | Ga0068861_100009341 | 3300005719 | Bacteria | 6768 |
| 137 | Ga0068861_100148714 | 3300005719 | Bacteria | 1920 |
| 138 | Ga0068861_100186909 | 3300005719 | Bacteria | 1729 |
| 139 | Ga0068861_100433721 | 3300005719 | Bacteria | 1173 |
| 140 | Ga0068851_10063975 | 3300005834 | Bacteria | 1890 |
| 141 | Ga0068851_10097805 | 3300005834 | Bacteria | 1553 |
| 142 | Ga0068863_100009149 | 3300005841 | Bacteria | 9667 |
| 143 | Ga0068863_100013734 | 3300005841 | Bacteria | 7808 |
| 144 | Ga0068863_100145777 | 3300005841 | Bacteria | 2264 |
| 145 | Ga0068863_100188712 | 3300005841 | Bacteria | 1980 |
| 146 | Ga0068863_100444600 | 3300005841 | Bacteria | 1272 |
| 147 | Ga0068858_100002892 | 3300005842 | Bacteria | 17265 |
| 148 | Ga0068858_100003275 | 3300005842 | Bacteria | 16136 |
| 149 | Ga0068858_100006541 | 3300005842 | Bacteria | 11334 |
| 150 | Ga0068860_100000445 | 3300005843 | Bacteria | 52236 |
| 151 | Ga0068860_100003813 | 3300005843 | Bacteria | 15505 |
| 152 | Ga0068860_100055223 | 3300005843 | Bacteria | 3775 |
| 153 | Ga0068860_100467608 | 3300005843 | Bacteria | 1256 |
| 154 | Ga0068862_100010767 | 3300005844 | Bacteria | 7550 |
| 155 | Ga0068862_100038290 | 3300005844 | Bacteria | 4067 |
| 156 | Ga0068862_100098450 | 3300005844 | Bacteria | 2555 |
| 157 | Ga0068862_100296552 | 3300005844 | Bacteria | 1486 |
| 158 | Ga0068862_100361354 | 3300005844 | Bacteria | 1349 |
| 159 | Ga0081539_10132285 | 3300005985 | Bacteria | 1223 |
| 160 | Ga0075365_10053369 | 3300006038 | Bacteria | 2677 |
| 161 | Ga0075363_100044891 | 3300006048 | Bacteria | 2342 |
| 162 | Ga0075363_100130919 | 3300006048 | Bacteria | 1407 |
| 163 | Ga0075364_10127340 | 3300006051 | Bacteria | 1708 |
| 164 | Ga0075364_10168113 | 3300006051 | Bacteria | 1482 |
| 165 | Ga0075432_10035439 | 3300006058 | Bacteria | 1734 |
| 166 | Ga0070715_10039621 | 3300006163 | Bacteria | 1964 |
| 167 | Ga0070712_100074571 | 3300006175 | Bacteria | 2438 |
| 168 | Ga0075362_10002737 | 3300006177 | Bacteria | 6007 |
| 169 | Ga0075362_10032612 | 3300006177 | Bacteria | 2261 |
| 170 | Ga0075367_10002066 | 3300006178 | Bacteria | 8992 |
| 171 | Ga0075367_10125329 | 3300006178 | Bacteria | 1585 |
| 172 | Ga0075369_10001746 | 3300006186 | Bacteria | 7534 |
| 173 | Ga0075366_10039304 | 3300006195 | Bacteria | 2797 |
| 174 | Ga0075366_10086166 | 3300006195 | Bacteria | 1879 |
| 175 | Ga0097621_100017213 | 3300006237 | Bacteria | 5485 |
| 176 | Ga0097621_100048088 | 3300006237 | Bacteria | 3459 |
| 177 | Ga0097621_100115999 | 3300006237 | Bacteria | 2267 |
| 178 | Ga0097621_100192298 | 3300006237 | Bacteria | 1768 |
| 179 | Ga0097621_100201581 | 3300006237 | Bacteria | 1728 |
| 180 | Ga0075370_10001147 | 3300006353 | Bacteria | 11127 |
| 181 | Ga0075370_10004740 | 3300006353 | Bacteria | 6649 |
| 182 | Ga0075370_10042799 | 3300006353 | Bacteria | 2559 |
| 183 | Ga0068871_100016517 | 3300006358 | Bacteria | 5563 |
| 184 | Ga0068871_100071329 | 3300006358 | Bacteria | 2857 |
| 185 | Ga0068871_100091740 | 3300006358 | Bacteria | 2532 |
| 186 | Ga0068871_100095369 | 3300006358 | Bacteria | 2484 |
| 187 | Ga0075428_100254586 | 3300006844 | Bacteria | 1891 |
| 188 | Ga0075428_100672709 | 3300006844 | Bacteria | 1103 |
| 189 | Ga0075430_100016752 | 3300006846 | Bacteria | 6243 |
| 190 | Ga0075431_100009047 | 3300006847 | Bacteria | 9987 |
| 191 | Ga0075431_100021141 | 3300006847 | Bacteria | 6649 |
| 192 | Ga0075431_100055100 | 3300006847 | Bacteria | 4101 |
| 193 | Ga0075431_100091893 | 3300006847 | Bacteria | 3132 |
| 194 | Ga0075433_10141798 | 3300006852 | Bacteria | 2136 |
| 195 | Ga0075434_100000132 | 3300006871 | Bacteria | 44951 |
| 196 | Ga0075434_100049920 | 3300006871 | Bacteria | 4155 |
| 197 | Ga0075429_100000638 | 3300006880 | Bacteria | 27089 |
| 198 | Ga0075429_100070657 | 3300006880 | Bacteria | 3040 |
| 199 | Ga0068865_100002093 | 3300006881 | Bacteria | 11787 |
| 200 | Ga0068865_100023360 | 3300006881 | Bacteria | 4047 |
| 201 | Ga0075436_100073824 | 3300006914 | Bacteria | 2361 |
| 202 | Ga0075436_100122725 | 3300006914 | Bacteria | 1819 |
| 203 | Ga0097620_100007812 | 3300006931 | Bacteria | 10858 |
| 204 | Ga0097620_100029524 | 3300006931 | Bacteria | 5502 |
| 205 | Ga0097620_100128892 | 3300006931 | Bacteria | 2601 |
| 206 | Ga0097620_100232124 | 3300006931 | Bacteria | 1933 |
| 207 | Ga0075435_100001341 | 3300007076 | Bacteria | 15839 |
| 208 | Ga0075435_100006450 | 3300007076 | Bacteria | 8299 |
| 209 | Ga0075435_100019365 | 3300007076 | Bacteria | 5197 |
| 210 | Ga0075435_100037184 | 3300007076 | Bacteria | 3875 |
| 211 | Ga0075435_100195112 | 3300007076 | Bacteria | 1715 |
| 212 | Ga0075435_100267804 | 3300007076 | Bacteria | 1457 |
| 213 | Ga0099795_10030113 | 3300007788 | Bacteria | 1861 |
| 214 | Ga0105240_10012681 | 3300009093 | Bacteria | 11616 |
| 215 | Ga0105240_10031668 | 3300009093 | Bacteria | 6854 |
| 216 | Ga0105240_10100319 | 3300009093 | Bacteria | 3523 |
| 217 | Ga0105240_10251643 | 3300009093 | Bacteria | 2043 |
| 218 | Ga0111539_10006412 | 3300009094 | Bacteria | 15172 |
| 219 | Ga0111539_10038861 | 3300009094 | Bacteria | 5741 |
| 220 | Ga0111539_10107535 | 3300009094 | Bacteria | 3273 |
| 221 | Ga0111539_10129330 | 3300009094 | Bacteria | 2957 |
| 222 | Ga0105245_10223471 | 3300009098 | Bacteria | 1818 |
| 223 | Ga0114129_10007443 | 3300009147 | Bacteria | 15595 |
| 224 | Ga0114129_10015516 | 3300009147 | Bacteria | 10831 |
| 225 | Ga0114129_10267830 | 3300009147 | Bacteria | 2287 |
| 226 | Ga0114129_10386532 | 3300009147 | Bacteria | 1847 |
| 227 | Ga0114129_10589906 | 3300009147 | Bacteria | 1441 |
| 228 | Ga0105243_10012737 | 3300009148 | Bacteria | 6353 |
| 229 | Ga0105243_10021971 | 3300009148 | Bacteria | 4846 |
| 230 | Ga0105243_10149966 | 3300009148 | Bacteria | 1999 |
| 231 | Ga0105243_10225236 | 3300009148 | Bacteria | 1660 |
| 232 | Ga0105242_10035175 | 3300009176 | Bacteria | 4017 |
| 233 | Ga0105242_10132848 | 3300009176 | Bacteria | 2151 |
| 234 | Ga0105242_10205843 | 3300009176 | Bacteria | 1750 |
| 235 | Ga0105248_10077605 | 3300009177 | Bacteria | 3734 |
| 236 | Ga0105248_10079168 | 3300009177 | Bacteria | 3693 |
| 237 | Ga0105237_10020953 | 3300009545 | Bacteria | 6730 |
| 238 | Ga0105238_10028562 | 3300009551 | Bacteria | 5682 |
| 239 | Ga0105238_10030346 | 3300009551 | Bacteria | 5502 |
| 240 | Ga0105238_10069909 | 3300009551 | Bacteria | 3511 |
| 241 | Ga0105249_10063386 | 3300009553 | Bacteria | 3396 |
| 242 | Ga0105249_10199009 | 3300009553 | Bacteria | 1960 |
| 243 | Ga0105249_10372687 | 3300009553 | Bacteria | 1452 |
| 244 | Ga0105239_10018223 | 3300010375 | Bacteria | 7762 |
| 245 | Ga0105239_10102136 | 3300010375 | Bacteria | 3173 |
| 246 | Ga0105246_10419917 | 3300011119 | Bacteria | 1116 |
| 247 | Ga0157373_10008856 | 3300013100 | Bacteria | 7450 |
| 248 | Ga0157371_10071907 | 3300013102 | Bacteria | 2449 |
| 249 | Ga0157370_10033935 | 3300013104 | Bacteria | 4972 |
| 250 | Ga0157370_10037271 | 3300013104 | Bacteria | 4714 |
| 251 | Ga0157374_10096546 | 3300013296 | Bacteria | 2827 |
| 252 | Ga0157374_10107158 | 3300013296 | Bacteria | 2685 |
| 253 | Ga0157374_10115310 | 3300013296 | Bacteria | 2588 |
| 254 | Ga0157374_10277089 | 3300013296 | Bacteria | 1655 |
| 255 | Ga0157374_10370832 | 3300013296 | Bacteria | 1425 |
| 256 | Ga0157378_10287237 | 3300013297 | Bacteria | 1588 |
| 257 | Ga0163162_10012088 | 3300013306 | Bacteria | 8422 |
| 258 | Ga0163162_10036523 | 3300013306 | Bacteria | 4898 |
| 259 | Ga0163162_10054073 | 3300013306 | Bacteria | 4037 |
| 260 | Ga0163162_10193531 | 3300013306 | Bacteria | 2161 |
| 261 | Ga0157372_10038032 | 3300013307 | Bacteria | 5310 |
| 262 | Ga0157372_10115147 | 3300013307 | Bacteria | 3082 |
| 263 | Ga0157375_10012725 | 3300013308 | Bacteria | 7468 |
| 264 | Ga0157375_10032862 | 3300013308 | Bacteria | 4925 |
| 265 | Ga0157375_10353880 | 3300013308 | Bacteria | 1634 |
| 266 | Ga0157375_10451756 | 3300013308 | Bacteria | 1451 |
| 267 | Ga0157375_10476969 | 3300013308 | Bacteria | 1412 |
| 268 | Ga0163163_10001922 | 3300014325 | Bacteria | 17590 |
| 269 | Ga0157380_10013461 | 3300014326 | Bacteria | 5964 |
| 270 | Ga0157380_10015790 | 3300014326 | Bacteria | 5556 |
| 271 | Ga0182008_10049438 | 3300014497 | Bacteria | 2087 |
| 272 | Ga0157377_10003326 | 3300014745 | Bacteria | 7267 |
| 273 | Ga0157377_10094696 | 3300014745 | Bacteria | 1769 |
| 274 | Ga0157379_10012126 | 3300014968 | Bacteria | 7527 |
| 275 | Ga0157379_10037589 | 3300014968 | Bacteria | 4318 |
| 276 | Ga0157379_10075966 | 3300014968 | Bacteria | 3008 |
| 277 | Ga0157379_10205795 | 3300014968 | Bacteria | 1780 |
| 278 | Ga0157379_10344064 | 3300014968 | Bacteria | 1364 |
| 279 | Ga0157379_10501204 | 3300014968 | Bacteria | 1125 |
| 280 | Ga0157376_10003522 | 3300014969 | Bacteria | 10798 |
| 281 | Ga0157376_10028875 | 3300014969 | Bacteria | 4413 |
| 282 | Ga0157376_10032818 | 3300014969 | Bacteria | 4172 |
| 283 | Ga0157376_10156917 | 3300014969 | Bacteria | 2059 |
| 284 | Ga0183362_10015 | 3300015683 | Bacteria | 36270 |
| 285 | Ga0163161_10007610 | 3300017792 | Bacteria | 7492 |
| 286 | Ga0163161_10013748 | 3300017792 | Bacteria | 5638 |
| 287 | Ga0163161_10020823 | 3300017792 | Bacteria | 4605 |
| 288 | Ga0207697_10015533 | 3300025315 | Bacteria | 3145 |
| 289 | Ga0207656_10021654 | 3300025321 | Bacteria | 2571 |
| 290 | Ga0207656_10053593 | 3300025321 | Bacteria | 1751 |
| 291 | Ga0207682_10008973 | 3300025893 | Bacteria | 3951 |
| 292 | Ga0207682_10011656 | 3300025893 | Bacteria | 3436 |
| 293 | Ga0207642_10002491 | 3300025899 | Bacteria | 5731 |
| 294 | Ga0207688_10012083 | 3300025901 | Bacteria | 4697 |
| 295 | Ga0207688_10040003 | 3300025901 | Bacteria | 2605 |
| 296 | Ga0207680_10005090 | 3300025903 | Bacteria | 6265 |
| 297 | Ga0207680_10046236 | 3300025903 | Bacteria | 2572 |
| 298 | Ga0207680_10235994 | 3300025903 | Bacteria | 1258 |
| 299 | Ga0207645_10004582 | 3300025907 | Bacteria | 10192 |
| 300 | Ga0207645_10004810 | 3300025907 | Bacteria | 9928 |
| 301 | Ga0207645_10014016 | 3300025907 | Bacteria | 5377 |
| 302 | Ga0207645_10019748 | 3300025907 | Bacteria | 4414 |
| 303 | Ga0207645_10047244 | 3300025907 | Bacteria | 2749 |
| 304 | Ga0207643_10036858 | 3300025908 | Bacteria | 2743 |
| 305 | Ga0207643_10071694 | 3300025908 | Bacteria | 1995 |
| 306 | Ga0207705_10027375 | 3300025909 | Bacteria | 4065 |
| 307 | Ga0207705_10028425 | 3300025909 | Bacteria | 3986 |
| 308 | Ga0207684_10019197 | 3300025910 | Bacteria | 5848 |
| 309 | Ga0207684_10052702 | 3300025910 | Bacteria | 3453 |
| 310 | Ga0207684_10084097 | 3300025910 | Bacteria | 2710 |
| 311 | Ga0207707_10007969 | 3300025912 | Bacteria | 9208 |
| 312 | Ga0207707_10008127 | 3300025912 | Bacteria | 9110 |
| 313 | Ga0207695_10005984 | 3300025913 | Bacteria | 15908 |
| 314 | Ga0207671_10011567 | 3300025914 | Bacteria | 7166 |
| 315 | Ga0207671_10012655 | 3300025914 | Bacteria | 6772 |
| 316 | Ga0207693_10219308 | 3300025915 | Bacteria | 1494 |
| 317 | Ga0207660_10225371 | 3300025917 | Bacteria | 1472 |
| 318 | Ga0207662_10001475 | 3300025918 | Bacteria | 11429 |
| 319 | Ga0207662_10205031 | 3300025918 | Bacteria | 1278 |
| 320 | Ga0207657_10028298 | 3300025919 | Bacteria | 5115 |
| 321 | Ga0207657_10090018 | 3300025919 | Bacteria | 2561 |
| 322 | Ga0207649_10040599 | 3300025920 | Bacteria | 2829 |
| 323 | Ga0207649_10171098 | 3300025920 | Bacteria | 1513 |
| 324 | Ga0207652_10033083 | 3300025921 | Bacteria | 4352 |
| 325 | Ga0207652_10049017 | 3300025921 | Bacteria | 3613 |
| 326 | Ga0207652_10084697 | 3300025921 | Bacteria | 2778 |
| 327 | Ga0207652_10189807 | 3300025921 | Bacteria | 1848 |
| 328 | Ga0207646_10053523 | 3300025922 | Bacteria | 3610 |
| 329 | Ga0207646_10264735 | 3300025922 | Unclassified | 1554 |
| 330 | Ga0207646_10303116 | 3300025922 | Bacteria | 1443 |
| 331 | Ga0207646_10456748 | 3300025922 | Bacteria | 1152 |
| 332 | Ga0207681_10008531 | 3300025923 | Bacteria | 6257 |
| 333 | Ga0207681_10039208 | 3300025923 | Bacteria | 3143 |
| 334 | Ga0207681_10053922 | 3300025923 | Bacteria | 2731 |
| 335 | Ga0207694_10028565 | 3300025924 | Bacteria | 4252 |
| 336 | Ga0207694_10160138 | 3300025924 | Bacteria | 1817 |
| 337 | Ga0207650_10002987 | 3300025925 | Bacteria | 11668 |
| 338 | Ga0207650_10024459 | 3300025925 | Bacteria | 4293 |
| 339 | Ga0207650_10025290 | 3300025925 | Bacteria | 4228 |
| 340 | Ga0207650_10028679 | 3300025925 | Bacteria | 3994 |
| 341 | Ga0207650_10260510 | 3300025925 | Bacteria | 1406 |
| 342 | Ga0207659_10008417 | 3300025926 | Bacteria | 6402 |
| 343 | Ga0207659_10008930 | 3300025926 | Bacteria | 6247 |
| 344 | Ga0207659_10009561 | 3300025926 | Bacteria | 6064 |
| 345 | Ga0207659_10011014 | 3300025926 | Bacteria | 5698 |
| 346 | Ga0207659_10075986 | 3300025926 | Bacteria | 2467 |
| 347 | Ga0207659_10086740 | 3300025926 | Bacteria | 2328 |
| 348 | Ga0207687_10085226 | 3300025927 | Bacteria | 2292 |
| 349 | Ga0207687_10136411 | 3300025927 | Bacteria | 1856 |
| 350 | Ga0207644_10012106 | 3300025931 | Bacteria | 5722 |
| 351 | Ga0207644_10096851 | 3300025931 | Bacteria | 2209 |
| 352 | Ga0207644_10213506 | 3300025931 | Bacteria | 1527 |
| 353 | Ga0207644_10330995 | 3300025931 | Bacteria | 1233 |
| 354 | Ga0207706_10002472 | 3300025933 | Bacteria | 18012 |
| 355 | Ga0207706_10009798 | 3300025933 | Bacteria | 8792 |
| 356 | Ga0207706_10057558 | 3300025933 | Bacteria | 3424 |
| 357 | Ga0207706_10125307 | 3300025933 | Bacteria | 2259 |
| 358 | Ga0207706_10136371 | 3300025933 | Bacteria | 2159 |
| 359 | Ga0207686_10006662 | 3300025934 | Bacteria | 6230 |
| 360 | Ga0207686_10085036 | 3300025934 | Bacteria | 2074 |
| 361 | Ga0207709_10002954 | 3300025935 | Bacteria | 10369 |
| 362 | Ga0207709_10010795 | 3300025935 | Bacteria | 5029 |
| 363 | Ga0207709_10048266 | 3300025935 | Bacteria | 2593 |
| 364 | Ga0207670_10090548 | 3300025936 | Bacteria | 2161 |
| 365 | Ga0207670_10178150 | 3300025936 | Bacteria | 1599 |
| 366 | Ga0207669_10018826 | 3300025937 | Bacteria | 3580 |
| 367 | Ga0207669_10019212 | 3300025937 | Bacteria | 3552 |
| 368 | Ga0207669_10034033 | 3300025937 | Bacteria | 2883 |
| 369 | Ga0207669_10072356 | 3300025937 | Bacteria | 2170 |
| 370 | Ga0207669_10140045 | 3300025937 | Bacteria | 1678 |
| 371 | Ga0207704_10000959 | 3300025938 | Bacteria | 12771 |
| 372 | Ga0207704_10010842 | 3300025938 | Bacteria | 4463 |
| 373 | Ga0207704_10045219 | 3300025938 | Bacteria | 2615 |
| 374 | Ga0207665_10002514 | 3300025939 | Bacteria | 12330 |
| 375 | Ga0207665_10044076 | 3300025939 | Bacteria | 2985 |
| 376 | Ga0207691_10001243 | 3300025940 | Bacteria | 25438 |
| 377 | Ga0207691_10006274 | 3300025940 | Bacteria | 11477 |
| 378 | Ga0207691_10010762 | 3300025940 | Bacteria | 8782 |
| 379 | Ga0207691_10013009 | 3300025940 | Bacteria | 7968 |
| 380 | Ga0207691_10018605 | 3300025940 | Bacteria | 6584 |
| 381 | Ga0207691_10097865 | 3300025940 | Bacteria | 2622 |
| 382 | Ga0207711_10031936 | 3300025941 | Bacteria | 4449 |
| 383 | Ga0207711_10037273 | 3300025941 | Bacteria | 4129 |
| 384 | Ga0207689_10003145 | 3300025942 | Bacteria | 15148 |
| 385 | Ga0207689_10004853 | 3300025942 | Bacteria | 12116 |
| 386 | Ga0207689_10043050 | 3300025942 | Bacteria | 3733 |
| 387 | Ga0207689_10079102 | 3300025942 | Bacteria | 2702 |
| 388 | Ga0207661_10182866 | 3300025944 | Bacteria | 1832 |
| 389 | Ga0207679_10028238 | 3300025945 | Bacteria | 3890 |
| 390 | Ga0207679_10050998 | 3300025945 | Bacteria | 3027 |
| 391 | Ga0207679_10132562 | 3300025945 | Bacteria | 2001 |
| 392 | Ga0207679_10207510 | 3300025945 | Bacteria | 1641 |
| 393 | Ga0207679_10249345 | 3300025945 | Bacteria | 1508 |
| 394 | Ga0207667_10003540 | 3300025949 | Bacteria | 19312 |
| 395 | Ga0207667_10014242 | 3300025949 | Bacteria | 9071 |
| 396 | Ga0207667_10125317 | 3300025949 | Bacteria | 2645 |
| 397 | Ga0207667_10132106 | 3300025949 | Bacteria | 2571 |
| 398 | Ga0207651_10005549 | 3300025960 | Bacteria | 6493 |
| 399 | Ga0207651_10317358 | 3300025960 | Bacteria | 1301 |
| 400 | Ga0207651_10405566 | 3300025960 | Bacteria | 1160 |
| 401 | Ga0207712_10011898 | 3300025961 | Bacteria | 5548 |
| 402 | Ga0207668_10012804 | 3300025972 | Bacteria | 5145 |
| 403 | Ga0207668_10079913 | 3300025972 | Bacteria | 2367 |
| 404 | Ga0207668_10097137 | 3300025972 | Bacteria | 2179 |
| 405 | Ga0207668_10268237 | 3300025972 | Bacteria | 1394 |
| 406 | Ga0207640_10289708 | 3300025981 | Bacteria | 1290 |
| 407 | Ga0207658_10003494 | 3300025986 | Bacteria | 11091 |
| 408 | Ga0207658_10027074 | 3300025986 | Bacteria | 4026 |
| 409 | Ga0207658_10051683 | 3300025986 | Bacteria | 3029 |
| 410 | Ga0207658_10114250 | 3300025986 | Bacteria | 2140 |
| 411 | Ga0207677_10003875 | 3300026023 | Bacteria | 7966 |
| 412 | Ga0207703_10001799 | 3300026035 | Bacteria | 19132 |
| 413 | Ga0207703_10191997 | 3300026035 | Bacteria | 1809 |
| 414 | Ga0207639_10036147 | 3300026041 | Bacteria | 3659 |
| 415 | Ga0207639_10109127 | 3300026041 | Bacteria | 2251 |
| 416 | Ga0207678_10063914 | 3300026067 | Bacteria | 3162 |
| 417 | Ga0207678_10064277 | 3300026067 | Bacteria | 3153 |
| 418 | Ga0207678_10089334 | 3300026067 | Bacteria | 2634 |
| 419 | Ga0207708_10012201 | 3300026075 | Bacteria | 6409 |
| 420 | Ga0207702_10012690 | 3300026078 | Bacteria | 7011 |
| 421 | Ga0207702_10102791 | 3300026078 | Bacteria | 2526 |
| 422 | Ga0207702_10331977 | 3300026078 | Bacteria | 1451 |
| 423 | Ga0207641_10015255 | 3300026088 | Bacteria | 6295 |
| 424 | Ga0207641_10020481 | 3300026088 | Bacteria | 5432 |
| 425 | Ga0207648_10004422 | 3300026089 | Bacteria | 14428 |
| 426 | Ga0207648_10004667 | 3300026089 | Bacteria | 14019 |
| 427 | Ga0207648_10014429 | 3300026089 | Bacteria | 7301 |
| 428 | Ga0207648_10017778 | 3300026089 | Bacteria | 6456 |
| 429 | Ga0207648_10021486 | 3300026089 | Bacteria | 5801 |
| 430 | Ga0207648_10041166 | 3300026089 | Bacteria | 4058 |
| 431 | Ga0207648_10209817 | 3300026089 | Bacteria | 1728 |
| 432 | Ga0207676_10003245 | 3300026095 | Bacteria | 11579 |
| 433 | Ga0207676_10005019 | 3300026095 | Bacteria | 9371 |
| 434 | Ga0207676_10011922 | 3300026095 | Bacteria | 6220 |
| 435 | Ga0207676_10030963 | 3300026095 | Bacteria | 4020 |
| 436 | Ga0207676_10035996 | 3300026095 | Bacteria | 3762 |
| 437 | Ga0207676_10052933 | 3300026095 | Bacteria | 3175 |
| 438 | Ga0207674_10105895 | 3300026116 | Bacteria | 2790 |
| 439 | Ga0207674_10212931 | 3300026116 | Bacteria | 1881 |
| 440 | Ga0207674_10322838 | 3300026116 | Bacteria | 1493 |
| 441 | Ga0207675_100003929 | 3300026118 | Bacteria | 14428 |
| 442 | Ga0207675_100004517 | 3300026118 | Bacteria | 13434 |
| 443 | Ga0207675_100007314 | 3300026118 | Bacteria | 10439 |
| 444 | Ga0207675_100017362 | 3300026118 | Bacteria | 6718 |
| 445 | Ga0207675_100076660 | 3300026118 | Bacteria | 3131 |
| 446 | Ga0207683_10004763 | 3300026121 | Bacteria | 11684 |
| 447 | Ga0207683_10006504 | 3300026121 | Bacteria | 10000 |
| 448 | Ga0207683_10007125 | 3300026121 | Bacteria | 9584 |
| 449 | Ga0207683_10054461 | 3300026121 | Bacteria | 3508 |
| 450 | Ga0207683_10166820 | 3300026121 | Bacteria | 1992 |
| 451 | Ga0207683_10392501 | 3300026121 | Bacteria | 1276 |
| 452 | Ga0207698_10013120 | 3300026142 | Bacteria | 5455 |
| 453 | Ga0207698_10033857 | 3300026142 | Bacteria | 3717 |
| 454 | Ga0207698_10048625 | 3300026142 | Bacteria | 3221 |
| 455 | Ga0207698_10136283 | 3300026142 | Bacteria | 2107 |
| 456 | Ga0207698_10187381 | 3300026142 | Bacteria | 1839 |
| 457 | Ga0207698_10329061 | 3300026142 | Bacteria | 1434 |
| 458 | Ga0209969_1000217 | 3300027360 | Bacteria | 7674 |
| 459 | Ga0209967_1000307 | 3300027364 | Bacteria | 6635 |
| 460 | Ga0209981_1001368 | 3300027378 | Bacteria | 3087 |
| 461 | Ga0210000_1002801 | 3300027462 | Bacteria | 2489 |
| 462 | Ga0209968_1001103 | 3300027526 | Bacteria | 4119 |
| 463 | Ga0209999_1000946 | 3300027543 | Bacteria | 4895 |
| 464 | Ga0207428_10000027 | 3300027907 | Bacteria | 250186 |
| 465 | Ga0207428_10036411 | 3300027907 | Bacteria | 4014 |
| 466 | Ga0207428_10062275 | 3300027907 | Bacteria | 2951 |
| 467 | Ga0207428_10108610 | 3300027907 | Bacteria | 2137 |
| 468 | Ga0268265_10003470 | 3300028380 | Bacteria | 11327 |
| 469 | Ga0268265_10004016 | 3300028380 | Bacteria | 10360 |
| 470 | Ga0268265_10077352 | 3300028380 | Bacteria | 2613 |
| 471 | Ga0268265_10313384 | 3300028380 | Bacteria | 1418 |
| 472 | Ga0268265_10374043 | 3300028380 | Bacteria | 1308 |
| 473 | Ga0268265_10547374 | 3300028380 | Bacteria | 1098 |
| 474 | Ga0268264_10015864 | 3300028381 | Bacteria | 6169 |
| 475 | Ga0268264_10020878 | 3300028381 | Bacteria | 5350 |
| 476 | Ga0268264_10100740 | 3300028381 | Bacteria | 2509 |
| 477 | Ga0307517_10142582 | 3300028786 | Bacteria | 1676 |
| 478 | Ga0307513_10013819 | 3300031456 | Bacteria | 9897 |
| 479 | Ga0307408_100048450 | 3300031548 | Bacteria | 3048 |
| 480 | Ga0307408_100096580 | 3300031548 | Bacteria | 2243 |
| 481 | Ga0316579_10005426 | 3300031691 | Bacteria | 5146 |
| 482 | Ga0265314_10044571 | 3300031711 | Bacteria | 3144 |
| 483 | Ga0265314_10084490 | 3300031711 | Bacteria | 2084 |
| 484 | Ga0307516_10046141 | 3300031730 | Bacteria | 4301 |
| 485 | Ga0307516_10103018 | 3300031730 | Bacteria | 2668 |
| 486 | Ga0307405_10003735 | 3300031731 | Bacteria | 7071 |
| 487 | Ga0307413_10026207 | 3300031824 | Bacteria | 3209 |
| 488 | Ga0307413_10068531 | 3300031824 | Bacteria | 2223 |
| 489 | Ga0307410_10013767 | 3300031852 | Bacteria | 4733 |
| 490 | Ga0307410_10050243 | 3300031852 | Bacteria | 2803 |
| 491 | Ga0307410_10147739 | 3300031852 | Bacteria | 1746 |
| 492 | Ga0307406_10005448 | 3300031901 | Bacteria | 6964 |
| 493 | Ga0307407_10002451 | 3300031903 | Bacteria | 7268 |
| 494 | Ga0307412_10009014 | 3300031911 | Bacteria | 5717 |
| 495 | Ga0307409_100022174 | 3300031995 | Bacteria | 4371 |
| 496 | Ga0307409_100125173 | 3300031995 | Bacteria | 2185 |
| 497 | Ga0307416_100001584 | 3300032002 | Bacteria | 12484 |
| 498 | Ga0307416_100056487 | 3300032002 | Bacteria | 3169 |
| 499 | Ga0307416_100360565 | 3300032002 | Bacteria | 1476 |
| 500 | Ga0307414_10031261 | 3300032004 | Bacteria | 3490 |
| 501 | Ga0307414_10243690 | 3300032004 | Bacteria | 1490 |
| 502 | Ga0307411_10002419 | 3300032005 | Bacteria | 8242 |
| 503 | Ga0307411_10361896 | 3300032005 | Bacteria | 1187 |
| 504 | Ga0316583_10009254 | 3300032133 | Bacteria | 3550 |
| 505 | Ga0373930_0036247 | 3300034816 | Bacteria | 1034 |
| 506 | Ga0373926_0011382 | 3300035083 | Bacteria | 2993 |
| 507 | Ga0373926_0049702 | 3300035083 | Bacteria | 1510 |
| 508 | Ga0373923_0061129 | 3300035111 | Bacteria | 1600 |
| 509 | Ga0373953_0063429 | 3300035117 | Bacteria | 1514 |
| 510 | Ga0373954_0000033 | 3300035118 | Bacteria | 54385 |
| 511 | Ga0373954_0038525 | 3300035118 | Bacteria | 2224 |
| 512 | Ga0373956_0032194 | 3300035119 | Bacteria | 2300 |
| 513 | Ga0373957_0013064 | 3300035120 | Bacteria | 2809 |
| 514 | Ga0373946_0123443 | 3300035171 | Bacteria | 1184 |
| 515 | Ga0373955_0021854 | 3300035172 | Bacteria | 3237 |
| 516 | Ga0373942_0033933 | 3300035207 | Bacteria | 1363 |
| 517 | Ga0373961_0005571 | 3300035241 | Bacteria | 3025 |
| 518 | Ga0316574_0006010 | 3300035398 | Bacteria | 6522 |
| 519 | Ga0373924_0003359 | 3300035410 | Bacteria | 5498 |
| 520 | Ga0373931_0006797 | 3300035691 | Bacteria | 5374 |
| 521 | Ga0373935_0129958 | 3300035692 | Bacteria | 1691 |
| 522 | Ga0373933_0002353 | 3300035724 | Bacteria | 10700 |
| 523 | Ga0373933_0006414 | 3300035724 | Bacteria | 6403 |
| 524 | Ga0373933_0096400 | 3300035724 | Bacteria | 1831 |
| 525 | Ga0373933_0121621 | 3300035724 | Bacteria | 1635 |
| 526 | Ga0373947_0088309 | 3300035725 | Bacteria | 1929 |
| 527 | Ga0373937_0000377 | 3300036401 | Bacteria | 41470 |
| 528 | Ga0373937_0003134 | 3300036401 | Bacteria | 13831 |
| 529 | Ga0373937_0028570 | 3300036401 | Bacteria | 5047 |
| 530 | Ga0373937_0055460 | 3300036401 | Bacteria | 3638 |
| 531 | Ga0373937_0113545 | 3300036401 | Bacteria | 2521 |
| 532 | Ga0316582_0007634 | 3300036647 | Bacteria | 5768 |
| 533 | Ga0373925_0142864 | 3300037068 | Bacteria | 1874 |
| 534 | Ga0395899_0081316 | 3300037312 | Bacteria | 2357 |
| 535 | Ga0395899_0199703 | 3300037312 | Bacteria | 1395 |
| 536 | Ga0395900_0010670 | 3300037418 | Bacteria | 9395 |
| 537 | Ga0395900_0021369 | 3300037418 | Bacteria | 6616 |
| 538 | Ga0395898_0017213 | 3300037466 | Bacteria | 7381 |
| 539 | Ga0395898_0091709 | 3300037466 | Bacteria | 2923 |
| 540 | Ga0395905_0000180 | 3300037471 | Bacteria | 100693 |
| 541 | Ga0395905_0035447 | 3300037471 | Bacteria | 4685 |
| 542 | Ga0395905_0055651 | 3300037471 | Bacteria | 3702 |
| 543 | Ga0395905_0087092 | 3300037471 | Bacteria | 2928 |
| 544 | Ga0395905_0151024 | 3300037471 | Bacteria | 2185 |
| 545 | Ga0395905_0225980 | 3300037471 | Bacteria | 1751 |
| 546 | Ga0395905_0275369 | 3300037471 | Bacteria | 1569 |
| 547 | Ga0395901_0024791 | 3300038443 | Bacteria | 6157 |
| 548 | Ga0395901_0061190 | 3300038443 | Bacteria | 3918 |
| 549 | Ga0395901_0108297 | 3300038443 | Bacteria | 2917 |
| 550 | Ga0395901_0211074 | 3300038443 | Bacteria | 2032 |
| 551 | Ga0242420_023590 | 3300038996 | Bacteria | 1111 |
| 552 | Ga0436365_0316538 | 3300039437 | Bacteria | 10934 |
| 553 | Ga0436365_1397879 | 3300039437 | Bacteria | 1431 |
| 554 | Ga0436360_1095664 | 3300039438 | Bacteria | 2155 |
| 555 | Ga0436360_1357442 | 3300039438 | Bacteria | 1943 |
| 556 | Ga0436363_0707452 | 3300039450 | Bacteria | 3226 |
| 557 | Ga0439461_0002114 | 3300041410 | Bacteria | 3144 |
| 558 | Ga0451853_1410340 | 3300041512 | Bacteria | 1546 |
| 559 | Ga0439441_011880 | 3300042001 | Bacteria | 1485 |
| 560 | Ga0439455_0016111 | 3300042012 | Bacteria | 1725 |
| 561 | Ga0439446_0001858 | 3300042156 | Bacteria | 4950 |
| 562 | Ga0439435_0000049 | 3300042436 | Bacteria | 13342 |
| 563 | Ga0439464_0002254 | 3300042439 | Bacteria | 4719 |
| 564 | Ga0451577_0003923 | 3300042876 | Bacteria | 16072 |
| 565 | Ga0466969_0067162 | 3300044656 | Bacteria | 1730 |
| 566 | Ga0466965_0144803 | 3300044683 | Bacteria | 1239 |
| 567 | Ga0466966_0003903 | 3300044684 | Bacteria | 9843 |
| 568 | Ga0453684_0101355 | 3300044712 | Bacteria | 3523 |
| 569 | Ga0453684_0233298 | 3300044712 | Bacteria | 2123 |
| 570 | Ga0466968_0019351 | 3300044735 | Bacteria | 2742 |
| 571 | Ga0451576_0006891 | 3300045051 | Bacteria | 13760 |
| 572 | Ga0451576_0031204 | 3300045051 | Bacteria | 5685 |
| 573 | Ga0451576_0066649 | 3300045051 | Bacteria | 3747 |
| 574 | Ga0451576_0170056 | 3300045051 | Bacteria | 2275 |
| 575 | Ga0466967_0580785 | 3300045976 | Bacteria | 1105 |
| 576 | Ga0495590_0023134 | 3300046457 | Bacteria | 2196 |
| 577 | Ga0495651_0107602 | 3300046462 | Bacteria | 2065 |
| 578 | Ga0495580_0046786 | 3300046472 | Bacteria | 3069 |
| 579 | Ga0495605_0051535 | 3300046474 | Bacteria | 2004 |
| 580 | Ga0495639_0141765 | 3300046475 | Bacteria | 1156 |
| 581 | Ga0495662_0010089 | 3300046476 | Bacteria | 4633 |
| 582 | Ga0495662_0082312 | 3300046476 | Bacteria | 1566 |
| 583 | Ga0495585_0093133 | 3300046492 | Bacteria | 1621 |
| 584 | Ga0495628_0113451 | 3300046516 | Bacteria | 2083 |
| 585 | Ga0495630_0006364 | 3300046517 | Bacteria | 8393 |
| 586 | Ga0495632_0011281 | 3300046519 | Bacteria | 5224 |
| 587 | Ga0495637_0023375 | 3300046520 | Bacteria | 2811 |
| 588 | Ga0495652_0353425 | 3300046529 | Bacteria | 1052 |
| 589 | Ga0495597_0011926 | 3300046542 | Bacteria | 4204 |
| 590 | Ga0495645_0042727 | 3300046543 | Bacteria | 3305 |
| 591 | Ga0495645_0096540 | 3300046543 | Bacteria | 2106 |
| 592 | Ga0495667_0042381 | 3300046559 | Bacteria | 3018 |
| 593 | Ga0495625_0046020 | 3300046660 | Bacteria | 3150 |
| 594 | Ga0495635_0104280 | 3300046663 | Bacteria | 1938 |
| 595 | Ga0495635_0113405 | 3300046663 | Bacteria | 1851 |
| 596 | Ga0495659_0012239 | 3300046664 | Bacteria | 2776 |
| 597 | Ga0495588_0048044 | 3300046674 | Bacteria | 2192 |
| 598 | Ga0495646_0072339 | 3300046680 | Bacteria | 2028 |
| 599 | Ga0495658_0005282 | 3300046683 | Bacteria | 6355 |
| 600 | Ga0495658_0056038 | 3300046683 | Bacteria | 2247 |
| 601 | Ga0495669_0010719 | 3300046684 | Bacteria | 3879 |
| 602 | Ga0495613_0116652 | 3300046689 | Bacteria | 1920 |
| 603 | Ga0495613_0138516 | 3300046689 | Bacteria | 1740 |
| 604 | Ga0495624_0027751 | 3300046690 | Bacteria | 3704 |
| 605 | Ga0495649_0000541 | 3300046694 | Bacteria | 32077 |
| 606 | Ga0495600_0041694 | 3300046809 | Bacteria | 2992 |
| 607 | Ga0495600_0258318 | 3300046809 | Bacteria | 1107 |
| 608 | Ga0495660_0037502 | 3300046810 | Bacteria | 2699 |
| 609 | Ga0495636_0017975 | 3300047318 | Bacteria | 2834 |
| 610 | Ga0495636_0052206 | 3300047318 | Bacteria | 1715 |
| 611 | Ga0495674_0096297 | 3300047319 | Bacteria | 2523 |
| 612 | Ga0495674_0194566 | 3300047319 | Bacteria | 1684 |
| 613 | Ga0495672_0042125 | 3300047320 | Bacteria | 2755 |
| 614 | Ga0495687_000174 | 3300047443 | Bacteria | 95031 |
| 615 | Ga0495677_0047183 | 3300047445 | Bacteria | 1581 |
| 616 | Ga0495686_0006540 | 3300047472 | Bacteria | 8894 |
| 617 | Ga0495602_0129132 | 3300048088 | Bacteria | 2019 |
| 618 | Ga0495626_0021987 | 3300048091 | Bacteria | 3155 |
| 619 | Ga0496100_0036459 | 3300048903 | Bacteria | 3102 |
| 620 | Ga0496100_0131429 | 3300048903 | Bacteria | 1764 |
| 621 | Ga0496101_0011006 | 3300048904 | Bacteria | 5993 |
| 622 | Ga0496102_0018381 | 3300048905 | Bacteria | 6142 |
| 623 | Ga0496102_0377375 | 3300048905 | Bacteria | 1334 |
| 624 | Ga0496102_0554357 | 3300048905 | Bacteria | 1072 |
| 625 | Ga0496103_0270195 | 3300048906 | Bacteria | 1094 |
| 626 | Ga0496104_0003573 | 3300048907 | Bacteria | 13420 |
| 627 | Ga0496104_0072463 | 3300048907 | Bacteria | 3276 |
| 628 | Ga0496104_0481520 | 3300048907 | Bacteria | 1152 |
| 629 | Ga0496106_0187932 | 3300048909 | Bacteria | 1641 |
| 630 | Ga0496106_0208169 | 3300048909 | Bacteria | 1558 |
| 631 | Ga0496106_0274454 | 3300048909 | Bacteria | 1350 |
| 632 | Ga0496107_0008481 | 3300048910 | Bacteria | 7114 |
| 633 | Ga0496108_0025297 | 3300048911 | Bacteria | 4891 |
| 634 | Ga0496108_0082335 | 3300048911 | Bacteria | 2729 |
| 635 | Ga0496109_0058844 | 3300048912 | Bacteria | 3510 |
| 636 | Ga0496110_0018001 | 3300048913 | Bacteria | 5918 |
| 637 | Ga0496110_0085623 | 3300048913 | Bacteria | 2813 |
| 638 | Ga0496110_0150426 | 3300048913 | Bacteria | 2108 |
| 639 | Ga0496110_0150933 | 3300048913 | Bacteria | 2104 |
| 640 | Ga0496111_0086443 | 3300048914 | Bacteria | 2294 |
| 641 | Ga0496112_0135103 | 3300048915 | Bacteria | 2437 |
| 642 | Ga0496112_0258202 | 3300048915 | Bacteria | 1692 |
| 643 | Ga0496114_0020230 | 3300048917 | Bacteria | 5401 |
| 644 | Ga0496114_0290254 | 3300048917 | Bacteria | 1443 |
| 645 | Ga0496114_0318261 | 3300048917 | Bacteria | 1375 |
| 646 | Ga0496115_0012118 | 3300048918 | Bacteria | 6483 |
| 647 | Ga0496115_0169936 | 3300048918 | Bacteria | 1803 |
| 648 | Ga0496115_0265233 | 3300048918 | Bacteria | 1412 |
| 649 | Ga0501034_0093439 | 3300049571 | Bacteria | 3004 |
| 650 | Ga0501040_0007117 | 3300049576 | Bacteria | 7244 |
| 651 | Ga0501042_0290360 | 3300049578 | Bacteria | 1181 |
| 652 | Ga0501043_0000149 | 3300049579 | Bacteria | 65122 |
| 653 | Ga0501046_0000092 | 3300049580 | Bacteria | 97456 |
| 654 | Ga0501046_0161104 | 3300049580 | Bacteria | 1687 |
| 655 | Ga0501047_0000028 | 3300049581 | Bacteria | 220279 |
| 656 | Ga0501047_0099445 | 3300049581 | Bacteria | 2788 |
| 657 | Ga0501048_0000097 | 3300049582 | Bacteria | 47728 |
| 658 | Ga0501070_0036022 | 3300049586 | Bacteria | 4132 |
| 659 | Ga0501071_0000638 | 3300049587 | Bacteria | 18217 |
| 660 | Ga0501071_0192928 | 3300049587 | Bacteria | 1528 |
| 661 | Ga0501072_0039243 | 3300049588 | Bacteria | 3718 |
| 662 | Ga0501074_0206978 | 3300049590 | Bacteria | 1398 |
| 663 | Ga0501075_0051262 | 3300049591 | Bacteria | 3103 |
| 664 | Ga0501075_0109391 | 3300049591 | Bacteria | 2101 |
| 665 | Ga0501076_0023976 | 3300049592 | Bacteria | 4710 |
| 666 | Ga0501076_0068664 | 3300049592 | Bacteria | 2831 |
| 667 | Ga0501079_0040802 | 3300049741 | Bacteria | 3582 |
| 668 | Ga0501080_0015068 | 3300049742 | Bacteria | 7125 |
| 669 | Ga0501080_0049394 | 3300049742 | Bacteria | 3915 |
| 670 | Ga0501080_0210890 | 3300049742 | Bacteria | 1780 |
| 671 | Ga0501081_0103777 | 3300049743 | Bacteria | 2012 |
| 672 | Ga0501083_0011934 | 3300049744 | Bacteria | 6087 |
| 673 | Ga0501035_0025466 | 3300049822 | Bacteria | 5424 |
| 674 | Ga0501044_0448564 | 3300049823 | Bacteria | 1197 |
| 675 | Ga0501045_0002894 | 3300049824 | Bacteria | 11731 |
| 676 | nmdc:mga03683_20389_c1 | 3300050489 | Bacteria | 2543 |
| 677 | nmdc:mga03n38_52854_c1 | 3300050490 | Bacteria | 1820 |
| 678 | nmdc:mga00v17_112445_c1 | 3300050491 | Bacteria | 1728 |
| 679 | nmdc:mga0k408_1076_c1 | 3300050493 | Bacteria | 15014 |
| 680 | nmdc:mga0k408_1264_c1 | 3300050493 | Bacteria | 13764 |
| 681 | nmdc:mga0k408_63487_c1 | 3300050493 | Bacteria | 2149 |
| 682 | nmdc:mga06z11_13801_c1 | 3300050494 | Bacteria | 3561 |
| 683 | nmdc:mga07m45_12274_c1 | 3300050496 | Bacteria | 4525 |
| 684 | nmdc:mga07m45_165924_c1 | 3300050496 | Bacteria | 1283 |
| 685 | nmdc:mga07m45_309_c1 | 3300050496 | Bacteria | 19711 |
| 686 | nmdc:mga07m45_37065_c1 | 3300050496 | Bacteria | 2719 |
| 687 | nmdc:mga07m45_756_c1 | 3300050496 | Bacteria | 13842 |
| 688 | nmdc:mga05p37_21838_c1 | 3300050507 | Bacteria | 7754 |
| 689 | nmdc:mga05p37_980_c1 | 3300050507 | Bacteria | 32442 |
| 690 | nmdc:mga09592_188883_c1 | 3300050508 | Bacteria | 1783 |
| 691 | nmdc:mga09592_352557_c1 | 3300050508 | Bacteria | 1273 |
| 692 | nmdc:mga09592_48847_c1 | 3300050508 | Bacteria | 3568 |
| 693 | nmdc:mga09592_947_c1 | 3300050508 | Bacteria | 22820 |
| 694 | nmdc:mga0qj67_705_c1 | 3300050509 | Bacteria | 22775 |
| 695 | nmdc:mga0qj67_9318_c1 | 3300050509 | Bacteria | 7302 |
| 696 | nmdc:mga06r32_2106_c1 | 3300050510 | Bacteria | 17820 |
| 697 | nmdc:mga06r32_318505_c1 | 3300050510 | Bacteria | 1541 |
| 698 | nmdc:mga06r32_48707_c1 | 3300050510 | Bacteria | 4051 |
| 699 | nmdc:mga06r32_78611_c1 | 3300050510 | Bacteria | 3207 |
| 700 | nmdc:mga08y16_365591_c1 | 3300050511 | Bacteria | 1481 |
| 701 | nmdc:mga08y16_667_c1 | 3300050511 | Bacteria | 32408 |
| 702 | nmdc:mga08y16_71819_c1 | 3300050511 | Bacteria | 3607 |
| 703 | nmdc:mga08y16_72879_c1 | 3300050511 | Bacteria | 3579 |
| 704 | nmdc:mga0n895_119372_c1 | 3300050512 | Bacteria | 2658 |
| 705 | nmdc:mga0n895_418421_c1 | 3300050512 | Bacteria | 1355 |
| 706 | nmdc:mga0n895_51200_c1 | 3300050512 | Bacteria | 4051 |
| 707 | nmdc:mga0n895_55158_c1 | 3300050512 | Bacteria | 3911 |
| 708 | nmdc:mga0n895_58125_c1 | 3300050512 | Bacteria | 3813 |
| 709 | nmdc:mga0rr50_173168_c1 | 3300050513 | Bacteria | 1760 |
| 710 | nmdc:mga0rr50_173434_c1 | 3300050513 | Bacteria | 1759 |
| 711 | nmdc:mga0rr50_17843_c1 | 3300050513 | Bacteria | 4752 |
| 712 | nmdc:mga0rr50_31256_c1 | 3300050513 | Bacteria | 3780 |
| 713 | nmdc:mga0rr50_340174_c1 | 3300050513 | Bacteria | 1261 |
| 714 | nmdc:mga0rr50_3812_c1 | 3300050513 | Bacteria | 8753 |
| 715 | nmdc:mga0rr50_38273_c1 | 3300050513 | Bacteria | 3469 |
| 716 | nmdc:mga08x19_157982_c1 | 3300050514 | Bacteria | 1539 |
| 717 | nmdc:mga08x19_166506_c1 | 3300050514 | Bacteria | 1499 |
| 718 | nmdc:mga08x19_56565_c1 | 3300050514 | Bacteria | 2532 |
| 719 | nmdc:mga08x19_81297_c1 | 3300050514 | Bacteria | 2128 |
| 720 | nmdc:mga0a205_329800_c1 | 3300050515 | Bacteria | 1396 |
| 721 | nmdc:mga0sz30_6627_c1 | 3300050516 | Bacteria | 4313 |
| 722 | Ga0495612_0097143 | 3300053078 | Bacteria | 1252 |
| 723 | Ga0495655_0042233 | 3300053083 | Bacteria | 1170 |
| 724 | Ga0495595_0019337 | 3300053084 | Bacteria | 2955 |
| 725 | Ga0495619_0024442 | 3300053085 | Bacteria | 3875 |
| 726 | Ga0500578_0075253 | 3300053086 | Bacteria | 2151 |
| 727 | Ga0500651_0132627 | 3300053093 | Bacteria | 1506 |
| 728 | Ga0500658_0005409 | 3300053134 | Bacteria | 4747 |
| 729 | Ga0500568_0010847 | 3300053139 | Bacteria | 4250 |
| 730 | Ga0501084_0104571 | 3300054114 | Bacteria | 2378 |
| 731 | Ga0501084_0273568 | 3300054114 | Bacteria | 1426 |
| 732 | Ga0590071_017498 | 3300059421 | Bacteria | 1684 |
| 733 | Ga0590077_003466 | 3300059426 | Bacteria | 3261 |
| 734 | Ga0501082_0054856 | 3300060353 | Bacteria | 3435 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_100173000 | Ga0070670_1001730002 | 254 |
| 2 | 3300053083 | Ga0495655_0042233 | Ga0495655_0042233_29_1036 | 255 |
| 3 | 3300035171 | Ga0373946_0123443 | Ga0373946_0123443_300_1169 | 266 |
| 4 | 3300039437 | Ga0436365_0316538 | Ga0436365_0316538_1542_2561 | 267 |
| 5 | 3300005719 | Ga0068861_100433721 | Ga0068861_1004337211 | 270 |
| 6 | 3300005841 | Ga0068863_100188712 | Ga0068863_1001887122 | 272 |
| 7 | 3300048917 | Ga0496114_0290254 | Ga0496114_0290254_402_1424 | 272 |
| 8 | 3300005545 | Ga0070695_100287097 | Ga0070695_1002870971 | 273 |
| 9 | 3300048913 | Ga0496110_0085623 | Ga0496110_0085623_302_1351 | 275 |
| 10 | 3300005347 | Ga0070668_100130216 | Ga0070668_1001302162 | 276 |
| 11 | 3300005719 | Ga0068861_100148714 | Ga0068861_1001487142 | 276 |
| 12 | 3300005844 | Ga0068862_100296552 | Ga0068862_1002965522 | 276 |
| 13 | 3300009148 | Ga0105243_10149966 | Ga0105243_101499661 | 276 |
| 14 | 3300025972 | Ga0207668_10079913 | Ga0207668_100799132 | 276 |
| 15 | 3300026118 | Ga0207675_100017362 | Ga0207675_1000173623 | 276 |
| 16 | 3300028380 | Ga0268265_10547374 | Ga0268265_105473741 | 276 |
| 17 | 3300050513 | nmdc:mga0rr50_3812_c1 | nmdc:mga0rr50_3812_c1_3906_4916 | 279 |
| 18 | 3300005335 | Ga0070666_10001889 | Ga0070666_100018897 | 281 |
| 19 | 3300005354 | Ga0070675_100002630 | Ga0070675_1000026307 | 281 |
| 20 | 3300005456 | Ga0070678_100020488 | Ga0070678_1000204883 | 281 |
| 21 | 3300005459 | Ga0068867_100088689 | Ga0068867_1000886892 | 281 |
| 22 | 3300005466 | Ga0070685_10091391 | Ga0070685_100913912 | 281 |
| 23 | 3300005618 | Ga0068864_100001309 | Ga0068864_10000130915 | 281 |
| 24 | 3300005841 | Ga0068863_100013734 | Ga0068863_1000137344 | 281 |
| 25 | 3300005842 | Ga0068858_100002892 | Ga0068858_10000289210 | 281 |
| 26 | 3300006237 | Ga0097621_100048088 | Ga0097621_1000480882 | 281 |
| 27 | 3300009177 | Ga0105248_10079168 | Ga0105248_100791683 | 281 |
| 28 | 3300013296 | Ga0157374_10096546 | Ga0157374_100965462 | 281 |
| 29 | 3300013306 | Ga0163162_10036523 | Ga0163162_100365234 | 281 |
| 30 | 3300014325 | Ga0163163_10001922 | Ga0163163_1000192212 | 281 |
| 31 | 3300014745 | Ga0157377_10094696 | Ga0157377_100946962 | 281 |
| 32 | 3300014968 | Ga0157379_10037589 | Ga0157379_100375893 | 281 |
| 33 | 3300025903 | Ga0207680_10046236 | Ga0207680_100462362 | 281 |
| 34 | 3300025907 | Ga0207645_10047244 | Ga0207645_100472442 | 281 |
| 35 | 3300025926 | Ga0207659_10008930 | Ga0207659_100089303 | 281 |
| 36 | 3300025931 | Ga0207644_10012106 | Ga0207644_100121065 | 281 |
| 37 | 3300025941 | Ga0207711_10037273 | Ga0207711_100372733 | 281 |
| 38 | 3300025960 | Ga0207651_10005549 | Ga0207651_100055495 | 281 |
| 39 | 3300025986 | Ga0207658_10051683 | Ga0207658_100516832 | 281 |
| 40 | 3300026088 | Ga0207641_10020481 | Ga0207641_100204815 | 281 |
| 41 | 3300026089 | Ga0207648_10021486 | Ga0207648_100214862 | 281 |
| 42 | 3300026095 | Ga0207676_10005019 | Ga0207676_100050194 | 281 |
| 43 | 3300026121 | Ga0207683_10007125 | Ga0207683_100071256 | 281 |
| 44 | 3300026142 | Ga0207698_10013120 | Ga0207698_100131203 | 281 |
| 45 | 3300048913 | Ga0496110_0150426 | Ga0496110_0150426_64_1083 | 281 |
| 46 | 3300005355 | Ga0070671_100021081 | Ga0070671_1000210813 | 283 |
| 47 | 3300025901 | Ga0207688_10040003 | Ga0207688_100400032 | 283 |
| 48 | 3300025907 | Ga0207645_10004810 | Ga0207645_100048107 | 284 |
| 49 | 3300048913 | Ga0496110_0150933 | Ga0496110_0150933_679_1686 | 284 |
| 50 | 3300048915 | Ga0496112_0135103 | Ga0496112_0135103_940_1947 | 284 |
| 51 | 3300005563 | Ga0068855_100009666 | Ga0068855_1000096665 | 285 |
| 52 | 3300006051 | Ga0075364_10127340 | Ga0075364_101273402 | 285 |
| 53 | 3300006353 | Ga0075370_10042799 | Ga0075370_100427992 | 285 |
| 54 | 3300009093 | Ga0105240_10012681 | Ga0105240_100126815 | 285 |
| 55 | 3300013308 | Ga0157375_10353880 | Ga0157375_103538802 | 285 |
| 56 | 3300025908 | Ga0207643_10071694 | Ga0207643_100716942 | 285 |
| 57 | 3300025913 | Ga0207695_10005984 | Ga0207695_100059845 | 285 |
| 58 | 3300025937 | Ga0207669_10140045 | Ga0207669_101400452 | 285 |
| 59 | 3300025949 | Ga0207667_10003540 | Ga0207667_1000354016 | 285 |
| 60 | 3300031824 | Ga0307413_10068531 | Ga0307413_100685311 | 285 |
| 61 | 3300046474 | Ga0495605_0051535 | Ga0495605_0051535_824_1807 | 285 |
| 62 | 3300046519 | Ga0495632_0011281 | Ga0495632_0011281_188_1171 | 285 |
| 63 | 3300046694 | Ga0495649_0000541 | Ga0495649_0000541_4171_5154 | 285 |
| 64 | 3300046809 | Ga0495600_0258318 | Ga0495600_0258318_25_1044 | 285 |
| 65 | 3300046810 | Ga0495660_0037502 | Ga0495660_0037502_1706_2689 | 285 |
| 66 | 3300050491 | nmdc:mga00v17_112445_c1 | nmdc:mga00v17_112445_c1_531_1538 | 285 |
| 67 | 3300050496 | nmdc:mga07m45_37065_c1 | nmdc:mga07m45_37065_c1_175_1182 | 285 |
| 68 | 3300053084 | Ga0495595_0019337 | Ga0495595_0019337_1342_2361 | 285 |
| 69 | 3300053085 | Ga0495619_0024442 | Ga0495619_0024442_2191_3210 | 285 |
| 70 | 3300053093 | Ga0500651_0132627 | Ga0500651_0132627_188_1171 | 285 |
| 71 | 3300053134 | Ga0500658_0005409 | Ga0500658_0005409_1601_2584 | 285 |
| 72 | 3300005353 | Ga0070669_100161509 | Ga0070669_1001615092 | 286 |
| 73 | 3300005457 | Ga0070662_100394058 | Ga0070662_1003940581 | 286 |
| 74 | 3300005459 | Ga0068867_100327287 | Ga0068867_1003272871 | 286 |
| 75 | 3300005719 | Ga0068861_100186909 | Ga0068861_1001869091 | 286 |
| 76 | 3300009553 | Ga0105249_10199009 | Ga0105249_101990092 | 286 |
| 77 | 3300015683 | Ga0183362_10015 | Ga0183362_1001515 | 286 |
| 78 | 3300017792 | Ga0163161_10013748 | Ga0163161_100137484 | 286 |
| 79 | 3300025940 | Ga0207691_10013009 | Ga0207691_100130092 | 286 |
| 80 | 3300025972 | Ga0207668_10097137 | Ga0207668_100971372 | 286 |
| 81 | 3300026089 | Ga0207648_10209817 | Ga0207648_102098171 | 286 |
| 82 | 3300006353 | Ga0075370_10004740 | Ga0075370_100047401 | 287 |
| 83 | 3300009147 | Ga0114129_10589906 | Ga0114129_105899061 | 287 |
| 84 | 3300039438 | Ga0436360_1357442 | Ga0436360_1357442_82_1110 | 287 |
| 85 | 3300042439 | Ga0439464_0002254 | Ga0439464_0002254_1339_2361 | 287 |
| 86 | 3300045051 | Ga0451576_0031204 | Ga0451576_0031204_343_1389 | 287 |
| 87 | 3300050493 | nmdc:mga0k408_1264_c1 | nmdc:mga0k408_1264_c1_6095_7084 | 287 |
| 88 | 3300050496 | nmdc:mga07m45_309_c1 | nmdc:mga07m45_309_c1_3439_4428 | 287 |
| 89 | 3300005331 | Ga0070670_100009195 | Ga0070670_1000091955 | 288 |
| 90 | 3300005333 | Ga0070677_10017059 | Ga0070677_100170592 | 288 |
| 91 | 3300005354 | Ga0070675_100061955 | Ga0070675_1000619551 | 288 |
| 92 | 3300005367 | Ga0070667_100093719 | Ga0070667_1000937192 | 288 |
| 93 | 3300005456 | Ga0070678_100012645 | Ga0070678_1000126453 | 288 |
| 94 | 3300005466 | Ga0070685_10114797 | Ga0070685_101147972 | 288 |
| 95 | 3300005543 | Ga0070672_100055033 | Ga0070672_1000550334 | 288 |
| 96 | 3300005564 | Ga0070664_100053624 | Ga0070664_1000536243 | 288 |
| 97 | 3300005841 | Ga0068863_100444600 | Ga0068863_1004446002 | 288 |
| 98 | 3300006237 | Ga0097621_100201581 | Ga0097621_1002015812 | 288 |
| 99 | 3300006358 | Ga0068871_100071329 | Ga0068871_1000713293 | 288 |
| 100 | 3300013306 | Ga0163162_10193531 | Ga0163162_101935312 | 288 |
| 101 | 3300025923 | Ga0207681_10053922 | Ga0207681_100539223 | 288 |
| 102 | 3300025925 | Ga0207650_10025290 | Ga0207650_100252902 | 288 |
| 103 | 3300025926 | Ga0207659_10011014 | Ga0207659_100110143 | 288 |
| 104 | 3300025933 | Ga0207706_10125307 | Ga0207706_101253072 | 288 |
| 105 | 3300025937 | Ga0207669_10072356 | Ga0207669_100723563 | 288 |
| 106 | 3300025940 | Ga0207691_10001243 | Ga0207691_1000124321 | 288 |
| 107 | 3300025945 | Ga0207679_10028238 | Ga0207679_100282382 | 288 |
| 108 | 3300025960 | Ga0207651_10405566 | Ga0207651_104055662 | 288 |
| 109 | 3300026089 | Ga0207648_10014429 | Ga0207648_100144295 | 288 |
| 110 | 3300026095 | Ga0207676_10035996 | Ga0207676_100359962 | 288 |
| 111 | 3300026121 | Ga0207683_10004763 | Ga0207683_100047633 | 288 |
| 112 | 3300026142 | Ga0207698_10136283 | Ga0207698_101362832 | 288 |
| 113 | 3300032002 | Ga0307416_100360565 | Ga0307416_1003605652 | 289 |
| 114 | 3300046660 | Ga0495625_0046020 | Ga0495625_0046020_96_1079 | 289 |
| 115 | 3300049579 | Ga0501043_0000149 | Ga0501043_0000149_21952_22962 | 289 |
| 116 | 3300049580 | Ga0501046_0000092 | Ga0501046_0000092_42297_43307 | 289 |
| 117 | 3300049581 | Ga0501047_0000028 | Ga0501047_0000028_197492_198502 | 289 |
| 118 | 3300049582 | Ga0501048_0000097 | Ga0501048_0000097_21346_22356 | 289 |
| 119 | 3300049823 | Ga0501044_0448564 | Ga0501044_0448564_117_1127 | 289 |
| 120 | 3300049824 | Ga0501045_0002894 | Ga0501045_0002894_3753_4763 | 289 |
| 121 | 3300009147 | Ga0114129_10386532 | Ga0114129_103865322 | 290 |
| 122 | 3300028786 | Ga0307517_10142582 | Ga0307517_101425822 | 290 |
| 123 | 3300038996 | Ga0242420_023590 | Ga0242420_023590_210_1097 | 290 |
| 124 | 3300046457 | Ga0495590_0023134 | Ga0495590_0023134_94_1077 | 290 |
| 125 | 3300050508 | nmdc:mga09592_188883_c1 | nmdc:mga09592_188883_c1_653_1660 | 290 |
| 126 | 3300050510 | nmdc:mga06r32_78611_c1 | nmdc:mga06r32_78611_c1_801_1808 | 290 |
| 127 | 3300053086 | Ga0500578_0075253 | Ga0500578_0075253_266_1249 | 290 |
| 128 | 3300013296 | Ga0157374_10277089 | Ga0157374_102770891 | 291 |
| 129 | 3300005340 | Ga0070689_100228459 | Ga0070689_1002284592 | 292 |
| 130 | 3300005577 | Ga0068857_100198475 | Ga0068857_1001984752 | 292 |
| 131 | 3300005617 | Ga0068859_100029524 | Ga0068859_1000295244 | 292 |
| 132 | 3300006177 | Ga0075362_10002737 | Ga0075362_100027375 | 292 |
| 133 | 3300006931 | Ga0097620_100029524 | Ga0097620_1000295244 | 292 |
| 134 | 3300009545 | Ga0105237_10020953 | Ga0105237_100209533 | 292 |
| 135 | 3300010375 | Ga0105239_10018223 | Ga0105239_100182235 | 292 |
| 136 | 3300025903 | Ga0207680_10235994 | Ga0207680_102359941 | 292 |
| 137 | 3300025914 | Ga0207671_10011567 | Ga0207671_100115673 | 292 |
| 138 | 3300025933 | Ga0207706_10136371 | Ga0207706_101363712 | 292 |
| 139 | 3300025936 | Ga0207670_10178150 | Ga0207670_101781502 | 292 |
| 140 | 3300026067 | Ga0207678_10089334 | Ga0207678_100893342 | 292 |
| 141 | 3300026116 | Ga0207674_10212931 | Ga0207674_102129312 | 292 |
| 142 | 3300031852 | Ga0307410_10050243 | Ga0307410_100502432 | 292 |
| 143 | 3300031852 | Ga0307410_10147739 | Ga0307410_101477392 | 292 |
| 144 | 3300031995 | Ga0307409_100125173 | Ga0307409_1001251732 | 292 |
| 145 | 3300032002 | Ga0307416_100056487 | Ga0307416_1000564872 | 292 |
| 146 | 3300032004 | Ga0307414_10243690 | Ga0307414_102436902 | 292 |
| 147 | 3300050489 | nmdc:mga03683_20389_c1 | nmdc:mga03683_20389_c1_125_1117 | 292 |
| 148 | 3300048909 | Ga0496106_0274454 | Ga0496106_0274454_11_931 | 293 |
| 149 | 3300005367 | Ga0070667_100165616 | Ga0070667_1001656162 | 294 |
| 150 | 3300025942 | Ga0207689_10079102 | Ga0207689_100791023 | 294 |
| 151 | 3300035724 | Ga0373933_0096400 | Ga0373933_0096400_874_1821 | 294 |
| 152 | 3300006058 | Ga0075432_10035439 | Ga0075432_100354392 | 295 |
| 153 | 3300009094 | Ga0111539_10006412 | Ga0111539_1000641210 | 295 |
| 154 | 3300027907 | Ga0207428_10000027 | Ga0207428_10000027111 | 295 |
| 155 | 3300031548 | Ga0307408_100096580 | Ga0307408_1000965802 | 295 |
| 156 | 3300047472 | Ga0495686_0006540 | Ga0495686_0006540_4439_5452 | 295 |
| 157 | 3300050511 | nmdc:mga08y16_667_c1 | nmdc:mga08y16_667_c1_27884_28888 | 295 |
| 158 | 3300031730 | Ga0307516_10103018 | Ga0307516_101030182 | 296 |
| 159 | 3300042001 | Ga0439441_011880 | Ga0439441_011880_240_1199 | 296 |
| 160 | 3300042012 | Ga0439455_0016111 | Ga0439455_0016111_195_1196 | 296 |
| 161 | 3300048903 | Ga0496100_0131429 | Ga0496100_0131429_220_1227 | 296 |
| 162 | 3300048907 | Ga0496104_0003573 | Ga0496104_0003573_1619_2626 | 296 |
| 163 | 3300048915 | Ga0496112_0258202 | Ga0496112_0258202_381_1388 | 296 |
| 164 | 3300048917 | Ga0496114_0318261 | Ga0496114_0318261_68_1075 | 296 |
| 165 | 3300048918 | Ga0496115_0169936 | Ga0496115_0169936_498_1505 | 296 |
| 166 | 3300053139 | Ga0500568_0010847 | Ga0500568_0010847_1472_2461 | 296 |
| 167 | 3300005338 | Ga0068868_100120478 | Ga0068868_1001204782 | 297 |
| 168 | 3300006195 | Ga0075366_10086166 | Ga0075366_100861661 | 297 |
| 169 | 3300041410 | Ga0439461_0002114 | Ga0439461_0002114_1664_2659 | 297 |
| 170 | 3300042156 | Ga0439446_0001858 | Ga0439446_0001858_656_1651 | 297 |
| 171 | 3300042436 | Ga0439435_0000049 | Ga0439435_0000049_3139_4134 | 297 |
| 172 | 3300049591 | Ga0501075_0109391 | Ga0501075_0109391_186_1193 | 297 |
| 173 | 3300049592 | Ga0501076_0023976 | Ga0501076_0023976_2522_3529 | 297 |
| 174 | 3300005467 | Ga0070706_100184916 | Ga0070706_1001849162 | 298 |
| 175 | 3300005468 | Ga0070707_100337339 | Ga0070707_1003373392 | 298 |
| 176 | 3300025910 | Ga0207684_10084097 | Ga0207684_100840972 | 298 |
| 177 | 3300025922 | Ga0207646_10456748 | Ga0207646_104567482 | 298 |
| 178 | 3300032005 | Ga0307411_10361896 | Ga0307411_103618961 | 298 |
| 179 | 3300035083 | Ga0373926_0011382 | Ga0373926_0011382_367_1467 | 298 |
| 180 | 3300035725 | Ga0373947_0088309 | Ga0373947_0088309_283_1383 | 298 |
| 181 | 3300005331 | Ga0070670_100142133 | Ga0070670_1001421332 | 299 |
| 182 | 3300005444 | Ga0070694_100005593 | Ga0070694_1000055936 | 299 |
| 183 | 3300005457 | Ga0070662_100171509 | Ga0070662_1001715092 | 299 |
| 184 | 3300005459 | Ga0068867_100051748 | Ga0068867_1000517482 | 299 |
| 185 | 3300005545 | Ga0070695_100019186 | Ga0070695_1000191863 | 299 |
| 186 | 3300006048 | Ga0075363_100130919 | Ga0075363_1001309191 | 299 |
| 187 | 3300006051 | Ga0075364_10168113 | Ga0075364_101681132 | 299 |
| 188 | 3300006178 | Ga0075367_10125329 | Ga0075367_101253292 | 299 |
| 189 | 3300006195 | Ga0075366_10039304 | Ga0075366_100393042 | 299 |
| 190 | 3300014969 | Ga0157376_10028875 | Ga0157376_100288755 | 299 |
| 191 | 3300025933 | Ga0207706_10057558 | Ga0207706_100575583 | 299 |
| 192 | 3300025935 | Ga0207709_10010795 | Ga0207709_100107956 | 299 |
| 193 | 3300026089 | Ga0207648_10017778 | Ga0207648_100177782 | 299 |
| 194 | 3300049576 | Ga0501040_0007117 | Ga0501040_0007117_4204_5178 | 299 |
| 195 | 3300050493 | nmdc:mga0k408_63487_c1 | nmdc:mga0k408_63487_c1_910_1962 | 299 |
| 196 | 3300050496 | nmdc:mga07m45_165924_c1 | nmdc:mga07m45_165924_c1_10_1062 | 299 |
| 197 | 3300059421 | Ga0590071_017498 | Ga0590071_017498_159_1166 | 299 |
| 198 | 3300005439 | Ga0070711_100059630 | Ga0070711_1000596302 | 300 |
| 199 | 3300005718 | Ga0068866_10131322 | Ga0068866_101313222 | 300 |
| 200 | 3300006175 | Ga0070712_100074571 | Ga0070712_1000745713 | 300 |
| 201 | 3300009098 | Ga0105245_10223471 | Ga0105245_102234712 | 300 |
| 202 | 3300025927 | Ga0207687_10136411 | Ga0207687_101364112 | 300 |
| 203 | 3300026116 | Ga0207674_10322838 | Ga0207674_103228382 | 300 |
| 204 | 3300045976 | Ga0466967_0580785 | Ga0466967_0580785_122_1039 | 300 |
| 205 | 3300046529 | Ga0495652_0353425 | Ga0495652_0353425_51_1010 | 300 |
| 206 | 3300048905 | Ga0496102_0377375 | Ga0496102_0377375_213_1220 | 300 |
| 207 | 3300048918 | Ga0496115_0265233 | Ga0496115_0265233_102_1109 | 300 |
| 208 | 3300049581 | Ga0501047_0099445 | Ga0501047_0099445_1227_2237 | 300 |
| 209 | 3300045051 | Ga0451576_0170056 | Ga0451576_0170056_594_1553 | 301 |
| 210 | 3300046462 | Ga0495651_0107602 | Ga0495651_0107602_406_1353 | 301 |
| 211 | 3300025949 | Ga0207667_10014242 | Ga0207667_100142425 | 303 |
| 212 | 3300031691 | Ga0316579_10005426 | Ga0316579_100054264 | 303 |
| 213 | 3300032133 | Ga0316583_10009254 | Ga0316583_100092543 | 303 |
| 214 | 3300036647 | Ga0316582_0007634 | Ga0316582_0007634_3021_4043 | 303 |
| 215 | 3300005718 | Ga0068866_10044520 | Ga0068866_100445202 | 304 |
| 216 | 3300025937 | Ga0207669_10018826 | Ga0207669_100188263 | 304 |
| 217 | 3300028380 | Ga0268265_10313384 | Ga0268265_103133842 | 305 |
| 218 | 3300048907 | Ga0496104_0481520 | Ga0496104_0481520_166_1131 | 305 |
| 219 | 3300005331 | Ga0070670_100068783 | Ga0070670_1000687833 | 306 |
| 220 | 3300005545 | Ga0070695_100101915 | Ga0070695_1001019152 | 306 |
| 221 | 3300025925 | Ga0207650_10028679 | Ga0207650_100286792 | 306 |
| 222 | 3300031730 | Ga0307516_10046141 | Ga0307516_100461413 | 306 |
| 223 | 3300005458 | Ga0070681_10012298 | Ga0070681_100122988 | 307 |
| 224 | 3300005536 | Ga0070697_100038033 | Ga0070697_1000380332 | 307 |
| 225 | 3300005549 | Ga0070704_100038987 | Ga0070704_1000389873 | 307 |
| 226 | 3300006038 | Ga0075365_10053369 | Ga0075365_100533692 | 307 |
| 227 | 3300014968 | Ga0157379_10344064 | Ga0157379_103440642 | 307 |
| 228 | 3300035241 | Ga0373961_0005571 | Ga0373961_0005571_704_1654 | 307 |
| 229 | 3300046684 | Ga0495669_0010719 | Ga0495669_0010719_1519_2454 | 307 |
| 230 | 3300005331 | Ga0070670_100375779 | Ga0070670_1003757791 | 308 |
| 231 | 3300005365 | Ga0070688_100026960 | Ga0070688_1000269602 | 308 |
| 232 | 3300005367 | Ga0070667_100091932 | Ga0070667_1000919322 | 308 |
| 233 | 3300005543 | Ga0070672_100051990 | Ga0070672_1000519903 | 308 |
| 234 | 3300005617 | Ga0068859_100232145 | Ga0068859_1002321452 | 308 |
| 235 | 3300005618 | Ga0068864_100142059 | Ga0068864_1001420592 | 308 |
| 236 | 3300006237 | Ga0097621_100192298 | Ga0097621_1001922982 | 308 |
| 237 | 3300006358 | Ga0068871_100091740 | Ga0068871_1000917402 | 308 |
| 238 | 3300006931 | Ga0097620_100232124 | Ga0097620_1002321242 | 308 |
| 239 | 3300011119 | Ga0105246_10419917 | Ga0105246_104199171 | 308 |
| 240 | 3300013296 | Ga0157374_10370832 | Ga0157374_103708322 | 308 |
| 241 | 3300025907 | Ga0207645_10019748 | Ga0207645_100197484 | 308 |
| 242 | 3300025925 | Ga0207650_10260510 | Ga0207650_102605102 | 308 |
| 243 | 3300025931 | Ga0207644_10213506 | Ga0207644_102135062 | 308 |
| 244 | 3300025936 | Ga0207670_10090548 | Ga0207670_100905482 | 308 |
| 245 | 3300025942 | Ga0207689_10043050 | Ga0207689_100430504 | 308 |
| 246 | 3300026089 | Ga0207648_10041166 | Ga0207648_100411663 | 308 |
| 247 | 3300026095 | Ga0207676_10030963 | Ga0207676_100309633 | 308 |
| 248 | 3300026118 | Ga0207675_100076660 | Ga0207675_1000766602 | 308 |
| 249 | 3300046475 | Ga0495639_0141765 | Ga0495639_0141765_135_1076 | 308 |
| 250 | 3300046476 | Ga0495662_0010089 | Ga0495662_0010089_765_1706 | 308 |
| 251 | 3300046516 | Ga0495628_0113451 | Ga0495628_0113451_203_1144 | 308 |
| 252 | 3300046517 | Ga0495630_0006364 | Ga0495630_0006364_5991_6932 | 308 |
| 253 | 3300046690 | Ga0495624_0027751 | Ga0495624_0027751_1679_2620 | 308 |
| 254 | 3300047318 | Ga0495636_0052206 | Ga0495636_0052206_21_1013 | 308 |
| 255 | 3300047319 | Ga0495674_0194566 | Ga0495674_0194566_569_1510 | 308 |
| 256 | 3300047445 | Ga0495677_0047183 | Ga0495677_0047183_634_1566 | 308 |
| 257 | 3300049586 | Ga0501070_0036022 | Ga0501070_0036022_774_1718 | 308 |
| 258 | 3300049742 | Ga0501080_0210890 | Ga0501080_0210890_630_1574 | 308 |
| 259 | 3300049744 | Ga0501083_0011934 | Ga0501083_0011934_3886_4830 | 308 |
| 260 | 3300050496 | nmdc:mga07m45_12274_c1 | nmdc:mga07m45_12274_c1_109_1245 | 308 |
| 261 | 3300050512 | nmdc:mga0n895_51200_c1 | nmdc:mga0n895_51200_c1_2940_3884 | 308 |
| 262 | 3300050513 | nmdc:mga0rr50_340174_c1 | nmdc:mga0rr50_340174_c1_97_1074 | 308 |
| 263 | 3300054114 | Ga0501084_0273568 | Ga0501084_0273568_149_1096 | 308 |
| 264 | 3300060353 | Ga0501082_0054856 | Ga0501082_0054856_614_1618 | 308 |
| 265 | 3300005334 | Ga0068869_100019219 | Ga0068869_1000192193 | 309 |
| 266 | 3300005336 | Ga0070680_100148819 | Ga0070680_1001488191 | 309 |
| 267 | 3300005353 | Ga0070669_100004770 | Ga0070669_10000477010 | 309 |
| 268 | 3300005440 | Ga0070705_100087470 | Ga0070705_1000874701 | 309 |
| 269 | 3300005441 | Ga0070700_100003507 | Ga0070700_1000035077 | 309 |
| 270 | 3300005441 | Ga0070700_100265184 | Ga0070700_1002651842 | 309 |
| 271 | 3300005459 | Ga0068867_100001086 | Ga0068867_1000010862 | 309 |
| 272 | 3300005544 | Ga0070686_100012900 | Ga0070686_1000129003 | 309 |
| 273 | 3300005615 | Ga0070702_100049806 | Ga0070702_1000498062 | 309 |
| 274 | 3300005719 | Ga0068861_100009341 | Ga0068861_1000093412 | 309 |
| 275 | 3300005843 | Ga0068860_100467608 | Ga0068860_1004676082 | 309 |
| 276 | 3300005844 | Ga0068862_100010767 | Ga0068862_1000107679 | 309 |
| 277 | 3300005844 | Ga0068862_100361354 | Ga0068862_1003613542 | 309 |
| 278 | 3300005985 | Ga0081539_10132285 | Ga0081539_101322852 | 309 |
| 279 | 3300006163 | Ga0070715_10039621 | Ga0070715_100396212 | 309 |
| 280 | 3300006844 | Ga0075428_100254586 | Ga0075428_1002545862 | 309 |
| 281 | 3300006844 | Ga0075428_100672709 | Ga0075428_1006727091 | 309 |
| 282 | 3300006847 | Ga0075431_100021141 | Ga0075431_1000211416 | 309 |
| 283 | 3300006847 | Ga0075431_100091893 | Ga0075431_1000918932 | 309 |
| 284 | 3300006852 | Ga0075433_10141798 | Ga0075433_101417983 | 309 |
| 285 | 3300006871 | Ga0075434_100049920 | Ga0075434_1000499203 | 309 |
| 286 | 3300006881 | Ga0068865_100023360 | Ga0068865_1000233603 | 309 |
| 287 | 3300007076 | Ga0075435_100001341 | Ga0075435_1000013416 | 309 |
| 288 | 3300007076 | Ga0075435_100037184 | Ga0075435_1000371845 | 309 |
| 289 | 3300007076 | Ga0075435_100195112 | Ga0075435_1001951121 | 309 |
| 290 | 3300009094 | Ga0111539_10038861 | Ga0111539_100388615 | 309 |
| 291 | 3300009094 | Ga0111539_10129330 | Ga0111539_101293302 | 309 |
| 292 | 3300009147 | Ga0114129_10015516 | Ga0114129_100155166 | 309 |
| 293 | 3300009148 | Ga0105243_10012737 | Ga0105243_100127372 | 309 |
| 294 | 3300009176 | Ga0105242_10205843 | Ga0105242_102058432 | 309 |
| 295 | 3300009553 | Ga0105249_10063386 | Ga0105249_100633862 | 309 |
| 296 | 3300014326 | Ga0157380_10013461 | Ga0157380_100134612 | 309 |
| 297 | 3300025908 | Ga0207643_10036858 | Ga0207643_100368583 | 309 |
| 298 | 3300025912 | Ga0207707_10007969 | Ga0207707_100079699 | 309 |
| 299 | 3300025917 | Ga0207660_10225371 | Ga0207660_102253712 | 309 |
| 300 | 3300025918 | Ga0207662_10205031 | Ga0207662_102050312 | 309 |
| 301 | 3300025921 | Ga0207652_10084697 | Ga0207652_100846972 | 309 |
| 302 | 3300025923 | Ga0207681_10039208 | Ga0207681_100392083 | 309 |
| 303 | 3300025935 | Ga0207709_10002954 | Ga0207709_100029542 | 309 |
| 304 | 3300025937 | Ga0207669_10034033 | Ga0207669_100340332 | 309 |
| 305 | 3300025938 | Ga0207704_10000959 | Ga0207704_1000095910 | 309 |
| 306 | 3300025972 | Ga0207668_10268237 | Ga0207668_102682372 | 309 |
| 307 | 3300026075 | Ga0207708_10012201 | Ga0207708_100122013 | 309 |
| 308 | 3300026089 | Ga0207648_10004422 | Ga0207648_100044226 | 309 |
| 309 | 3300026118 | Ga0207675_100003929 | Ga0207675_1000039296 | 309 |
| 310 | 3300027360 | Ga0209969_1000217 | Ga0209969_10002174 | 309 |
| 311 | 3300027364 | Ga0209967_1000307 | Ga0209967_10003074 | 309 |
| 312 | 3300027378 | Ga0209981_1001368 | Ga0209981_10013682 | 309 |
| 313 | 3300027462 | Ga0210000_1002801 | Ga0210000_10028012 | 309 |
| 314 | 3300027526 | Ga0209968_1001103 | Ga0209968_10011034 | 309 |
| 315 | 3300027543 | Ga0209999_1000946 | Ga0209999_10009465 | 309 |
| 316 | 3300027907 | Ga0207428_10036411 | Ga0207428_100364113 | 309 |
| 317 | 3300027907 | Ga0207428_10062275 | Ga0207428_100622753 | 309 |
| 318 | 3300027907 | Ga0207428_10108610 | Ga0207428_101086102 | 309 |
| 319 | 3300028380 | Ga0268265_10003470 | Ga0268265_1000347010 | 309 |
| 320 | 3300028380 | Ga0268265_10374043 | Ga0268265_103740432 | 309 |
| 321 | 3300035111 | Ga0373923_0061129 | Ga0373923_0061129_516_1460 | 309 |
| 322 | 3300035117 | Ga0373953_0063429 | Ga0373953_0063429_405_1349 | 309 |
| 323 | 3300035118 | Ga0373954_0000033 | Ga0373954_0000033_29452_30396 | 309 |
| 324 | 3300035118 | Ga0373954_0038525 | Ga0373954_0038525_681_1625 | 309 |
| 325 | 3300035119 | Ga0373956_0032194 | Ga0373956_0032194_1009_1953 | 309 |
| 326 | 3300035120 | Ga0373957_0013064 | Ga0373957_0013064_545_1489 | 309 |
| 327 | 3300035172 | Ga0373955_0021854 | Ga0373955_0021854_1163_2107 | 309 |
| 328 | 3300035410 | Ga0373924_0003359 | Ga0373924_0003359_4261_5205 | 309 |
| 329 | 3300035724 | Ga0373933_0002353 | Ga0373933_0002353_1972_2916 | 309 |
| 330 | 3300035724 | Ga0373933_0006414 | Ga0373933_0006414_2808_3752 | 309 |
| 331 | 3300035724 | Ga0373933_0121621 | Ga0373933_0121621_22_1038 | 309 |
| 332 | 3300036401 | Ga0373937_0000377 | Ga0373937_0000377_32813_33757 | 309 |
| 333 | 3300036401 | Ga0373937_0003134 | Ga0373937_0003134_5398_6342 | 309 |
| 334 | 3300036401 | Ga0373937_0028570 | Ga0373937_0028570_2209_3168 | 309 |
| 335 | 3300042876 | Ga0451577_0003923 | Ga0451577_0003923_2744_3739 | 309 |
| 336 | 3300044712 | Ga0453684_0101355 | Ga0453684_0101355_1910_2905 | 309 |
| 337 | 3300044712 | Ga0453684_0233298 | Ga0453684_0233298_673_1671 | 309 |
| 338 | 3300046543 | Ga0495645_0096540 | Ga0495645_0096540_218_1162 | 309 |
| 339 | 3300046559 | Ga0495667_0042381 | Ga0495667_0042381_1058_2002 | 309 |
| 340 | 3300046663 | Ga0495635_0104280 | Ga0495635_0104280_207_1223 | 309 |
| 341 | 3300046680 | Ga0495646_0072339 | Ga0495646_0072339_919_1863 | 309 |
| 342 | 3300046683 | Ga0495658_0005282 | Ga0495658_0005282_1526_2542 | 309 |
| 343 | 3300046689 | Ga0495613_0116652 | Ga0495613_0116652_300_1316 | 309 |
| 344 | 3300046809 | Ga0495600_0041694 | Ga0495600_0041694_1663_2607 | 309 |
| 345 | 3300047319 | Ga0495674_0096297 | Ga0495674_0096297_1409_2425 | 309 |
| 346 | 3300048088 | Ga0495602_0129132 | Ga0495602_0129132_243_1187 | 309 |
| 347 | 3300050507 | nmdc:mga05p37_21838_c1 | nmdc:mga05p37_21838_c1_2100_3047 | 309 |
| 348 | 3300050508 | nmdc:mga09592_352557_c1 | nmdc:mga09592_352557_c1_101_1048 | 309 |
| 349 | 3300050509 | nmdc:mga0qj67_705_c1 | nmdc:mga0qj67_705_c1_19011_19958 | 309 |
| 350 | 3300050510 | nmdc:mga06r32_318505_c1 | nmdc:mga06r32_318505_c1_492_1439 | 309 |
| 351 | 3300050510 | nmdc:mga06r32_48707_c1 | nmdc:mga06r32_48707_c1_1254_2201 | 309 |
| 352 | 3300050511 | nmdc:mga08y16_365591_c1 | nmdc:mga08y16_365591_c1_117_1064 | 309 |
| 353 | 3300050511 | nmdc:mga08y16_71819_c1 | nmdc:mga08y16_71819_c1_1710_2654 | 309 |
| 354 | 3300050511 | nmdc:mga08y16_72879_c1 | nmdc:mga08y16_72879_c1_1523_2467 | 309 |
| 355 | 3300050512 | nmdc:mga0n895_55158_c1 | nmdc:mga0n895_55158_c1_319_1263 | 309 |
| 356 | 3300050512 | nmdc:mga0n895_58125_c1 | nmdc:mga0n895_58125_c1_1122_2069 | 309 |
| 357 | 3300050513 | nmdc:mga0rr50_173168_c1 | nmdc:mga0rr50_173168_c1_752_1696 | 309 |
| 358 | 3300050513 | nmdc:mga0rr50_31256_c1 | nmdc:mga0rr50_31256_c1_1988_2935 | 309 |
| 359 | 3300050514 | nmdc:mga08x19_56565_c1 | nmdc:mga08x19_56565_c1_1067_2014 | 309 |
| 360 | 3300053078 | Ga0495612_0097143 | Ga0495612_0097143_131_1147 | 309 |
| 361 | 3300005336 | Ga0070680_100035618 | Ga0070680_1000356183 | 310 |
| 362 | 3300005336 | Ga0070680_100080743 | Ga0070680_1000807432 | 310 |
| 363 | 3300005440 | Ga0070705_100099966 | Ga0070705_1000999662 | 310 |
| 364 | 3300005444 | Ga0070694_100008469 | Ga0070694_1000084696 | 310 |
| 365 | 3300005458 | Ga0070681_10009509 | Ga0070681_100095095 | 310 |
| 366 | 3300005458 | Ga0070681_10022535 | Ga0070681_100225354 | 310 |
| 367 | 3300005530 | Ga0070679_100004740 | Ga0070679_1000047407 | 310 |
| 368 | 3300005530 | Ga0070679_100008970 | Ga0070679_1000089708 | 310 |
| 369 | 3300005530 | Ga0070679_100458460 | Ga0070679_1004584602 | 310 |
| 370 | 3300005545 | Ga0070695_100108643 | Ga0070695_1001086432 | 310 |
| 371 | 3300005546 | Ga0070696_100071825 | Ga0070696_1000718252 | 310 |
| 372 | 3300005563 | Ga0068855_100004439 | Ga0068855_10000443914 | 310 |
| 373 | 3300005617 | Ga0068859_100007812 | Ga0068859_1000078125 | 310 |
| 374 | 3300006847 | Ga0075431_100009047 | Ga0075431_1000090474 | 310 |
| 375 | 3300006880 | Ga0075429_100000638 | Ga0075429_10000063821 | 310 |
| 376 | 3300006914 | Ga0075436_100122725 | Ga0075436_1001227251 | 310 |
| 377 | 3300006931 | Ga0097620_100007812 | Ga0097620_1000078125 | 310 |
| 378 | 3300007788 | Ga0099795_10030113 | Ga0099795_100301132 | 310 |
| 379 | 3300009093 | Ga0105240_10031668 | Ga0105240_100316688 | 310 |
| 380 | 3300009093 | Ga0105240_10100319 | Ga0105240_101003193 | 310 |
| 381 | 3300009147 | Ga0114129_10007443 | Ga0114129_100074437 | 310 |
| 382 | 3300009176 | Ga0105242_10132848 | Ga0105242_101328482 | 310 |
| 383 | 3300009551 | Ga0105238_10030346 | Ga0105238_100303463 | 310 |
| 384 | 3300013104 | Ga0157370_10033935 | Ga0157370_100339354 | 310 |
| 385 | 3300013104 | Ga0157370_10037271 | Ga0157370_100372712 | 310 |
| 386 | 3300025909 | Ga0207705_10027375 | Ga0207705_100273752 | 310 |
| 387 | 3300025912 | Ga0207707_10008127 | Ga0207707_100081277 | 310 |
| 388 | 3300025915 | Ga0207693_10219308 | Ga0207693_102193081 | 310 |
| 389 | 3300025919 | Ga0207657_10028298 | Ga0207657_100282984 | 310 |
| 390 | 3300025921 | Ga0207652_10033083 | Ga0207652_100330833 | 310 |
| 391 | 3300025921 | Ga0207652_10049017 | Ga0207652_100490172 | 310 |
| 392 | 3300025921 | Ga0207652_10189807 | Ga0207652_101898072 | 310 |
| 393 | 3300025924 | Ga0207694_10160138 | Ga0207694_101601382 | 310 |
| 394 | 3300025927 | Ga0207687_10085226 | Ga0207687_100852262 | 310 |
| 395 | 3300025934 | Ga0207686_10006662 | Ga0207686_100066627 | 310 |
| 396 | 3300025939 | Ga0207665_10002514 | Ga0207665_100025147 | 310 |
| 397 | 3300036401 | Ga0373937_0055460 | Ga0373937_0055460_1834_2829 | 310 |
| 398 | 3300045051 | Ga0451576_0006891 | Ga0451576_0006891_4095_5054 | 310 |
| 399 | 3300046492 | Ga0495585_0093133 | Ga0495585_0093133_625_1599 | 310 |
| 400 | 3300046520 | Ga0495637_0023375 | Ga0495637_0023375_1221_2219 | 310 |
| 401 | 3300047318 | Ga0495636_0017975 | Ga0495636_0017975_791_1768 | 310 |
| 402 | 3300047320 | Ga0495672_0042125 | Ga0495672_0042125_15_974 | 310 |
| 403 | 3300048091 | Ga0495626_0021987 | Ga0495626_0021987_594_1592 | 310 |
| 404 | 3300048905 | Ga0496102_0554357 | Ga0496102_0554357_25_1023 | 310 |
| 405 | 3300048906 | Ga0496103_0270195 | Ga0496103_0270195_44_1042 | 310 |
| 406 | 3300048909 | Ga0496106_0208169 | Ga0496106_0208169_366_1364 | 310 |
| 407 | 3300048911 | Ga0496108_0082335 | Ga0496108_0082335_621_1619 | 310 |
| 408 | 3300049578 | Ga0501042_0290360 | Ga0501042_0290360_62_1033 | 310 |
| 409 | 3300049587 | Ga0501071_0000638 | Ga0501071_0000638_3073_4044 | 310 |
| 410 | 3300049588 | Ga0501072_0039243 | Ga0501072_0039243_1211_2182 | 310 |
| 411 | 3300049591 | Ga0501075_0051262 | Ga0501075_0051262_1693_2664 | 310 |
| 412 | 3300049592 | Ga0501076_0068664 | Ga0501076_0068664_1177_2148 | 310 |
| 413 | 3300049741 | Ga0501079_0040802 | Ga0501079_0040802_914_1885 | 310 |
| 414 | 3300049742 | Ga0501080_0049394 | Ga0501080_0049394_1042_2013 | 310 |
| 415 | 3300049743 | Ga0501081_0103777 | Ga0501081_0103777_923_1894 | 310 |
| 416 | 3300050507 | nmdc:mga05p37_980_c1 | nmdc:mga05p37_980_c1_21063_22022 | 310 |
| 417 | 3300050508 | nmdc:mga09592_947_c1 | nmdc:mga09592_947_c1_5725_6684 | 310 |
| 418 | 3300050510 | nmdc:mga06r32_2106_c1 | nmdc:mga06r32_2106_c1_10790_11749 | 310 |
| 419 | 3300050514 | nmdc:mga08x19_157982_c1 | nmdc:mga08x19_157982_c1_511_1482 | 310 |
| 420 | 3300050514 | nmdc:mga08x19_81297_c1 | nmdc:mga08x19_81297_c1_343_1314 | 310 |
| 421 | 3300054114 | Ga0501084_0104571 | Ga0501084_0104571_1148_2119 | 310 |
| 422 | 3300005328 | Ga0070676_10008106 | Ga0070676_100081065 | 311 |
| 423 | 3300005330 | Ga0070690_100005969 | Ga0070690_1000059693 | 311 |
| 424 | 3300005331 | Ga0070670_100222170 | Ga0070670_1002221702 | 311 |
| 425 | 3300005333 | Ga0070677_10002411 | Ga0070677_100024115 | 311 |
| 426 | 3300005334 | Ga0068869_100004332 | Ga0068869_1000043323 | 311 |
| 427 | 3300005335 | Ga0070666_10004949 | Ga0070666_100049493 | 311 |
| 428 | 3300005339 | Ga0070660_100149037 | Ga0070660_1001490372 | 311 |
| 429 | 3300005343 | Ga0070687_100034083 | Ga0070687_1000340832 | 311 |
| 430 | 3300005355 | Ga0070671_100317408 | Ga0070671_1003174082 | 311 |
| 431 | 3300005356 | Ga0070674_100056559 | Ga0070674_1000565592 | 311 |
| 432 | 3300005367 | Ga0070667_100030785 | Ga0070667_1000307851 | 311 |
| 433 | 3300005441 | Ga0070700_100077649 | Ga0070700_1000776492 | 311 |
| 434 | 3300005456 | Ga0070678_100036514 | Ga0070678_1000365142 | 311 |
| 435 | 3300005457 | Ga0070662_100020143 | Ga0070662_1000201431 | 311 |
| 436 | 3300005459 | Ga0068867_100006301 | Ga0068867_1000063015 | 311 |
| 437 | 3300005530 | Ga0070679_100199967 | Ga0070679_1001999672 | 311 |
| 438 | 3300005543 | Ga0070672_100004725 | Ga0070672_1000047254 | 311 |
| 439 | 3300005616 | Ga0068852_100012855 | Ga0068852_1000128554 | 311 |
| 440 | 3300005617 | Ga0068859_100128891 | Ga0068859_1001288912 | 311 |
| 441 | 3300005618 | Ga0068864_100067142 | Ga0068864_1000671422 | 311 |
| 442 | 3300005719 | Ga0068861_100006046 | Ga0068861_1000060464 | 311 |
| 443 | 3300005841 | Ga0068863_100009149 | Ga0068863_1000091495 | 311 |
| 444 | 3300005842 | Ga0068858_100006541 | Ga0068858_1000065413 | 311 |
| 445 | 3300005843 | Ga0068860_100000445 | Ga0068860_10000044543 | 311 |
| 446 | 3300005844 | Ga0068862_100098450 | Ga0068862_1000984503 | 311 |
| 447 | 3300006048 | Ga0075363_100044891 | Ga0075363_1000448913 | 311 |
| 448 | 3300006177 | Ga0075362_10032612 | Ga0075362_100326123 | 311 |
| 449 | 3300006178 | Ga0075367_10002066 | Ga0075367_100020665 | 311 |
| 450 | 3300006186 | Ga0075369_10001746 | Ga0075369_100017466 | 311 |
| 451 | 3300006353 | Ga0075370_10001147 | Ga0075370_100011477 | 311 |
| 452 | 3300006881 | Ga0068865_100002093 | Ga0068865_1000020935 | 311 |
| 453 | 3300006931 | Ga0097620_100128892 | Ga0097620_1001288922 | 311 |
| 454 | 3300007076 | Ga0075435_100267804 | Ga0075435_1002678042 | 311 |
| 455 | 3300009094 | Ga0111539_10107535 | Ga0111539_101075352 | 311 |
| 456 | 3300009148 | Ga0105243_10021971 | Ga0105243_100219715 | 311 |
| 457 | 3300009176 | Ga0105242_10035175 | Ga0105242_100351752 | 311 |
| 458 | 3300009553 | Ga0105249_10372687 | Ga0105249_103726872 | 311 |
| 459 | 3300013306 | Ga0163162_10054073 | Ga0163162_100540734 | 311 |
| 460 | 3300013308 | Ga0157375_10012725 | Ga0157375_100127255 | 311 |
| 461 | 3300013308 | Ga0157375_10476969 | Ga0157375_104769691 | 311 |
| 462 | 3300014326 | Ga0157380_10015790 | Ga0157380_100157903 | 311 |
| 463 | 3300014968 | Ga0157379_10205795 | Ga0157379_102057951 | 311 |
| 464 | 3300014969 | Ga0157376_10156917 | Ga0157376_101569172 | 311 |
| 465 | 3300017792 | Ga0163161_10020823 | Ga0163161_100208232 | 311 |
| 466 | 3300025315 | Ga0207697_10015533 | Ga0207697_100155332 | 311 |
| 467 | 3300025893 | Ga0207682_10008973 | Ga0207682_100089732 | 311 |
| 468 | 3300025899 | Ga0207642_10002491 | Ga0207642_100024914 | 311 |
| 469 | 3300025903 | Ga0207680_10005090 | Ga0207680_100050905 | 311 |
| 470 | 3300025907 | Ga0207645_10004582 | Ga0207645_100045829 | 311 |
| 471 | 3300025918 | Ga0207662_10001475 | Ga0207662_100014753 | 311 |
| 472 | 3300025922 | Ga0207646_10264735 | Ga0207646_102647352 | 311 |
| 473 | 3300025923 | Ga0207681_10008531 | Ga0207681_100085312 | 311 |
| 474 | 3300025926 | Ga0207659_10075986 | Ga0207659_100759862 | 311 |
| 475 | 3300025931 | Ga0207644_10330995 | Ga0207644_103309952 | 311 |
| 476 | 3300025933 | Ga0207706_10009798 | Ga0207706_100097987 | 311 |
| 477 | 3300025934 | Ga0207686_10085036 | Ga0207686_100850362 | 311 |
| 478 | 3300025935 | Ga0207709_10048266 | Ga0207709_100482663 | 311 |
| 479 | 3300025937 | Ga0207669_10019212 | Ga0207669_100192124 | 311 |
| 480 | 3300025938 | Ga0207704_10010842 | Ga0207704_100108422 | 311 |
| 481 | 3300025940 | Ga0207691_10010762 | Ga0207691_100107625 | 311 |
| 482 | 3300025942 | Ga0207689_10004853 | Ga0207689_100048535 | 311 |
| 483 | 3300025945 | Ga0207679_10132562 | Ga0207679_101325622 | 311 |
| 484 | 3300025961 | Ga0207712_10011898 | Ga0207712_100118984 | 311 |
| 485 | 3300025972 | Ga0207668_10012804 | Ga0207668_100128043 | 311 |
| 486 | 3300025986 | Ga0207658_10003494 | Ga0207658_100034949 | 311 |
| 487 | 3300025986 | Ga0207658_10027074 | Ga0207658_100270744 | 311 |
| 488 | 3300026035 | Ga0207703_10001799 | Ga0207703_100017999 | 311 |
| 489 | 3300026067 | Ga0207678_10063914 | Ga0207678_100639143 | 311 |
| 490 | 3300026088 | Ga0207641_10015255 | Ga0207641_100152552 | 311 |
| 491 | 3300026089 | Ga0207648_10004667 | Ga0207648_100046679 | 311 |
| 492 | 3300026095 | Ga0207676_10052933 | Ga0207676_100529334 | 311 |
| 493 | 3300026118 | Ga0207675_100007314 | Ga0207675_1000073145 | 311 |
| 494 | 3300026121 | Ga0207683_10054461 | Ga0207683_100544614 | 311 |
| 495 | 3300026142 | Ga0207698_10048625 | Ga0207698_100486252 | 311 |
| 496 | 3300028380 | Ga0268265_10004016 | Ga0268265_100040163 | 311 |
| 497 | 3300028381 | Ga0268264_10020878 | Ga0268264_100208785 | 311 |
| 498 | 3300031456 | Ga0307513_10013819 | Ga0307513_100138197 | 311 |
| 499 | 3300031548 | Ga0307408_100048450 | Ga0307408_1000484502 | 311 |
| 500 | 3300031731 | Ga0307405_10003735 | Ga0307405_100037354 | 311 |
| 501 | 3300031824 | Ga0307413_10026207 | Ga0307413_100262074 | 311 |
| 502 | 3300031852 | Ga0307410_10013767 | Ga0307410_100137672 | 311 |
| 503 | 3300031901 | Ga0307406_10005448 | Ga0307406_100054483 | 311 |
| 504 | 3300031903 | Ga0307407_10002451 | Ga0307407_100024514 | 311 |
| 505 | 3300031911 | Ga0307412_10009014 | Ga0307412_100090143 | 311 |
| 506 | 3300031995 | Ga0307409_100022174 | Ga0307409_1000221744 | 311 |
| 507 | 3300032002 | Ga0307416_100001584 | Ga0307416_10000158412 | 311 |
| 508 | 3300032004 | Ga0307414_10031261 | Ga0307414_100312614 | 311 |
| 509 | 3300032005 | Ga0307411_10002419 | Ga0307411_100024192 | 311 |
| 510 | 3300035398 | Ga0316574_0006010 | Ga0316574_0006010_3672_4691 | 311 |
| 511 | 3300036401 | Ga0373937_0113545 | Ga0373937_0113545_34_1059 | 311 |
| 512 | 3300037466 | Ga0395898_0091709 | Ga0395898_0091709_829_1836 | 311 |
| 513 | 3300037471 | Ga0395905_0151024 | Ga0395905_0151024_266_1273 | 311 |
| 514 | 3300037471 | Ga0395905_0275369 | Ga0395905_0275369_214_1230 | 311 |
| 515 | 3300038443 | Ga0395901_0211074 | Ga0395901_0211074_496_1503 | 311 |
| 516 | 3300039437 | Ga0436365_1397879 | Ga0436365_1397879_51_1010 | 311 |
| 517 | 3300039438 | Ga0436360_1095664 | Ga0436360_1095664_247_1257 | 311 |
| 518 | 3300039450 | Ga0436363_0707452 | Ga0436363_0707452_2053_3030 | 311 |
| 519 | 3300046542 | Ga0495597_0011926 | Ga0495597_0011926_2774_3730 | 311 |
| 520 | 3300046674 | Ga0495588_0048044 | Ga0495588_0048044_581_1570 | 311 |
| 521 | 3300047443 | Ga0495687_000174 | Ga0495687_000174_83230_84186 | 311 |
| 522 | 3300049587 | Ga0501071_0192928 | Ga0501071_0192928_427_1476 | 311 |
| 523 | 3300050490 | nmdc:mga03n38_52854_c1 | nmdc:mga03n38_52854_c1_431_1408 | 311 |
| 524 | 3300050493 | nmdc:mga0k408_1076_c1 | nmdc:mga0k408_1076_c1_665_1642 | 311 |
| 525 | 3300050494 | nmdc:mga06z11_13801_c1 | nmdc:mga06z11_13801_c1_2345_3322 | 311 |
| 526 | 3300050496 | nmdc:mga07m45_756_c1 | nmdc:mga07m45_756_c1_10335_11312 | 311 |
| 527 | 3300050513 | nmdc:mga0rr50_173434_c1 | nmdc:mga0rr50_173434_c1_121_1122 | 311 |
| 528 | 3300050516 | nmdc:mga0sz30_6627_c1 | nmdc:mga0sz30_6627_c1_2369_3346 | 311 |
| 529 | 3300005440 | Ga0070705_100100317 | Ga0070705_1001003172 | 312 |
| 530 | 3300005445 | Ga0070708_100071167 | Ga0070708_1000711673 | 312 |
| 531 | 3300005467 | Ga0070706_100056652 | Ga0070706_1000566523 | 312 |
| 532 | 3300005467 | Ga0070706_100069571 | Ga0070706_1000695713 | 312 |
| 533 | 3300005468 | Ga0070707_100125374 | Ga0070707_1001253742 | 312 |
| 534 | 3300005471 | Ga0070698_100128136 | Ga0070698_1001281362 | 312 |
| 535 | 3300005518 | Ga0070699_100012263 | Ga0070699_1000122632 | 312 |
| 536 | 3300005536 | Ga0070697_100028919 | Ga0070697_1000289192 | 312 |
| 537 | 3300006846 | Ga0075430_100016752 | Ga0075430_1000167524 | 312 |
| 538 | 3300006847 | Ga0075431_100055100 | Ga0075431_1000551002 | 312 |
| 539 | 3300006880 | Ga0075429_100070657 | Ga0075429_1000706573 | 312 |
| 540 | 3300007076 | Ga0075435_100019365 | Ga0075435_1000193653 | 312 |
| 541 | 3300009147 | Ga0114129_10267830 | Ga0114129_102678303 | 312 |
| 542 | 3300009148 | Ga0105243_10225236 | Ga0105243_102252362 | 312 |
| 543 | 3300013297 | Ga0157378_10287237 | Ga0157378_102872372 | 312 |
| 544 | 3300025910 | Ga0207684_10019197 | Ga0207684_100191972 | 312 |
| 545 | 3300025910 | Ga0207684_10052702 | Ga0207684_100527022 | 312 |
| 546 | 3300025922 | Ga0207646_10053523 | Ga0207646_100535232 | 312 |
| 547 | 3300025922 | Ga0207646_10303116 | Ga0207646_103031162 | 312 |
| 548 | 3300026041 | Ga0207639_10036147 | Ga0207639_100361472 | 312 |
| 549 | 3300034816 | Ga0373930_0036247 | Ga0373930_0036247_19_1023 | 312 |
| 550 | 3300045051 | Ga0451576_0066649 | Ga0451576_0066649_1361_2365 | 312 |
| 551 | 3300046472 | Ga0495580_0046786 | Ga0495580_0046786_818_1822 | 312 |
| 552 | 3300046664 | Ga0495659_0012239 | Ga0495659_0012239_1383_2387 | 312 |
| 553 | 3300050508 | nmdc:mga09592_48847_c1 | nmdc:mga09592_48847_c1_1582_2586 | 312 |
| 554 | 3300050509 | nmdc:mga0qj67_9318_c1 | nmdc:mga0qj67_9318_c1_494_1498 | 312 |
| 555 | 3300050512 | nmdc:mga0n895_418421_c1 | nmdc:mga0n895_418421_c1_90_1094 | 312 |
| 556 | 3300050515 | nmdc:mga0a205_329800_c1 | nmdc:mga0a205_329800_c1_235_1239 | 312 |
| 557 | 3300005331 | Ga0070670_100246288 | Ga0070670_1002462882 | 313 |
| 558 | 3300005334 | Ga0068869_100002122 | Ga0068869_1000021226 | 313 |
| 559 | 3300005337 | Ga0070682_100078008 | Ga0070682_1000780081 | 313 |
| 560 | 3300005338 | Ga0068868_100006941 | Ga0068868_1000069416 | 313 |
| 561 | 3300005354 | Ga0070675_100027777 | Ga0070675_1000277774 | 313 |
| 562 | 3300005355 | Ga0070671_100245386 | Ga0070671_1002453862 | 313 |
| 563 | 3300005366 | Ga0070659_100024761 | Ga0070659_1000247613 | 313 |
| 564 | 3300005455 | Ga0070663_100007618 | Ga0070663_1000076184 | 313 |
| 565 | 3300005455 | Ga0070663_100284924 | Ga0070663_1002849242 | 313 |
| 566 | 3300005456 | Ga0070678_100108183 | Ga0070678_1001081832 | 313 |
| 567 | 3300005457 | Ga0070662_100014240 | Ga0070662_1000142404 | 313 |
| 568 | 3300005457 | Ga0070662_100014845 | Ga0070662_1000148452 | 313 |
| 569 | 3300005539 | Ga0068853_100019417 | Ga0068853_1000194173 | 313 |
| 570 | 3300005543 | Ga0070672_100009264 | Ga0070672_1000092644 | 313 |
| 571 | 3300005547 | Ga0070693_100100341 | Ga0070693_1001003412 | 313 |
| 572 | 3300005548 | Ga0070665_100165095 | Ga0070665_1001650952 | 313 |
| 573 | 3300005563 | Ga0068855_100081449 | Ga0068855_1000814492 | 313 |
| 574 | 3300005564 | Ga0070664_100085179 | Ga0070664_1000851792 | 313 |
| 575 | 3300005564 | Ga0070664_100144464 | Ga0070664_1001444641 | 313 |
| 576 | 3300005564 | Ga0070664_100232032 | Ga0070664_1002320321 | 313 |
| 577 | 3300005578 | Ga0068854_100014049 | Ga0068854_1000140492 | 313 |
| 578 | 3300005614 | Ga0068856_100002754 | Ga0068856_1000027547 | 313 |
| 579 | 3300005616 | Ga0068852_100014774 | Ga0068852_1000147744 | 313 |
| 580 | 3300005616 | Ga0068852_100126502 | Ga0068852_1001265022 | 313 |
| 581 | 3300005616 | Ga0068852_100211164 | Ga0068852_1002111642 | 313 |
| 582 | 3300005618 | Ga0068864_100014331 | Ga0068864_1000143313 | 313 |
| 583 | 3300005719 | Ga0068861_100002723 | Ga0068861_1000027238 | 313 |
| 584 | 3300005834 | Ga0068851_10097805 | Ga0068851_100978052 | 313 |
| 585 | 3300005841 | Ga0068863_100145777 | Ga0068863_1001457772 | 313 |
| 586 | 3300005842 | Ga0068858_100003275 | Ga0068858_10000327513 | 313 |
| 587 | 3300005843 | Ga0068860_100003813 | Ga0068860_10000381314 | 313 |
| 588 | 3300005843 | Ga0068860_100055223 | Ga0068860_1000552234 | 313 |
| 589 | 3300005844 | Ga0068862_100038290 | Ga0068862_1000382903 | 313 |
| 590 | 3300006237 | Ga0097621_100017213 | Ga0097621_1000172133 | 313 |
| 591 | 3300006358 | Ga0068871_100016517 | Ga0068871_1000165173 | 313 |
| 592 | 3300009093 | Ga0105240_10251643 | Ga0105240_102516432 | 313 |
| 593 | 3300009177 | Ga0105248_10077605 | Ga0105248_100776054 | 313 |
| 594 | 3300009551 | Ga0105238_10028562 | Ga0105238_100285624 | 313 |
| 595 | 3300009551 | Ga0105238_10069909 | Ga0105238_100699092 | 313 |
| 596 | 3300010375 | Ga0105239_10102136 | Ga0105239_101021362 | 313 |
| 597 | 3300013100 | Ga0157373_10008856 | Ga0157373_100088565 | 313 |
| 598 | 3300013102 | Ga0157371_10071907 | Ga0157371_100719072 | 313 |
| 599 | 3300013296 | Ga0157374_10107158 | Ga0157374_101071582 | 313 |
| 600 | 3300013296 | Ga0157374_10115310 | Ga0157374_101153102 | 313 |
| 601 | 3300013306 | Ga0163162_10012088 | Ga0163162_100120884 | 313 |
| 602 | 3300013307 | Ga0157372_10038032 | Ga0157372_100380322 | 313 |
| 603 | 3300013307 | Ga0157372_10115147 | Ga0157372_101151473 | 313 |
| 604 | 3300013308 | Ga0157375_10451756 | Ga0157375_104517562 | 313 |
| 605 | 3300014745 | Ga0157377_10003326 | Ga0157377_100033264 | 313 |
| 606 | 3300014968 | Ga0157379_10012126 | Ga0157379_100121265 | 313 |
| 607 | 3300014968 | Ga0157379_10075966 | Ga0157379_100759663 | 313 |
| 608 | 3300014969 | Ga0157376_10003522 | Ga0157376_100035227 | 313 |
| 609 | 3300017792 | Ga0163161_10007610 | Ga0163161_100076104 | 313 |
| 610 | 3300025321 | Ga0207656_10021654 | Ga0207656_100216543 | 313 |
| 611 | 3300025893 | Ga0207682_10011656 | Ga0207682_100116562 | 313 |
| 612 | 3300025901 | Ga0207688_10012083 | Ga0207688_100120833 | 313 |
| 613 | 3300025907 | Ga0207645_10014016 | Ga0207645_100140163 | 313 |
| 614 | 3300025909 | Ga0207705_10028425 | Ga0207705_100284253 | 313 |
| 615 | 3300025914 | Ga0207671_10012655 | Ga0207671_100126554 | 313 |
| 616 | 3300025919 | Ga0207657_10090018 | Ga0207657_100900182 | 313 |
| 617 | 3300025920 | Ga0207649_10040599 | Ga0207649_100405993 | 313 |
| 618 | 3300025920 | Ga0207649_10171098 | Ga0207649_101710982 | 313 |
| 619 | 3300025924 | Ga0207694_10028565 | Ga0207694_100285652 | 313 |
| 620 | 3300025925 | Ga0207650_10024459 | Ga0207650_100244593 | 313 |
| 621 | 3300025926 | Ga0207659_10009561 | Ga0207659_100095614 | 313 |
| 622 | 3300025926 | Ga0207659_10086740 | Ga0207659_100867402 | 313 |
| 623 | 3300025933 | Ga0207706_10002472 | Ga0207706_100024725 | 313 |
| 624 | 3300025938 | Ga0207704_10045219 | Ga0207704_100452192 | 313 |
| 625 | 3300025940 | Ga0207691_10006274 | Ga0207691_100062745 | 313 |
| 626 | 3300025940 | Ga0207691_10097865 | Ga0207691_100978652 | 313 |
| 627 | 3300025941 | Ga0207711_10031936 | Ga0207711_100319362 | 313 |
| 628 | 3300025942 | Ga0207689_10003145 | Ga0207689_100031455 | 313 |
| 629 | 3300025944 | Ga0207661_10182866 | Ga0207661_101828662 | 313 |
| 630 | 3300025945 | Ga0207679_10050998 | Ga0207679_100509983 | 313 |
| 631 | 3300025945 | Ga0207679_10249345 | Ga0207679_102493452 | 313 |
| 632 | 3300025949 | Ga0207667_10125317 | Ga0207667_101253173 | 313 |
| 633 | 3300025981 | Ga0207640_10289708 | Ga0207640_102897081 | 313 |
| 634 | 3300025986 | Ga0207658_10114250 | Ga0207658_101142502 | 313 |
| 635 | 3300026023 | Ga0207677_10003875 | Ga0207677_100038754 | 313 |
| 636 | 3300026035 | Ga0207703_10191997 | Ga0207703_101919972 | 313 |
| 637 | 3300026041 | Ga0207639_10109127 | Ga0207639_101091271 | 313 |
| 638 | 3300026067 | Ga0207678_10064277 | Ga0207678_100642772 | 313 |
| 639 | 3300026078 | Ga0207702_10102791 | Ga0207702_101027913 | 313 |
| 640 | 3300026078 | Ga0207702_10331977 | Ga0207702_103319772 | 313 |
| 641 | 3300026095 | Ga0207676_10011922 | Ga0207676_100119223 | 313 |
| 642 | 3300026116 | Ga0207674_10105895 | Ga0207674_101058952 | 313 |
| 643 | 3300026118 | Ga0207675_100004517 | Ga0207675_10000451711 | 313 |
| 644 | 3300026121 | Ga0207683_10166820 | Ga0207683_101668202 | 313 |
| 645 | 3300026121 | Ga0207683_10392501 | Ga0207683_103925012 | 313 |
| 646 | 3300026142 | Ga0207698_10033857 | Ga0207698_100338573 | 313 |
| 647 | 3300026142 | Ga0207698_10187381 | Ga0207698_101873812 | 313 |
| 648 | 3300026142 | Ga0207698_10329061 | Ga0207698_103290612 | 313 |
| 649 | 3300028380 | Ga0268265_10077352 | Ga0268265_100773522 | 313 |
| 650 | 3300028381 | Ga0268264_10015864 | Ga0268264_100158644 | 313 |
| 651 | 3300028381 | Ga0268264_10100740 | Ga0268264_101007402 | 313 |
| 652 | 3300035207 | Ga0373942_0033933 | Ga0373942_0033933_169_1146 | 313 |
| 653 | 3300035691 | Ga0373931_0006797 | Ga0373931_0006797_3052_4029 | 313 |
| 654 | 3300041512 | Ga0451853_1410340 | Ga0451853_1410340_85_1065 | 313 |
| 655 | 3300048903 | Ga0496100_0036459 | Ga0496100_0036459_780_1757 | 313 |
| 656 | 3300048904 | Ga0496101_0011006 | Ga0496101_0011006_3584_4561 | 313 |
| 657 | 3300048905 | Ga0496102_0018381 | Ga0496102_0018381_3322_4299 | 313 |
| 658 | 3300048907 | Ga0496104_0072463 | Ga0496104_0072463_1054_2031 | 313 |
| 659 | 3300048909 | Ga0496106_0187932 | Ga0496106_0187932_341_1318 | 313 |
| 660 | 3300048910 | Ga0496107_0008481 | Ga0496107_0008481_4996_5973 | 313 |
| 661 | 3300048911 | Ga0496108_0025297 | Ga0496108_0025297_2149_3126 | 313 |
| 662 | 3300048912 | Ga0496109_0058844 | Ga0496109_0058844_2298_3275 | 313 |
| 663 | 3300048913 | Ga0496110_0018001 | Ga0496110_0018001_3786_4763 | 313 |
| 664 | 3300048914 | Ga0496111_0086443 | Ga0496111_0086443_239_1216 | 313 |
| 665 | 3300048917 | Ga0496114_0020230 | Ga0496114_0020230_1703_2680 | 313 |
| 666 | 3300048918 | Ga0496115_0012118 | Ga0496115_0012118_2965_3942 | 313 |
| 667 | 3300005614 | Ga0068856_100021873 | Ga0068856_1000218736 | 314 |
| 668 | 3300006871 | Ga0075434_100000132 | Ga0075434_1000001329 | 314 |
| 669 | 3300006914 | Ga0075436_100073824 | Ga0075436_1000738242 | 314 |
| 670 | 3300007076 | Ga0075435_100006450 | Ga0075435_1000064504 | 314 |
| 671 | 3300014497 | Ga0182008_10049438 | Ga0182008_100494382 | 314 |
| 672 | 3300014968 | Ga0157379_10501204 | Ga0157379_105012041 | 314 |
| 673 | 3300025939 | Ga0207665_10044076 | Ga0207665_100440763 | 314 |
| 674 | 3300026078 | Ga0207702_10012690 | Ga0207702_100126905 | 314 |
| 675 | 3300035692 | Ga0373935_0129958 | Ga0373935_0129958_267_1265 | 314 |
| 676 | 3300050512 | nmdc:mga0n895_119372_c1 | nmdc:mga0n895_119372_c1_544_1536 | 314 |
| 677 | 3300050513 | nmdc:mga0rr50_17843_c1 | nmdc:mga0rr50_17843_c1_823_1815 | 314 |
| 678 | 3300050513 | nmdc:mga0rr50_38273_c1 | nmdc:mga0rr50_38273_c1_750_1856 | 314 |
| 679 | 3300050514 | nmdc:mga08x19_166506_c1 | nmdc:mga08x19_166506_c1_216_1322 | 314 |
| 680 | 3300059426 | Ga0590077_003466 | Ga0590077_003466_107_1090 | 314 |
| 681 | 3300025949 | Ga0207667_10132106 | Ga0207667_101321063 | 315 |
| 682 | 3300035083 | Ga0373926_0049702 | Ga0373926_0049702_451_1470 | 315 |
| 683 | 3300037312 | Ga0395899_0199703 | Ga0395899_0199703_148_1254 | 315 |
| 684 | 3300037418 | Ga0395900_0010670 | Ga0395900_0010670_1741_2847 | 315 |
| 685 | 3300037466 | Ga0395898_0017213 | Ga0395898_0017213_6112_7218 | 315 |
| 686 | 3300037471 | Ga0395905_0225980 | Ga0395905_0225980_57_1163 | 315 |
| 687 | 3300038443 | Ga0395901_0024791 | Ga0395901_0024791_4258_5364 | 315 |
| 688 | 3300038443 | Ga0395901_0108297 | Ga0395901_0108297_961_2067 | 315 |
| 689 | 3300044656 | Ga0466969_0067162 | Ga0466969_0067162_70_1179 | 315 |
| 690 | 3300044683 | Ga0466965_0144803 | Ga0466965_0144803_33_1142 | 315 |
| 691 | 3300044684 | Ga0466966_0003903 | Ga0466966_0003903_7293_8402 | 315 |
| 692 | 3300044735 | Ga0466968_0019351 | Ga0466968_0019351_1294_2424 | 315 |
| 693 | 3300005327 | Ga0070658_10313918 | Ga0070658_103139182 | 316 |
| 694 | 3300005331 | Ga0070670_100002757 | Ga0070670_1000027572 | 316 |
| 695 | 3300005354 | Ga0070675_100123555 | Ga0070675_1001235552 | 316 |
| 696 | 3300005355 | Ga0070671_100036410 | Ga0070671_1000364102 | 316 |
| 697 | 3300005364 | Ga0070673_100274156 | Ga0070673_1002741562 | 316 |
| 698 | 3300005456 | Ga0070678_100002569 | Ga0070678_1000025692 | 316 |
| 699 | 3300005543 | Ga0070672_100154305 | Ga0070672_1001543052 | 316 |
| 700 | 3300005618 | Ga0068864_100275623 | Ga0068864_1002756232 | 316 |
| 701 | 3300005834 | Ga0068851_10063975 | Ga0068851_100639752 | 316 |
| 702 | 3300006237 | Ga0097621_100115999 | Ga0097621_1001159992 | 316 |
| 703 | 3300006358 | Ga0068871_100095369 | Ga0068871_1000953692 | 316 |
| 704 | 3300013308 | Ga0157375_10032862 | Ga0157375_100328625 | 316 |
| 705 | 3300014969 | Ga0157376_10032818 | Ga0157376_100328183 | 316 |
| 706 | 3300025321 | Ga0207656_10053593 | Ga0207656_100535932 | 316 |
| 707 | 3300025925 | Ga0207650_10002987 | Ga0207650_100029876 | 316 |
| 708 | 3300025926 | Ga0207659_10008417 | Ga0207659_100084173 | 316 |
| 709 | 3300025931 | Ga0207644_10096851 | Ga0207644_100968512 | 316 |
| 710 | 3300025940 | Ga0207691_10018605 | Ga0207691_100186053 | 316 |
| 711 | 3300025945 | Ga0207679_10207510 | Ga0207679_102075102 | 316 |
| 712 | 3300025960 | Ga0207651_10317358 | Ga0207651_103173582 | 316 |
| 713 | 3300026095 | Ga0207676_10003245 | Ga0207676_100032453 | 316 |
| 714 | 3300026121 | Ga0207683_10006504 | Ga0207683_100065042 | 316 |
| 715 | 3300031711 | Ga0265314_10044571 | Ga0265314_100445712 | 316 |
| 716 | 3300031711 | Ga0265314_10084490 | Ga0265314_100844902 | 316 |
| 717 | 3300037068 | Ga0373925_0142864 | Ga0373925_0142864_247_1266 | 316 |
| 718 | 3300037312 | Ga0395899_0081316 | Ga0395899_0081316_139_1176 | 316 |
| 719 | 3300037418 | Ga0395900_0021369 | Ga0395900_0021369_956_1993 | 316 |
| 720 | 3300037471 | Ga0395905_0000180 | Ga0395905_0000180_94460_95497 | 316 |
| 721 | 3300037471 | Ga0395905_0035447 | Ga0395905_0035447_3349_4386 | 316 |
| 722 | 3300037471 | Ga0395905_0055651 | Ga0395905_0055651_2382_3410 | 316 |
| 723 | 3300037471 | Ga0395905_0087092 | Ga0395905_0087092_1239_2273 | 316 |
| 724 | 3300038443 | Ga0395901_0061190 | Ga0395901_0061190_1770_2807 | 316 |
| 725 | 3300046476 | Ga0495662_0082312 | Ga0495662_0082312_89_1108 | 316 |
| 726 | 3300046543 | Ga0495645_0042727 | Ga0495645_0042727_1239_2255 | 316 |
| 727 | 3300046663 | Ga0495635_0113405 | Ga0495635_0113405_568_1587 | 316 |
| 728 | 3300046683 | Ga0495658_0056038 | Ga0495658_0056038_543_1562 | 316 |
| 729 | 3300046689 | Ga0495613_0138516 | Ga0495613_0138516_609_1628 | 316 |
| 730 | 3300049571 | Ga0501034_0093439 | Ga0501034_0093439_1923_2957 | 316 |
| 731 | 3300049580 | Ga0501046_0161104 | Ga0501046_0161104_451_1485 | 316 |
| 732 | 3300049590 | Ga0501074_0206978 | Ga0501074_0206978_242_1276 | 316 |
| 733 | 3300049742 | Ga0501080_0015068 | Ga0501080_0015068_1666_2700 | 316 |
| 734 | 3300049822 | Ga0501035_0025466 | Ga0501035_0025466_3181_4215 | 316 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lb8-assembly1.cif.gz_B | structure of a ferrichrome importer fhucdb from e. coli | 0.5557 | 16 | 281 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.4911 | 22 | 297 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4884 | 12 | 297 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.4881 | 22 | 297 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4754 | 12 | 297 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58666_4_320_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8441 | 22 | 293 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8264 | 26 | 293 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7865 | 26 | 293 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7726 | 26 | 291 | 1.10.3470.10 |
| af_P32720_52_318_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7607 | 30 | 291 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V6TNZ8-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9918 | 21 | 262 |
GO:0005886
GO:0015658 |
| AF-A0A536V8Q0-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9916 | 2 | 316 |
GO:0005886
GO:0015658 |
| AF-A0A521YMR3-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9912 | 1 | 314 |
GO:0005886
GO:0015658 |
| AF-A0A521VKR8-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9903 | 1 | 315 |
GO:0005886
GO:0015658 |
| AF-A0A1S8FII9-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9903 | 1 | 316 |
GO:0005886
GO:0015658 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar