F478161

General Info

Members Datasets Scaffolds Average Seq Length
734 340 734 325

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0019351|Ga0466968_0019351_1294_2424
Length 376
Sequence MKAMERGMDVKRKLSAQQLAGLAALLVIACVLPFVLGNYTVFQLTMAMSYAIALLGLNMLTGYNGQISLGHGAFFAIGAYTAAILMDKANWPYWATIPAAGIVCLAAGFLFGLPALRLEGLYLALATFALGVAMPQILKYKGFEHWTGGSMGVVIMKPDPPAGIPLNQDQWLYFFTLLWVVILFVAGWNILRGRVGRALVAIRDHPIAAQAMGVNTAMYKSLTFGVSALYTGIAGALAAIGVQFASPDSFSVFLSLTLLVGVVVGGLASISGAFYGALFIQFIPNIADRISKAAPWAIYGVFLIAFMYLMPSGVAGLIAMVRRRFVKVPVQVQERKQDDDSTQDPRDRRSHARGPVPEHRVRAIEEGNQDRADHAV

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
184 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
200 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
201 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
202 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
204 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
205 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
206 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
209 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
210 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
215 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
216 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
219 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
220 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
221 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
225 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
228 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
229 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
232 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
233 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
234 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
235 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
236 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
237 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
238 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
239 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
240 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
241 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
244 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
250 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
251 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
254 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
271 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
275 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
307 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
308 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
331 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
332 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
333 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
334 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
335 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
339 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
340 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.36
Nodule 0
Rhizoplane 4.09
Rhizosphere 90.46
Stem 0
Stem Tuber 0
Unclassified 1.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10313918 3300005327 Bacteria 1338
2 Ga0070676_10008106 3300005328 Bacteria 5650
3 Ga0070690_100005969 3300005330 Bacteria 6877
4 Ga0070670_100002757 3300005331 Bacteria 14508
5 Ga0070670_100009195 3300005331 Bacteria 8445
6 Ga0070670_100068783 3300005331 Bacteria 3039
7 Ga0070670_100142133 3300005331 Bacteria 2076
8 Ga0070670_100173000 3300005331 Bacteria 1873
9 Ga0070670_100222170 3300005331 Bacteria 1643
10 Ga0070670_100246288 3300005331 Bacteria 1556
11 Ga0070670_100375779 3300005331 Bacteria 1251
12 Ga0070677_10002411 3300005333 Bacteria 5965
13 Ga0070677_10017059 3300005333 Bacteria 2593
14 Ga0068869_100002122 3300005334 Bacteria 11923
15 Ga0068869_100004332 3300005334 Bacteria 8810
16 Ga0068869_100019219 3300005334 Bacteria 4663
17 Ga0070666_10001889 3300005335 Bacteria 12748
18 Ga0070666_10004949 3300005335 Bacteria 8151
19 Ga0070680_100035618 3300005336 Bacteria 4019
20 Ga0070680_100080743 3300005336 Bacteria 2682
21 Ga0070680_100148819 3300005336 Bacteria 1965
22 Ga0070682_100078008 3300005337 Bacteria 2136
23 Ga0068868_100006941 3300005338 Bacteria 8048
24 Ga0068868_100120478 3300005338 Bacteria 2140
25 Ga0070660_100149037 3300005339 Bacteria 1880
26 Ga0070689_100228459 3300005340 Bacteria 1529
27 Ga0070687_100034083 3300005343 Bacteria 2518
28 Ga0070668_100130216 3300005347 Bacteria 2019
29 Ga0070669_100004770 3300005353 Bacteria 9779
30 Ga0070669_100161509 3300005353 Bacteria 1741
31 Ga0070675_100002630 3300005354 Bacteria 13494
32 Ga0070675_100027777 3300005354 Bacteria 4549
33 Ga0070675_100061955 3300005354 Bacteria 3090
34 Ga0070675_100123555 3300005354 Bacteria 2201
35 Ga0070671_100021081 3300005355 Bacteria 5320
36 Ga0070671_100036410 3300005355 Bacteria 4081
37 Ga0070671_100245386 3300005355 Bacteria 1520
38 Ga0070671_100317408 3300005355 Bacteria 1327
39 Ga0070674_100056559 3300005356 Bacteria 2720
40 Ga0070673_100274156 3300005364 Bacteria 1477
41 Ga0070688_100026960 3300005365 Bacteria 3419
42 Ga0070659_100024761 3300005366 Bacteria 4603
43 Ga0070667_100030785 3300005367 Bacteria 4475
44 Ga0070667_100091932 3300005367 Bacteria 2610
45 Ga0070667_100093719 3300005367 Bacteria 2587
46 Ga0070667_100165616 3300005367 Bacteria 1949
47 Ga0070711_100059630 3300005439 Bacteria 2650
48 Ga0070705_100087470 3300005440 Bacteria 1932
49 Ga0070705_100099966 3300005440 Bacteria 1829
50 Ga0070705_100100317 3300005440 Bacteria 1827
51 Ga0070700_100003507 3300005441 Bacteria 8091
52 Ga0070700_100077649 3300005441 Bacteria 2136
53 Ga0070700_100265184 3300005441 Bacteria 1238
54 Ga0070694_100005593 3300005444 Bacteria 7617
55 Ga0070694_100008469 3300005444 Bacteria 6291
56 Ga0070708_100071167 3300005445 Bacteria 3130
57 Ga0070663_100007618 3300005455 Bacteria 6604
58 Ga0070663_100284924 3300005455 Bacteria 1318
59 Ga0070678_100002569 3300005456 Bacteria 9969
60 Ga0070678_100012645 3300005456 Bacteria 5259
61 Ga0070678_100020488 3300005456 Bacteria 4340
62 Ga0070678_100036514 3300005456 Bacteria 3441
63 Ga0070678_100108183 3300005456 Bacteria 2170
64 Ga0070662_100014240 3300005457 Bacteria 5308
65 Ga0070662_100014845 3300005457 Bacteria 5208
66 Ga0070662_100020143 3300005457 Bacteria 4539
67 Ga0070662_100171509 3300005457 Bacteria 1704
68 Ga0070662_100394058 3300005457 Bacteria 1142
69 Ga0070681_10009509 3300005458 Bacteria 9567
70 Ga0070681_10012298 3300005458 Bacteria 8489
71 Ga0070681_10022535 3300005458 Bacteria 6325
72 Ga0068867_100001086 3300005459 Bacteria 18625
73 Ga0068867_100006301 3300005459 Bacteria 8395
74 Ga0068867_100051748 3300005459 Bacteria 3030
75 Ga0068867_100088689 3300005459 Bacteria 2344
76 Ga0068867_100327287 3300005459 Bacteria 1271
77 Ga0070685_10091391 3300005466 Bacteria 1843
78 Ga0070685_10114797 3300005466 Bacteria 1665
79 Ga0070706_100056652 3300005467 Bacteria 3616
80 Ga0070706_100069571 3300005467 Bacteria 3255
81 Ga0070706_100184916 3300005467 Bacteria 1947
82 Ga0070707_100125374 3300005468 Bacteria 2494
83 Ga0070707_100337339 3300005468 Bacteria 1465
84 Ga0070698_100128136 3300005471 Bacteria 2494
85 Ga0070699_100012263 3300005518 Bacteria 7394
86 Ga0070679_100004740 3300005530 Bacteria 12542
87 Ga0070679_100008970 3300005530 Bacteria 9437
88 Ga0070679_100199967 3300005530 Bacteria 1965
89 Ga0070679_100458460 3300005530 Bacteria 1219
90 Ga0070697_100028919 3300005536 Bacteria 4441
91 Ga0070697_100038033 3300005536 Bacteria 3887
92 Ga0068853_100019417 3300005539 Bacteria 5634
93 Ga0070672_100004725 3300005543 Bacteria 8940
94 Ga0070672_100009264 3300005543 Bacteria 6780
95 Ga0070672_100051990 3300005543 Bacteria 3197
96 Ga0070672_100055033 3300005543 Bacteria 3116
97 Ga0070672_100154305 3300005543 Bacteria 1901
98 Ga0070686_100012900 3300005544 Bacteria 4771
99 Ga0070695_100019186 3300005545 Bacteria 4160
100 Ga0070695_100101915 3300005545 Bacteria 1935
101 Ga0070695_100108643 3300005545 Bacteria 1879
102 Ga0070695_100287097 3300005545 Bacteria 1211
103 Ga0070696_100071825 3300005546 Bacteria 2436
104 Ga0070693_100100341 3300005547 Bacteria 1762
105 Ga0070665_100165095 3300005548 Bacteria 2216
106 Ga0070704_100038987 3300005549 Bacteria 3259
107 Ga0068855_100004439 3300005563 Bacteria 17139
108 Ga0068855_100009666 3300005563 Bacteria 11637
109 Ga0068855_100081449 3300005563 Bacteria 3752
110 Ga0070664_100053624 3300005564 Bacteria 3419
111 Ga0070664_100085179 3300005564 Bacteria 2729
112 Ga0070664_100144464 3300005564 Bacteria 2097
113 Ga0070664_100232032 3300005564 Bacteria 1654
114 Ga0068857_100198475 3300005577 Bacteria 1828
115 Ga0068854_100014049 3300005578 Bacteria 5271
116 Ga0068856_100002754 3300005614 Bacteria 18000
117 Ga0068856_100021873 3300005614 Bacteria 6216
118 Ga0070702_100049806 3300005615 Bacteria 2390
119 Ga0068852_100012855 3300005616 Bacteria 6382
120 Ga0068852_100014774 3300005616 Bacteria 6028
121 Ga0068852_100126502 3300005616 Bacteria 2348
122 Ga0068852_100211164 3300005616 Bacteria 1841
123 Ga0068859_100007812 3300005617 Bacteria 10858
124 Ga0068859_100029524 3300005617 Bacteria 5502
125 Ga0068859_100128891 3300005617 Bacteria 2601
126 Ga0068859_100232145 3300005617 Bacteria 1933
127 Ga0068864_100001309 3300005618 Bacteria 20721
128 Ga0068864_100014331 3300005618 Bacteria 6585
129 Ga0068864_100067142 3300005618 Bacteria 3114
130 Ga0068864_100142059 3300005618 Bacteria 2166
131 Ga0068864_100275623 3300005618 Bacteria 1568
132 Ga0068866_10044520 3300005718 Bacteria 2221
133 Ga0068866_10131322 3300005718 Bacteria 1425
134 Ga0068861_100002723 3300005719 Bacteria 11577
135 Ga0068861_100006046 3300005719 Bacteria 8233
136 Ga0068861_100009341 3300005719 Bacteria 6768
137 Ga0068861_100148714 3300005719 Bacteria 1920
138 Ga0068861_100186909 3300005719 Bacteria 1729
139 Ga0068861_100433721 3300005719 Bacteria 1173
140 Ga0068851_10063975 3300005834 Bacteria 1890
141 Ga0068851_10097805 3300005834 Bacteria 1553
142 Ga0068863_100009149 3300005841 Bacteria 9667
143 Ga0068863_100013734 3300005841 Bacteria 7808
144 Ga0068863_100145777 3300005841 Bacteria 2264
145 Ga0068863_100188712 3300005841 Bacteria 1980
146 Ga0068863_100444600 3300005841 Bacteria 1272
147 Ga0068858_100002892 3300005842 Bacteria 17265
148 Ga0068858_100003275 3300005842 Bacteria 16136
149 Ga0068858_100006541 3300005842 Bacteria 11334
150 Ga0068860_100000445 3300005843 Bacteria 52236
151 Ga0068860_100003813 3300005843 Bacteria 15505
152 Ga0068860_100055223 3300005843 Bacteria 3775
153 Ga0068860_100467608 3300005843 Bacteria 1256
154 Ga0068862_100010767 3300005844 Bacteria 7550
155 Ga0068862_100038290 3300005844 Bacteria 4067
156 Ga0068862_100098450 3300005844 Bacteria 2555
157 Ga0068862_100296552 3300005844 Bacteria 1486
158 Ga0068862_100361354 3300005844 Bacteria 1349
159 Ga0081539_10132285 3300005985 Bacteria 1223
160 Ga0075365_10053369 3300006038 Bacteria 2677
161 Ga0075363_100044891 3300006048 Bacteria 2342
162 Ga0075363_100130919 3300006048 Bacteria 1407
163 Ga0075364_10127340 3300006051 Bacteria 1708
164 Ga0075364_10168113 3300006051 Bacteria 1482
165 Ga0075432_10035439 3300006058 Bacteria 1734
166 Ga0070715_10039621 3300006163 Bacteria 1964
167 Ga0070712_100074571 3300006175 Bacteria 2438
168 Ga0075362_10002737 3300006177 Bacteria 6007
169 Ga0075362_10032612 3300006177 Bacteria 2261
170 Ga0075367_10002066 3300006178 Bacteria 8992
171 Ga0075367_10125329 3300006178 Bacteria 1585
172 Ga0075369_10001746 3300006186 Bacteria 7534
173 Ga0075366_10039304 3300006195 Bacteria 2797
174 Ga0075366_10086166 3300006195 Bacteria 1879
175 Ga0097621_100017213 3300006237 Bacteria 5485
176 Ga0097621_100048088 3300006237 Bacteria 3459
177 Ga0097621_100115999 3300006237 Bacteria 2267
178 Ga0097621_100192298 3300006237 Bacteria 1768
179 Ga0097621_100201581 3300006237 Bacteria 1728
180 Ga0075370_10001147 3300006353 Bacteria 11127
181 Ga0075370_10004740 3300006353 Bacteria 6649
182 Ga0075370_10042799 3300006353 Bacteria 2559
183 Ga0068871_100016517 3300006358 Bacteria 5563
184 Ga0068871_100071329 3300006358 Bacteria 2857
185 Ga0068871_100091740 3300006358 Bacteria 2532
186 Ga0068871_100095369 3300006358 Bacteria 2484
187 Ga0075428_100254586 3300006844 Bacteria 1891
188 Ga0075428_100672709 3300006844 Bacteria 1103
189 Ga0075430_100016752 3300006846 Bacteria 6243
190 Ga0075431_100009047 3300006847 Bacteria 9987
191 Ga0075431_100021141 3300006847 Bacteria 6649
192 Ga0075431_100055100 3300006847 Bacteria 4101
193 Ga0075431_100091893 3300006847 Bacteria 3132
194 Ga0075433_10141798 3300006852 Bacteria 2136
195 Ga0075434_100000132 3300006871 Bacteria 44951
196 Ga0075434_100049920 3300006871 Bacteria 4155
197 Ga0075429_100000638 3300006880 Bacteria 27089
198 Ga0075429_100070657 3300006880 Bacteria 3040
199 Ga0068865_100002093 3300006881 Bacteria 11787
200 Ga0068865_100023360 3300006881 Bacteria 4047
201 Ga0075436_100073824 3300006914 Bacteria 2361
202 Ga0075436_100122725 3300006914 Bacteria 1819
203 Ga0097620_100007812 3300006931 Bacteria 10858
204 Ga0097620_100029524 3300006931 Bacteria 5502
205 Ga0097620_100128892 3300006931 Bacteria 2601
206 Ga0097620_100232124 3300006931 Bacteria 1933
207 Ga0075435_100001341 3300007076 Bacteria 15839
208 Ga0075435_100006450 3300007076 Bacteria 8299
209 Ga0075435_100019365 3300007076 Bacteria 5197
210 Ga0075435_100037184 3300007076 Bacteria 3875
211 Ga0075435_100195112 3300007076 Bacteria 1715
212 Ga0075435_100267804 3300007076 Bacteria 1457
213 Ga0099795_10030113 3300007788 Bacteria 1861
214 Ga0105240_10012681 3300009093 Bacteria 11616
215 Ga0105240_10031668 3300009093 Bacteria 6854
216 Ga0105240_10100319 3300009093 Bacteria 3523
217 Ga0105240_10251643 3300009093 Bacteria 2043
218 Ga0111539_10006412 3300009094 Bacteria 15172
219 Ga0111539_10038861 3300009094 Bacteria 5741
220 Ga0111539_10107535 3300009094 Bacteria 3273
221 Ga0111539_10129330 3300009094 Bacteria 2957
222 Ga0105245_10223471 3300009098 Bacteria 1818
223 Ga0114129_10007443 3300009147 Bacteria 15595
224 Ga0114129_10015516 3300009147 Bacteria 10831
225 Ga0114129_10267830 3300009147 Bacteria 2287
226 Ga0114129_10386532 3300009147 Bacteria 1847
227 Ga0114129_10589906 3300009147 Bacteria 1441
228 Ga0105243_10012737 3300009148 Bacteria 6353
229 Ga0105243_10021971 3300009148 Bacteria 4846
230 Ga0105243_10149966 3300009148 Bacteria 1999
231 Ga0105243_10225236 3300009148 Bacteria 1660
232 Ga0105242_10035175 3300009176 Bacteria 4017
233 Ga0105242_10132848 3300009176 Bacteria 2151
234 Ga0105242_10205843 3300009176 Bacteria 1750
235 Ga0105248_10077605 3300009177 Bacteria 3734
236 Ga0105248_10079168 3300009177 Bacteria 3693
237 Ga0105237_10020953 3300009545 Bacteria 6730
238 Ga0105238_10028562 3300009551 Bacteria 5682
239 Ga0105238_10030346 3300009551 Bacteria 5502
240 Ga0105238_10069909 3300009551 Bacteria 3511
241 Ga0105249_10063386 3300009553 Bacteria 3396
242 Ga0105249_10199009 3300009553 Bacteria 1960
243 Ga0105249_10372687 3300009553 Bacteria 1452
244 Ga0105239_10018223 3300010375 Bacteria 7762
245 Ga0105239_10102136 3300010375 Bacteria 3173
246 Ga0105246_10419917 3300011119 Bacteria 1116
247 Ga0157373_10008856 3300013100 Bacteria 7450
248 Ga0157371_10071907 3300013102 Bacteria 2449
249 Ga0157370_10033935 3300013104 Bacteria 4972
250 Ga0157370_10037271 3300013104 Bacteria 4714
251 Ga0157374_10096546 3300013296 Bacteria 2827
252 Ga0157374_10107158 3300013296 Bacteria 2685
253 Ga0157374_10115310 3300013296 Bacteria 2588
254 Ga0157374_10277089 3300013296 Bacteria 1655
255 Ga0157374_10370832 3300013296 Bacteria 1425
256 Ga0157378_10287237 3300013297 Bacteria 1588
257 Ga0163162_10012088 3300013306 Bacteria 8422
258 Ga0163162_10036523 3300013306 Bacteria 4898
259 Ga0163162_10054073 3300013306 Bacteria 4037
260 Ga0163162_10193531 3300013306 Bacteria 2161
261 Ga0157372_10038032 3300013307 Bacteria 5310
262 Ga0157372_10115147 3300013307 Bacteria 3082
263 Ga0157375_10012725 3300013308 Bacteria 7468
264 Ga0157375_10032862 3300013308 Bacteria 4925
265 Ga0157375_10353880 3300013308 Bacteria 1634
266 Ga0157375_10451756 3300013308 Bacteria 1451
267 Ga0157375_10476969 3300013308 Bacteria 1412
268 Ga0163163_10001922 3300014325 Bacteria 17590
269 Ga0157380_10013461 3300014326 Bacteria 5964
270 Ga0157380_10015790 3300014326 Bacteria 5556
271 Ga0182008_10049438 3300014497 Bacteria 2087
272 Ga0157377_10003326 3300014745 Bacteria 7267
273 Ga0157377_10094696 3300014745 Bacteria 1769
274 Ga0157379_10012126 3300014968 Bacteria 7527
275 Ga0157379_10037589 3300014968 Bacteria 4318
276 Ga0157379_10075966 3300014968 Bacteria 3008
277 Ga0157379_10205795 3300014968 Bacteria 1780
278 Ga0157379_10344064 3300014968 Bacteria 1364
279 Ga0157379_10501204 3300014968 Bacteria 1125
280 Ga0157376_10003522 3300014969 Bacteria 10798
281 Ga0157376_10028875 3300014969 Bacteria 4413
282 Ga0157376_10032818 3300014969 Bacteria 4172
283 Ga0157376_10156917 3300014969 Bacteria 2059
284 Ga0183362_10015 3300015683 Bacteria 36270
285 Ga0163161_10007610 3300017792 Bacteria 7492
286 Ga0163161_10013748 3300017792 Bacteria 5638
287 Ga0163161_10020823 3300017792 Bacteria 4605
288 Ga0207697_10015533 3300025315 Bacteria 3145
289 Ga0207656_10021654 3300025321 Bacteria 2571
290 Ga0207656_10053593 3300025321 Bacteria 1751
291 Ga0207682_10008973 3300025893 Bacteria 3951
292 Ga0207682_10011656 3300025893 Bacteria 3436
293 Ga0207642_10002491 3300025899 Bacteria 5731
294 Ga0207688_10012083 3300025901 Bacteria 4697
295 Ga0207688_10040003 3300025901 Bacteria 2605
296 Ga0207680_10005090 3300025903 Bacteria 6265
297 Ga0207680_10046236 3300025903 Bacteria 2572
298 Ga0207680_10235994 3300025903 Bacteria 1258
299 Ga0207645_10004582 3300025907 Bacteria 10192
300 Ga0207645_10004810 3300025907 Bacteria 9928
301 Ga0207645_10014016 3300025907 Bacteria 5377
302 Ga0207645_10019748 3300025907 Bacteria 4414
303 Ga0207645_10047244 3300025907 Bacteria 2749
304 Ga0207643_10036858 3300025908 Bacteria 2743
305 Ga0207643_10071694 3300025908 Bacteria 1995
306 Ga0207705_10027375 3300025909 Bacteria 4065
307 Ga0207705_10028425 3300025909 Bacteria 3986
308 Ga0207684_10019197 3300025910 Bacteria 5848
309 Ga0207684_10052702 3300025910 Bacteria 3453
310 Ga0207684_10084097 3300025910 Bacteria 2710
311 Ga0207707_10007969 3300025912 Bacteria 9208
312 Ga0207707_10008127 3300025912 Bacteria 9110
313 Ga0207695_10005984 3300025913 Bacteria 15908
314 Ga0207671_10011567 3300025914 Bacteria 7166
315 Ga0207671_10012655 3300025914 Bacteria 6772
316 Ga0207693_10219308 3300025915 Bacteria 1494
317 Ga0207660_10225371 3300025917 Bacteria 1472
318 Ga0207662_10001475 3300025918 Bacteria 11429
319 Ga0207662_10205031 3300025918 Bacteria 1278
320 Ga0207657_10028298 3300025919 Bacteria 5115
321 Ga0207657_10090018 3300025919 Bacteria 2561
322 Ga0207649_10040599 3300025920 Bacteria 2829
323 Ga0207649_10171098 3300025920 Bacteria 1513
324 Ga0207652_10033083 3300025921 Bacteria 4352
325 Ga0207652_10049017 3300025921 Bacteria 3613
326 Ga0207652_10084697 3300025921 Bacteria 2778
327 Ga0207652_10189807 3300025921 Bacteria 1848
328 Ga0207646_10053523 3300025922 Bacteria 3610
329 Ga0207646_10264735 3300025922 Unclassified 1554
330 Ga0207646_10303116 3300025922 Bacteria 1443
331 Ga0207646_10456748 3300025922 Bacteria 1152
332 Ga0207681_10008531 3300025923 Bacteria 6257
333 Ga0207681_10039208 3300025923 Bacteria 3143
334 Ga0207681_10053922 3300025923 Bacteria 2731
335 Ga0207694_10028565 3300025924 Bacteria 4252
336 Ga0207694_10160138 3300025924 Bacteria 1817
337 Ga0207650_10002987 3300025925 Bacteria 11668
338 Ga0207650_10024459 3300025925 Bacteria 4293
339 Ga0207650_10025290 3300025925 Bacteria 4228
340 Ga0207650_10028679 3300025925 Bacteria 3994
341 Ga0207650_10260510 3300025925 Bacteria 1406
342 Ga0207659_10008417 3300025926 Bacteria 6402
343 Ga0207659_10008930 3300025926 Bacteria 6247
344 Ga0207659_10009561 3300025926 Bacteria 6064
345 Ga0207659_10011014 3300025926 Bacteria 5698
346 Ga0207659_10075986 3300025926 Bacteria 2467
347 Ga0207659_10086740 3300025926 Bacteria 2328
348 Ga0207687_10085226 3300025927 Bacteria 2292
349 Ga0207687_10136411 3300025927 Bacteria 1856
350 Ga0207644_10012106 3300025931 Bacteria 5722
351 Ga0207644_10096851 3300025931 Bacteria 2209
352 Ga0207644_10213506 3300025931 Bacteria 1527
353 Ga0207644_10330995 3300025931 Bacteria 1233
354 Ga0207706_10002472 3300025933 Bacteria 18012
355 Ga0207706_10009798 3300025933 Bacteria 8792
356 Ga0207706_10057558 3300025933 Bacteria 3424
357 Ga0207706_10125307 3300025933 Bacteria 2259
358 Ga0207706_10136371 3300025933 Bacteria 2159
359 Ga0207686_10006662 3300025934 Bacteria 6230
360 Ga0207686_10085036 3300025934 Bacteria 2074
361 Ga0207709_10002954 3300025935 Bacteria 10369
362 Ga0207709_10010795 3300025935 Bacteria 5029
363 Ga0207709_10048266 3300025935 Bacteria 2593
364 Ga0207670_10090548 3300025936 Bacteria 2161
365 Ga0207670_10178150 3300025936 Bacteria 1599
366 Ga0207669_10018826 3300025937 Bacteria 3580
367 Ga0207669_10019212 3300025937 Bacteria 3552
368 Ga0207669_10034033 3300025937 Bacteria 2883
369 Ga0207669_10072356 3300025937 Bacteria 2170
370 Ga0207669_10140045 3300025937 Bacteria 1678
371 Ga0207704_10000959 3300025938 Bacteria 12771
372 Ga0207704_10010842 3300025938 Bacteria 4463
373 Ga0207704_10045219 3300025938 Bacteria 2615
374 Ga0207665_10002514 3300025939 Bacteria 12330
375 Ga0207665_10044076 3300025939 Bacteria 2985
376 Ga0207691_10001243 3300025940 Bacteria 25438
377 Ga0207691_10006274 3300025940 Bacteria 11477
378 Ga0207691_10010762 3300025940 Bacteria 8782
379 Ga0207691_10013009 3300025940 Bacteria 7968
380 Ga0207691_10018605 3300025940 Bacteria 6584
381 Ga0207691_10097865 3300025940 Bacteria 2622
382 Ga0207711_10031936 3300025941 Bacteria 4449
383 Ga0207711_10037273 3300025941 Bacteria 4129
384 Ga0207689_10003145 3300025942 Bacteria 15148
385 Ga0207689_10004853 3300025942 Bacteria 12116
386 Ga0207689_10043050 3300025942 Bacteria 3733
387 Ga0207689_10079102 3300025942 Bacteria 2702
388 Ga0207661_10182866 3300025944 Bacteria 1832
389 Ga0207679_10028238 3300025945 Bacteria 3890
390 Ga0207679_10050998 3300025945 Bacteria 3027
391 Ga0207679_10132562 3300025945 Bacteria 2001
392 Ga0207679_10207510 3300025945 Bacteria 1641
393 Ga0207679_10249345 3300025945 Bacteria 1508
394 Ga0207667_10003540 3300025949 Bacteria 19312
395 Ga0207667_10014242 3300025949 Bacteria 9071
396 Ga0207667_10125317 3300025949 Bacteria 2645
397 Ga0207667_10132106 3300025949 Bacteria 2571
398 Ga0207651_10005549 3300025960 Bacteria 6493
399 Ga0207651_10317358 3300025960 Bacteria 1301
400 Ga0207651_10405566 3300025960 Bacteria 1160
401 Ga0207712_10011898 3300025961 Bacteria 5548
402 Ga0207668_10012804 3300025972 Bacteria 5145
403 Ga0207668_10079913 3300025972 Bacteria 2367
404 Ga0207668_10097137 3300025972 Bacteria 2179
405 Ga0207668_10268237 3300025972 Bacteria 1394
406 Ga0207640_10289708 3300025981 Bacteria 1290
407 Ga0207658_10003494 3300025986 Bacteria 11091
408 Ga0207658_10027074 3300025986 Bacteria 4026
409 Ga0207658_10051683 3300025986 Bacteria 3029
410 Ga0207658_10114250 3300025986 Bacteria 2140
411 Ga0207677_10003875 3300026023 Bacteria 7966
412 Ga0207703_10001799 3300026035 Bacteria 19132
413 Ga0207703_10191997 3300026035 Bacteria 1809
414 Ga0207639_10036147 3300026041 Bacteria 3659
415 Ga0207639_10109127 3300026041 Bacteria 2251
416 Ga0207678_10063914 3300026067 Bacteria 3162
417 Ga0207678_10064277 3300026067 Bacteria 3153
418 Ga0207678_10089334 3300026067 Bacteria 2634
419 Ga0207708_10012201 3300026075 Bacteria 6409
420 Ga0207702_10012690 3300026078 Bacteria 7011
421 Ga0207702_10102791 3300026078 Bacteria 2526
422 Ga0207702_10331977 3300026078 Bacteria 1451
423 Ga0207641_10015255 3300026088 Bacteria 6295
424 Ga0207641_10020481 3300026088 Bacteria 5432
425 Ga0207648_10004422 3300026089 Bacteria 14428
426 Ga0207648_10004667 3300026089 Bacteria 14019
427 Ga0207648_10014429 3300026089 Bacteria 7301
428 Ga0207648_10017778 3300026089 Bacteria 6456
429 Ga0207648_10021486 3300026089 Bacteria 5801
430 Ga0207648_10041166 3300026089 Bacteria 4058
431 Ga0207648_10209817 3300026089 Bacteria 1728
432 Ga0207676_10003245 3300026095 Bacteria 11579
433 Ga0207676_10005019 3300026095 Bacteria 9371
434 Ga0207676_10011922 3300026095 Bacteria 6220
435 Ga0207676_10030963 3300026095 Bacteria 4020
436 Ga0207676_10035996 3300026095 Bacteria 3762
437 Ga0207676_10052933 3300026095 Bacteria 3175
438 Ga0207674_10105895 3300026116 Bacteria 2790
439 Ga0207674_10212931 3300026116 Bacteria 1881
440 Ga0207674_10322838 3300026116 Bacteria 1493
441 Ga0207675_100003929 3300026118 Bacteria 14428
442 Ga0207675_100004517 3300026118 Bacteria 13434
443 Ga0207675_100007314 3300026118 Bacteria 10439
444 Ga0207675_100017362 3300026118 Bacteria 6718
445 Ga0207675_100076660 3300026118 Bacteria 3131
446 Ga0207683_10004763 3300026121 Bacteria 11684
447 Ga0207683_10006504 3300026121 Bacteria 10000
448 Ga0207683_10007125 3300026121 Bacteria 9584
449 Ga0207683_10054461 3300026121 Bacteria 3508
450 Ga0207683_10166820 3300026121 Bacteria 1992
451 Ga0207683_10392501 3300026121 Bacteria 1276
452 Ga0207698_10013120 3300026142 Bacteria 5455
453 Ga0207698_10033857 3300026142 Bacteria 3717
454 Ga0207698_10048625 3300026142 Bacteria 3221
455 Ga0207698_10136283 3300026142 Bacteria 2107
456 Ga0207698_10187381 3300026142 Bacteria 1839
457 Ga0207698_10329061 3300026142 Bacteria 1434
458 Ga0209969_1000217 3300027360 Bacteria 7674
459 Ga0209967_1000307 3300027364 Bacteria 6635
460 Ga0209981_1001368 3300027378 Bacteria 3087
461 Ga0210000_1002801 3300027462 Bacteria 2489
462 Ga0209968_1001103 3300027526 Bacteria 4119
463 Ga0209999_1000946 3300027543 Bacteria 4895
464 Ga0207428_10000027 3300027907 Bacteria 250186
465 Ga0207428_10036411 3300027907 Bacteria 4014
466 Ga0207428_10062275 3300027907 Bacteria 2951
467 Ga0207428_10108610 3300027907 Bacteria 2137
468 Ga0268265_10003470 3300028380 Bacteria 11327
469 Ga0268265_10004016 3300028380 Bacteria 10360
470 Ga0268265_10077352 3300028380 Bacteria 2613
471 Ga0268265_10313384 3300028380 Bacteria 1418
472 Ga0268265_10374043 3300028380 Bacteria 1308
473 Ga0268265_10547374 3300028380 Bacteria 1098
474 Ga0268264_10015864 3300028381 Bacteria 6169
475 Ga0268264_10020878 3300028381 Bacteria 5350
476 Ga0268264_10100740 3300028381 Bacteria 2509
477 Ga0307517_10142582 3300028786 Bacteria 1676
478 Ga0307513_10013819 3300031456 Bacteria 9897
479 Ga0307408_100048450 3300031548 Bacteria 3048
480 Ga0307408_100096580 3300031548 Bacteria 2243
481 Ga0316579_10005426 3300031691 Bacteria 5146
482 Ga0265314_10044571 3300031711 Bacteria 3144
483 Ga0265314_10084490 3300031711 Bacteria 2084
484 Ga0307516_10046141 3300031730 Bacteria 4301
485 Ga0307516_10103018 3300031730 Bacteria 2668
486 Ga0307405_10003735 3300031731 Bacteria 7071
487 Ga0307413_10026207 3300031824 Bacteria 3209
488 Ga0307413_10068531 3300031824 Bacteria 2223
489 Ga0307410_10013767 3300031852 Bacteria 4733
490 Ga0307410_10050243 3300031852 Bacteria 2803
491 Ga0307410_10147739 3300031852 Bacteria 1746
492 Ga0307406_10005448 3300031901 Bacteria 6964
493 Ga0307407_10002451 3300031903 Bacteria 7268
494 Ga0307412_10009014 3300031911 Bacteria 5717
495 Ga0307409_100022174 3300031995 Bacteria 4371
496 Ga0307409_100125173 3300031995 Bacteria 2185
497 Ga0307416_100001584 3300032002 Bacteria 12484
498 Ga0307416_100056487 3300032002 Bacteria 3169
499 Ga0307416_100360565 3300032002 Bacteria 1476
500 Ga0307414_10031261 3300032004 Bacteria 3490
501 Ga0307414_10243690 3300032004 Bacteria 1490
502 Ga0307411_10002419 3300032005 Bacteria 8242
503 Ga0307411_10361896 3300032005 Bacteria 1187
504 Ga0316583_10009254 3300032133 Bacteria 3550
505 Ga0373930_0036247 3300034816 Bacteria 1034
506 Ga0373926_0011382 3300035083 Bacteria 2993
507 Ga0373926_0049702 3300035083 Bacteria 1510
508 Ga0373923_0061129 3300035111 Bacteria 1600
509 Ga0373953_0063429 3300035117 Bacteria 1514
510 Ga0373954_0000033 3300035118 Bacteria 54385
511 Ga0373954_0038525 3300035118 Bacteria 2224
512 Ga0373956_0032194 3300035119 Bacteria 2300
513 Ga0373957_0013064 3300035120 Bacteria 2809
514 Ga0373946_0123443 3300035171 Bacteria 1184
515 Ga0373955_0021854 3300035172 Bacteria 3237
516 Ga0373942_0033933 3300035207 Bacteria 1363
517 Ga0373961_0005571 3300035241 Bacteria 3025
518 Ga0316574_0006010 3300035398 Bacteria 6522
519 Ga0373924_0003359 3300035410 Bacteria 5498
520 Ga0373931_0006797 3300035691 Bacteria 5374
521 Ga0373935_0129958 3300035692 Bacteria 1691
522 Ga0373933_0002353 3300035724 Bacteria 10700
523 Ga0373933_0006414 3300035724 Bacteria 6403
524 Ga0373933_0096400 3300035724 Bacteria 1831
525 Ga0373933_0121621 3300035724 Bacteria 1635
526 Ga0373947_0088309 3300035725 Bacteria 1929
527 Ga0373937_0000377 3300036401 Bacteria 41470
528 Ga0373937_0003134 3300036401 Bacteria 13831
529 Ga0373937_0028570 3300036401 Bacteria 5047
530 Ga0373937_0055460 3300036401 Bacteria 3638
531 Ga0373937_0113545 3300036401 Bacteria 2521
532 Ga0316582_0007634 3300036647 Bacteria 5768
533 Ga0373925_0142864 3300037068 Bacteria 1874
534 Ga0395899_0081316 3300037312 Bacteria 2357
535 Ga0395899_0199703 3300037312 Bacteria 1395
536 Ga0395900_0010670 3300037418 Bacteria 9395
537 Ga0395900_0021369 3300037418 Bacteria 6616
538 Ga0395898_0017213 3300037466 Bacteria 7381
539 Ga0395898_0091709 3300037466 Bacteria 2923
540 Ga0395905_0000180 3300037471 Bacteria 100693
541 Ga0395905_0035447 3300037471 Bacteria 4685
542 Ga0395905_0055651 3300037471 Bacteria 3702
543 Ga0395905_0087092 3300037471 Bacteria 2928
544 Ga0395905_0151024 3300037471 Bacteria 2185
545 Ga0395905_0225980 3300037471 Bacteria 1751
546 Ga0395905_0275369 3300037471 Bacteria 1569
547 Ga0395901_0024791 3300038443 Bacteria 6157
548 Ga0395901_0061190 3300038443 Bacteria 3918
549 Ga0395901_0108297 3300038443 Bacteria 2917
550 Ga0395901_0211074 3300038443 Bacteria 2032
551 Ga0242420_023590 3300038996 Bacteria 1111
552 Ga0436365_0316538 3300039437 Bacteria 10934
553 Ga0436365_1397879 3300039437 Bacteria 1431
554 Ga0436360_1095664 3300039438 Bacteria 2155
555 Ga0436360_1357442 3300039438 Bacteria 1943
556 Ga0436363_0707452 3300039450 Bacteria 3226
557 Ga0439461_0002114 3300041410 Bacteria 3144
558 Ga0451853_1410340 3300041512 Bacteria 1546
559 Ga0439441_011880 3300042001 Bacteria 1485
560 Ga0439455_0016111 3300042012 Bacteria 1725
561 Ga0439446_0001858 3300042156 Bacteria 4950
562 Ga0439435_0000049 3300042436 Bacteria 13342
563 Ga0439464_0002254 3300042439 Bacteria 4719
564 Ga0451577_0003923 3300042876 Bacteria 16072
565 Ga0466969_0067162 3300044656 Bacteria 1730
566 Ga0466965_0144803 3300044683 Bacteria 1239
567 Ga0466966_0003903 3300044684 Bacteria 9843
568 Ga0453684_0101355 3300044712 Bacteria 3523
569 Ga0453684_0233298 3300044712 Bacteria 2123
570 Ga0466968_0019351 3300044735 Bacteria 2742
571 Ga0451576_0006891 3300045051 Bacteria 13760
572 Ga0451576_0031204 3300045051 Bacteria 5685
573 Ga0451576_0066649 3300045051 Bacteria 3747
574 Ga0451576_0170056 3300045051 Bacteria 2275
575 Ga0466967_0580785 3300045976 Bacteria 1105
576 Ga0495590_0023134 3300046457 Bacteria 2196
577 Ga0495651_0107602 3300046462 Bacteria 2065
578 Ga0495580_0046786 3300046472 Bacteria 3069
579 Ga0495605_0051535 3300046474 Bacteria 2004
580 Ga0495639_0141765 3300046475 Bacteria 1156
581 Ga0495662_0010089 3300046476 Bacteria 4633
582 Ga0495662_0082312 3300046476 Bacteria 1566
583 Ga0495585_0093133 3300046492 Bacteria 1621
584 Ga0495628_0113451 3300046516 Bacteria 2083
585 Ga0495630_0006364 3300046517 Bacteria 8393
586 Ga0495632_0011281 3300046519 Bacteria 5224
587 Ga0495637_0023375 3300046520 Bacteria 2811
588 Ga0495652_0353425 3300046529 Bacteria 1052
589 Ga0495597_0011926 3300046542 Bacteria 4204
590 Ga0495645_0042727 3300046543 Bacteria 3305
591 Ga0495645_0096540 3300046543 Bacteria 2106
592 Ga0495667_0042381 3300046559 Bacteria 3018
593 Ga0495625_0046020 3300046660 Bacteria 3150
594 Ga0495635_0104280 3300046663 Bacteria 1938
595 Ga0495635_0113405 3300046663 Bacteria 1851
596 Ga0495659_0012239 3300046664 Bacteria 2776
597 Ga0495588_0048044 3300046674 Bacteria 2192
598 Ga0495646_0072339 3300046680 Bacteria 2028
599 Ga0495658_0005282 3300046683 Bacteria 6355
600 Ga0495658_0056038 3300046683 Bacteria 2247
601 Ga0495669_0010719 3300046684 Bacteria 3879
602 Ga0495613_0116652 3300046689 Bacteria 1920
603 Ga0495613_0138516 3300046689 Bacteria 1740
604 Ga0495624_0027751 3300046690 Bacteria 3704
605 Ga0495649_0000541 3300046694 Bacteria 32077
606 Ga0495600_0041694 3300046809 Bacteria 2992
607 Ga0495600_0258318 3300046809 Bacteria 1107
608 Ga0495660_0037502 3300046810 Bacteria 2699
609 Ga0495636_0017975 3300047318 Bacteria 2834
610 Ga0495636_0052206 3300047318 Bacteria 1715
611 Ga0495674_0096297 3300047319 Bacteria 2523
612 Ga0495674_0194566 3300047319 Bacteria 1684
613 Ga0495672_0042125 3300047320 Bacteria 2755
614 Ga0495687_000174 3300047443 Bacteria 95031
615 Ga0495677_0047183 3300047445 Bacteria 1581
616 Ga0495686_0006540 3300047472 Bacteria 8894
617 Ga0495602_0129132 3300048088 Bacteria 2019
618 Ga0495626_0021987 3300048091 Bacteria 3155
619 Ga0496100_0036459 3300048903 Bacteria 3102
620 Ga0496100_0131429 3300048903 Bacteria 1764
621 Ga0496101_0011006 3300048904 Bacteria 5993
622 Ga0496102_0018381 3300048905 Bacteria 6142
623 Ga0496102_0377375 3300048905 Bacteria 1334
624 Ga0496102_0554357 3300048905 Bacteria 1072
625 Ga0496103_0270195 3300048906 Bacteria 1094
626 Ga0496104_0003573 3300048907 Bacteria 13420
627 Ga0496104_0072463 3300048907 Bacteria 3276
628 Ga0496104_0481520 3300048907 Bacteria 1152
629 Ga0496106_0187932 3300048909 Bacteria 1641
630 Ga0496106_0208169 3300048909 Bacteria 1558
631 Ga0496106_0274454 3300048909 Bacteria 1350
632 Ga0496107_0008481 3300048910 Bacteria 7114
633 Ga0496108_0025297 3300048911 Bacteria 4891
634 Ga0496108_0082335 3300048911 Bacteria 2729
635 Ga0496109_0058844 3300048912 Bacteria 3510
636 Ga0496110_0018001 3300048913 Bacteria 5918
637 Ga0496110_0085623 3300048913 Bacteria 2813
638 Ga0496110_0150426 3300048913 Bacteria 2108
639 Ga0496110_0150933 3300048913 Bacteria 2104
640 Ga0496111_0086443 3300048914 Bacteria 2294
641 Ga0496112_0135103 3300048915 Bacteria 2437
642 Ga0496112_0258202 3300048915 Bacteria 1692
643 Ga0496114_0020230 3300048917 Bacteria 5401
644 Ga0496114_0290254 3300048917 Bacteria 1443
645 Ga0496114_0318261 3300048917 Bacteria 1375
646 Ga0496115_0012118 3300048918 Bacteria 6483
647 Ga0496115_0169936 3300048918 Bacteria 1803
648 Ga0496115_0265233 3300048918 Bacteria 1412
649 Ga0501034_0093439 3300049571 Bacteria 3004
650 Ga0501040_0007117 3300049576 Bacteria 7244
651 Ga0501042_0290360 3300049578 Bacteria 1181
652 Ga0501043_0000149 3300049579 Bacteria 65122
653 Ga0501046_0000092 3300049580 Bacteria 97456
654 Ga0501046_0161104 3300049580 Bacteria 1687
655 Ga0501047_0000028 3300049581 Bacteria 220279
656 Ga0501047_0099445 3300049581 Bacteria 2788
657 Ga0501048_0000097 3300049582 Bacteria 47728
658 Ga0501070_0036022 3300049586 Bacteria 4132
659 Ga0501071_0000638 3300049587 Bacteria 18217
660 Ga0501071_0192928 3300049587 Bacteria 1528
661 Ga0501072_0039243 3300049588 Bacteria 3718
662 Ga0501074_0206978 3300049590 Bacteria 1398
663 Ga0501075_0051262 3300049591 Bacteria 3103
664 Ga0501075_0109391 3300049591 Bacteria 2101
665 Ga0501076_0023976 3300049592 Bacteria 4710
666 Ga0501076_0068664 3300049592 Bacteria 2831
667 Ga0501079_0040802 3300049741 Bacteria 3582
668 Ga0501080_0015068 3300049742 Bacteria 7125
669 Ga0501080_0049394 3300049742 Bacteria 3915
670 Ga0501080_0210890 3300049742 Bacteria 1780
671 Ga0501081_0103777 3300049743 Bacteria 2012
672 Ga0501083_0011934 3300049744 Bacteria 6087
673 Ga0501035_0025466 3300049822 Bacteria 5424
674 Ga0501044_0448564 3300049823 Bacteria 1197
675 Ga0501045_0002894 3300049824 Bacteria 11731
676 nmdc:mga03683_20389_c1 3300050489 Bacteria 2543
677 nmdc:mga03n38_52854_c1 3300050490 Bacteria 1820
678 nmdc:mga00v17_112445_c1 3300050491 Bacteria 1728
679 nmdc:mga0k408_1076_c1 3300050493 Bacteria 15014
680 nmdc:mga0k408_1264_c1 3300050493 Bacteria 13764
681 nmdc:mga0k408_63487_c1 3300050493 Bacteria 2149
682 nmdc:mga06z11_13801_c1 3300050494 Bacteria 3561
683 nmdc:mga07m45_12274_c1 3300050496 Bacteria 4525
684 nmdc:mga07m45_165924_c1 3300050496 Bacteria 1283
685 nmdc:mga07m45_309_c1 3300050496 Bacteria 19711
686 nmdc:mga07m45_37065_c1 3300050496 Bacteria 2719
687 nmdc:mga07m45_756_c1 3300050496 Bacteria 13842
688 nmdc:mga05p37_21838_c1 3300050507 Bacteria 7754
689 nmdc:mga05p37_980_c1 3300050507 Bacteria 32442
690 nmdc:mga09592_188883_c1 3300050508 Bacteria 1783
691 nmdc:mga09592_352557_c1 3300050508 Bacteria 1273
692 nmdc:mga09592_48847_c1 3300050508 Bacteria 3568
693 nmdc:mga09592_947_c1 3300050508 Bacteria 22820
694 nmdc:mga0qj67_705_c1 3300050509 Bacteria 22775
695 nmdc:mga0qj67_9318_c1 3300050509 Bacteria 7302
696 nmdc:mga06r32_2106_c1 3300050510 Bacteria 17820
697 nmdc:mga06r32_318505_c1 3300050510 Bacteria 1541
698 nmdc:mga06r32_48707_c1 3300050510 Bacteria 4051
699 nmdc:mga06r32_78611_c1 3300050510 Bacteria 3207
700 nmdc:mga08y16_365591_c1 3300050511 Bacteria 1481
701 nmdc:mga08y16_667_c1 3300050511 Bacteria 32408
702 nmdc:mga08y16_71819_c1 3300050511 Bacteria 3607
703 nmdc:mga08y16_72879_c1 3300050511 Bacteria 3579
704 nmdc:mga0n895_119372_c1 3300050512 Bacteria 2658
705 nmdc:mga0n895_418421_c1 3300050512 Bacteria 1355
706 nmdc:mga0n895_51200_c1 3300050512 Bacteria 4051
707 nmdc:mga0n895_55158_c1 3300050512 Bacteria 3911
708 nmdc:mga0n895_58125_c1 3300050512 Bacteria 3813
709 nmdc:mga0rr50_173168_c1 3300050513 Bacteria 1760
710 nmdc:mga0rr50_173434_c1 3300050513 Bacteria 1759
711 nmdc:mga0rr50_17843_c1 3300050513 Bacteria 4752
712 nmdc:mga0rr50_31256_c1 3300050513 Bacteria 3780
713 nmdc:mga0rr50_340174_c1 3300050513 Bacteria 1261
714 nmdc:mga0rr50_3812_c1 3300050513 Bacteria 8753
715 nmdc:mga0rr50_38273_c1 3300050513 Bacteria 3469
716 nmdc:mga08x19_157982_c1 3300050514 Bacteria 1539
717 nmdc:mga08x19_166506_c1 3300050514 Bacteria 1499
718 nmdc:mga08x19_56565_c1 3300050514 Bacteria 2532
719 nmdc:mga08x19_81297_c1 3300050514 Bacteria 2128
720 nmdc:mga0a205_329800_c1 3300050515 Bacteria 1396
721 nmdc:mga0sz30_6627_c1 3300050516 Bacteria 4313
722 Ga0495612_0097143 3300053078 Bacteria 1252
723 Ga0495655_0042233 3300053083 Bacteria 1170
724 Ga0495595_0019337 3300053084 Bacteria 2955
725 Ga0495619_0024442 3300053085 Bacteria 3875
726 Ga0500578_0075253 3300053086 Bacteria 2151
727 Ga0500651_0132627 3300053093 Bacteria 1506
728 Ga0500658_0005409 3300053134 Bacteria 4747
729 Ga0500568_0010847 3300053139 Bacteria 4250
730 Ga0501084_0104571 3300054114 Bacteria 2378
731 Ga0501084_0273568 3300054114 Bacteria 1426
732 Ga0590071_017498 3300059421 Bacteria 1684
733 Ga0590077_003466 3300059426 Bacteria 3261
734 Ga0501082_0054856 3300060353 Bacteria 3435

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100173000 Ga0070670_1001730002 254
2 3300053083 Ga0495655_0042233 Ga0495655_0042233_29_1036 255
3 3300035171 Ga0373946_0123443 Ga0373946_0123443_300_1169 266
4 3300039437 Ga0436365_0316538 Ga0436365_0316538_1542_2561 267
5 3300005719 Ga0068861_100433721 Ga0068861_1004337211 270
6 3300005841 Ga0068863_100188712 Ga0068863_1001887122 272
7 3300048917 Ga0496114_0290254 Ga0496114_0290254_402_1424 272
8 3300005545 Ga0070695_100287097 Ga0070695_1002870971 273
9 3300048913 Ga0496110_0085623 Ga0496110_0085623_302_1351 275
10 3300005347 Ga0070668_100130216 Ga0070668_1001302162 276
11 3300005719 Ga0068861_100148714 Ga0068861_1001487142 276
12 3300005844 Ga0068862_100296552 Ga0068862_1002965522 276
13 3300009148 Ga0105243_10149966 Ga0105243_101499661 276
14 3300025972 Ga0207668_10079913 Ga0207668_100799132 276
15 3300026118 Ga0207675_100017362 Ga0207675_1000173623 276
16 3300028380 Ga0268265_10547374 Ga0268265_105473741 276
17 3300050513 nmdc:mga0rr50_3812_c1 nmdc:mga0rr50_3812_c1_3906_4916 279
18 3300005335 Ga0070666_10001889 Ga0070666_100018897 281
19 3300005354 Ga0070675_100002630 Ga0070675_1000026307 281
20 3300005456 Ga0070678_100020488 Ga0070678_1000204883 281
21 3300005459 Ga0068867_100088689 Ga0068867_1000886892 281
22 3300005466 Ga0070685_10091391 Ga0070685_100913912 281
23 3300005618 Ga0068864_100001309 Ga0068864_10000130915 281
24 3300005841 Ga0068863_100013734 Ga0068863_1000137344 281
25 3300005842 Ga0068858_100002892 Ga0068858_10000289210 281
26 3300006237 Ga0097621_100048088 Ga0097621_1000480882 281
27 3300009177 Ga0105248_10079168 Ga0105248_100791683 281
28 3300013296 Ga0157374_10096546 Ga0157374_100965462 281
29 3300013306 Ga0163162_10036523 Ga0163162_100365234 281
30 3300014325 Ga0163163_10001922 Ga0163163_1000192212 281
31 3300014745 Ga0157377_10094696 Ga0157377_100946962 281
32 3300014968 Ga0157379_10037589 Ga0157379_100375893 281
33 3300025903 Ga0207680_10046236 Ga0207680_100462362 281
34 3300025907 Ga0207645_10047244 Ga0207645_100472442 281
35 3300025926 Ga0207659_10008930 Ga0207659_100089303 281
36 3300025931 Ga0207644_10012106 Ga0207644_100121065 281
37 3300025941 Ga0207711_10037273 Ga0207711_100372733 281
38 3300025960 Ga0207651_10005549 Ga0207651_100055495 281
39 3300025986 Ga0207658_10051683 Ga0207658_100516832 281
40 3300026088 Ga0207641_10020481 Ga0207641_100204815 281
41 3300026089 Ga0207648_10021486 Ga0207648_100214862 281
42 3300026095 Ga0207676_10005019 Ga0207676_100050194 281
43 3300026121 Ga0207683_10007125 Ga0207683_100071256 281
44 3300026142 Ga0207698_10013120 Ga0207698_100131203 281
45 3300048913 Ga0496110_0150426 Ga0496110_0150426_64_1083 281
46 3300005355 Ga0070671_100021081 Ga0070671_1000210813 283
47 3300025901 Ga0207688_10040003 Ga0207688_100400032 283
48 3300025907 Ga0207645_10004810 Ga0207645_100048107 284
49 3300048913 Ga0496110_0150933 Ga0496110_0150933_679_1686 284
50 3300048915 Ga0496112_0135103 Ga0496112_0135103_940_1947 284
51 3300005563 Ga0068855_100009666 Ga0068855_1000096665 285
52 3300006051 Ga0075364_10127340 Ga0075364_101273402 285
53 3300006353 Ga0075370_10042799 Ga0075370_100427992 285
54 3300009093 Ga0105240_10012681 Ga0105240_100126815 285
55 3300013308 Ga0157375_10353880 Ga0157375_103538802 285
56 3300025908 Ga0207643_10071694 Ga0207643_100716942 285
57 3300025913 Ga0207695_10005984 Ga0207695_100059845 285
58 3300025937 Ga0207669_10140045 Ga0207669_101400452 285
59 3300025949 Ga0207667_10003540 Ga0207667_1000354016 285
60 3300031824 Ga0307413_10068531 Ga0307413_100685311 285
61 3300046474 Ga0495605_0051535 Ga0495605_0051535_824_1807 285
62 3300046519 Ga0495632_0011281 Ga0495632_0011281_188_1171 285
63 3300046694 Ga0495649_0000541 Ga0495649_0000541_4171_5154 285
64 3300046809 Ga0495600_0258318 Ga0495600_0258318_25_1044 285
65 3300046810 Ga0495660_0037502 Ga0495660_0037502_1706_2689 285
66 3300050491 nmdc:mga00v17_112445_c1 nmdc:mga00v17_112445_c1_531_1538 285
67 3300050496 nmdc:mga07m45_37065_c1 nmdc:mga07m45_37065_c1_175_1182 285
68 3300053084 Ga0495595_0019337 Ga0495595_0019337_1342_2361 285
69 3300053085 Ga0495619_0024442 Ga0495619_0024442_2191_3210 285
70 3300053093 Ga0500651_0132627 Ga0500651_0132627_188_1171 285
71 3300053134 Ga0500658_0005409 Ga0500658_0005409_1601_2584 285
72 3300005353 Ga0070669_100161509 Ga0070669_1001615092 286
73 3300005457 Ga0070662_100394058 Ga0070662_1003940581 286
74 3300005459 Ga0068867_100327287 Ga0068867_1003272871 286
75 3300005719 Ga0068861_100186909 Ga0068861_1001869091 286
76 3300009553 Ga0105249_10199009 Ga0105249_101990092 286
77 3300015683 Ga0183362_10015 Ga0183362_1001515 286
78 3300017792 Ga0163161_10013748 Ga0163161_100137484 286
79 3300025940 Ga0207691_10013009 Ga0207691_100130092 286
80 3300025972 Ga0207668_10097137 Ga0207668_100971372 286
81 3300026089 Ga0207648_10209817 Ga0207648_102098171 286
82 3300006353 Ga0075370_10004740 Ga0075370_100047401 287
83 3300009147 Ga0114129_10589906 Ga0114129_105899061 287
84 3300039438 Ga0436360_1357442 Ga0436360_1357442_82_1110 287
85 3300042439 Ga0439464_0002254 Ga0439464_0002254_1339_2361 287
86 3300045051 Ga0451576_0031204 Ga0451576_0031204_343_1389 287
87 3300050493 nmdc:mga0k408_1264_c1 nmdc:mga0k408_1264_c1_6095_7084 287
88 3300050496 nmdc:mga07m45_309_c1 nmdc:mga07m45_309_c1_3439_4428 287
89 3300005331 Ga0070670_100009195 Ga0070670_1000091955 288
90 3300005333 Ga0070677_10017059 Ga0070677_100170592 288
91 3300005354 Ga0070675_100061955 Ga0070675_1000619551 288
92 3300005367 Ga0070667_100093719 Ga0070667_1000937192 288
93 3300005456 Ga0070678_100012645 Ga0070678_1000126453 288
94 3300005466 Ga0070685_10114797 Ga0070685_101147972 288
95 3300005543 Ga0070672_100055033 Ga0070672_1000550334 288
96 3300005564 Ga0070664_100053624 Ga0070664_1000536243 288
97 3300005841 Ga0068863_100444600 Ga0068863_1004446002 288
98 3300006237 Ga0097621_100201581 Ga0097621_1002015812 288
99 3300006358 Ga0068871_100071329 Ga0068871_1000713293 288
100 3300013306 Ga0163162_10193531 Ga0163162_101935312 288
101 3300025923 Ga0207681_10053922 Ga0207681_100539223 288
102 3300025925 Ga0207650_10025290 Ga0207650_100252902 288
103 3300025926 Ga0207659_10011014 Ga0207659_100110143 288
104 3300025933 Ga0207706_10125307 Ga0207706_101253072 288
105 3300025937 Ga0207669_10072356 Ga0207669_100723563 288
106 3300025940 Ga0207691_10001243 Ga0207691_1000124321 288
107 3300025945 Ga0207679_10028238 Ga0207679_100282382 288
108 3300025960 Ga0207651_10405566 Ga0207651_104055662 288
109 3300026089 Ga0207648_10014429 Ga0207648_100144295 288
110 3300026095 Ga0207676_10035996 Ga0207676_100359962 288
111 3300026121 Ga0207683_10004763 Ga0207683_100047633 288
112 3300026142 Ga0207698_10136283 Ga0207698_101362832 288
113 3300032002 Ga0307416_100360565 Ga0307416_1003605652 289
114 3300046660 Ga0495625_0046020 Ga0495625_0046020_96_1079 289
115 3300049579 Ga0501043_0000149 Ga0501043_0000149_21952_22962 289
116 3300049580 Ga0501046_0000092 Ga0501046_0000092_42297_43307 289
117 3300049581 Ga0501047_0000028 Ga0501047_0000028_197492_198502 289
118 3300049582 Ga0501048_0000097 Ga0501048_0000097_21346_22356 289
119 3300049823 Ga0501044_0448564 Ga0501044_0448564_117_1127 289
120 3300049824 Ga0501045_0002894 Ga0501045_0002894_3753_4763 289
121 3300009147 Ga0114129_10386532 Ga0114129_103865322 290
122 3300028786 Ga0307517_10142582 Ga0307517_101425822 290
123 3300038996 Ga0242420_023590 Ga0242420_023590_210_1097 290
124 3300046457 Ga0495590_0023134 Ga0495590_0023134_94_1077 290
125 3300050508 nmdc:mga09592_188883_c1 nmdc:mga09592_188883_c1_653_1660 290
126 3300050510 nmdc:mga06r32_78611_c1 nmdc:mga06r32_78611_c1_801_1808 290
127 3300053086 Ga0500578_0075253 Ga0500578_0075253_266_1249 290
128 3300013296 Ga0157374_10277089 Ga0157374_102770891 291
129 3300005340 Ga0070689_100228459 Ga0070689_1002284592 292
130 3300005577 Ga0068857_100198475 Ga0068857_1001984752 292
131 3300005617 Ga0068859_100029524 Ga0068859_1000295244 292
132 3300006177 Ga0075362_10002737 Ga0075362_100027375 292
133 3300006931 Ga0097620_100029524 Ga0097620_1000295244 292
134 3300009545 Ga0105237_10020953 Ga0105237_100209533 292
135 3300010375 Ga0105239_10018223 Ga0105239_100182235 292
136 3300025903 Ga0207680_10235994 Ga0207680_102359941 292
137 3300025914 Ga0207671_10011567 Ga0207671_100115673 292
138 3300025933 Ga0207706_10136371 Ga0207706_101363712 292
139 3300025936 Ga0207670_10178150 Ga0207670_101781502 292
140 3300026067 Ga0207678_10089334 Ga0207678_100893342 292
141 3300026116 Ga0207674_10212931 Ga0207674_102129312 292
142 3300031852 Ga0307410_10050243 Ga0307410_100502432 292
143 3300031852 Ga0307410_10147739 Ga0307410_101477392 292
144 3300031995 Ga0307409_100125173 Ga0307409_1001251732 292
145 3300032002 Ga0307416_100056487 Ga0307416_1000564872 292
146 3300032004 Ga0307414_10243690 Ga0307414_102436902 292
147 3300050489 nmdc:mga03683_20389_c1 nmdc:mga03683_20389_c1_125_1117 292
148 3300048909 Ga0496106_0274454 Ga0496106_0274454_11_931 293
149 3300005367 Ga0070667_100165616 Ga0070667_1001656162 294
150 3300025942 Ga0207689_10079102 Ga0207689_100791023 294
151 3300035724 Ga0373933_0096400 Ga0373933_0096400_874_1821 294
152 3300006058 Ga0075432_10035439 Ga0075432_100354392 295
153 3300009094 Ga0111539_10006412 Ga0111539_1000641210 295
154 3300027907 Ga0207428_10000027 Ga0207428_10000027111 295
155 3300031548 Ga0307408_100096580 Ga0307408_1000965802 295
156 3300047472 Ga0495686_0006540 Ga0495686_0006540_4439_5452 295
157 3300050511 nmdc:mga08y16_667_c1 nmdc:mga08y16_667_c1_27884_28888 295
158 3300031730 Ga0307516_10103018 Ga0307516_101030182 296
159 3300042001 Ga0439441_011880 Ga0439441_011880_240_1199 296
160 3300042012 Ga0439455_0016111 Ga0439455_0016111_195_1196 296
161 3300048903 Ga0496100_0131429 Ga0496100_0131429_220_1227 296
162 3300048907 Ga0496104_0003573 Ga0496104_0003573_1619_2626 296
163 3300048915 Ga0496112_0258202 Ga0496112_0258202_381_1388 296
164 3300048917 Ga0496114_0318261 Ga0496114_0318261_68_1075 296
165 3300048918 Ga0496115_0169936 Ga0496115_0169936_498_1505 296
166 3300053139 Ga0500568_0010847 Ga0500568_0010847_1472_2461 296
167 3300005338 Ga0068868_100120478 Ga0068868_1001204782 297
168 3300006195 Ga0075366_10086166 Ga0075366_100861661 297
169 3300041410 Ga0439461_0002114 Ga0439461_0002114_1664_2659 297
170 3300042156 Ga0439446_0001858 Ga0439446_0001858_656_1651 297
171 3300042436 Ga0439435_0000049 Ga0439435_0000049_3139_4134 297
172 3300049591 Ga0501075_0109391 Ga0501075_0109391_186_1193 297
173 3300049592 Ga0501076_0023976 Ga0501076_0023976_2522_3529 297
174 3300005467 Ga0070706_100184916 Ga0070706_1001849162 298
175 3300005468 Ga0070707_100337339 Ga0070707_1003373392 298
176 3300025910 Ga0207684_10084097 Ga0207684_100840972 298
177 3300025922 Ga0207646_10456748 Ga0207646_104567482 298
178 3300032005 Ga0307411_10361896 Ga0307411_103618961 298
179 3300035083 Ga0373926_0011382 Ga0373926_0011382_367_1467 298
180 3300035725 Ga0373947_0088309 Ga0373947_0088309_283_1383 298
181 3300005331 Ga0070670_100142133 Ga0070670_1001421332 299
182 3300005444 Ga0070694_100005593 Ga0070694_1000055936 299
183 3300005457 Ga0070662_100171509 Ga0070662_1001715092 299
184 3300005459 Ga0068867_100051748 Ga0068867_1000517482 299
185 3300005545 Ga0070695_100019186 Ga0070695_1000191863 299
186 3300006048 Ga0075363_100130919 Ga0075363_1001309191 299
187 3300006051 Ga0075364_10168113 Ga0075364_101681132 299
188 3300006178 Ga0075367_10125329 Ga0075367_101253292 299
189 3300006195 Ga0075366_10039304 Ga0075366_100393042 299
190 3300014969 Ga0157376_10028875 Ga0157376_100288755 299
191 3300025933 Ga0207706_10057558 Ga0207706_100575583 299
192 3300025935 Ga0207709_10010795 Ga0207709_100107956 299
193 3300026089 Ga0207648_10017778 Ga0207648_100177782 299
194 3300049576 Ga0501040_0007117 Ga0501040_0007117_4204_5178 299
195 3300050493 nmdc:mga0k408_63487_c1 nmdc:mga0k408_63487_c1_910_1962 299
196 3300050496 nmdc:mga07m45_165924_c1 nmdc:mga07m45_165924_c1_10_1062 299
197 3300059421 Ga0590071_017498 Ga0590071_017498_159_1166 299
198 3300005439 Ga0070711_100059630 Ga0070711_1000596302 300
199 3300005718 Ga0068866_10131322 Ga0068866_101313222 300
200 3300006175 Ga0070712_100074571 Ga0070712_1000745713 300
201 3300009098 Ga0105245_10223471 Ga0105245_102234712 300
202 3300025927 Ga0207687_10136411 Ga0207687_101364112 300
203 3300026116 Ga0207674_10322838 Ga0207674_103228382 300
204 3300045976 Ga0466967_0580785 Ga0466967_0580785_122_1039 300
205 3300046529 Ga0495652_0353425 Ga0495652_0353425_51_1010 300
206 3300048905 Ga0496102_0377375 Ga0496102_0377375_213_1220 300
207 3300048918 Ga0496115_0265233 Ga0496115_0265233_102_1109 300
208 3300049581 Ga0501047_0099445 Ga0501047_0099445_1227_2237 300
209 3300045051 Ga0451576_0170056 Ga0451576_0170056_594_1553 301
210 3300046462 Ga0495651_0107602 Ga0495651_0107602_406_1353 301
211 3300025949 Ga0207667_10014242 Ga0207667_100142425 303
212 3300031691 Ga0316579_10005426 Ga0316579_100054264 303
213 3300032133 Ga0316583_10009254 Ga0316583_100092543 303
214 3300036647 Ga0316582_0007634 Ga0316582_0007634_3021_4043 303
215 3300005718 Ga0068866_10044520 Ga0068866_100445202 304
216 3300025937 Ga0207669_10018826 Ga0207669_100188263 304
217 3300028380 Ga0268265_10313384 Ga0268265_103133842 305
218 3300048907 Ga0496104_0481520 Ga0496104_0481520_166_1131 305
219 3300005331 Ga0070670_100068783 Ga0070670_1000687833 306
220 3300005545 Ga0070695_100101915 Ga0070695_1001019152 306
221 3300025925 Ga0207650_10028679 Ga0207650_100286792 306
222 3300031730 Ga0307516_10046141 Ga0307516_100461413 306
223 3300005458 Ga0070681_10012298 Ga0070681_100122988 307
224 3300005536 Ga0070697_100038033 Ga0070697_1000380332 307
225 3300005549 Ga0070704_100038987 Ga0070704_1000389873 307
226 3300006038 Ga0075365_10053369 Ga0075365_100533692 307
227 3300014968 Ga0157379_10344064 Ga0157379_103440642 307
228 3300035241 Ga0373961_0005571 Ga0373961_0005571_704_1654 307
229 3300046684 Ga0495669_0010719 Ga0495669_0010719_1519_2454 307
230 3300005331 Ga0070670_100375779 Ga0070670_1003757791 308
231 3300005365 Ga0070688_100026960 Ga0070688_1000269602 308
232 3300005367 Ga0070667_100091932 Ga0070667_1000919322 308
233 3300005543 Ga0070672_100051990 Ga0070672_1000519903 308
234 3300005617 Ga0068859_100232145 Ga0068859_1002321452 308
235 3300005618 Ga0068864_100142059 Ga0068864_1001420592 308
236 3300006237 Ga0097621_100192298 Ga0097621_1001922982 308
237 3300006358 Ga0068871_100091740 Ga0068871_1000917402 308
238 3300006931 Ga0097620_100232124 Ga0097620_1002321242 308
239 3300011119 Ga0105246_10419917 Ga0105246_104199171 308
240 3300013296 Ga0157374_10370832 Ga0157374_103708322 308
241 3300025907 Ga0207645_10019748 Ga0207645_100197484 308
242 3300025925 Ga0207650_10260510 Ga0207650_102605102 308
243 3300025931 Ga0207644_10213506 Ga0207644_102135062 308
244 3300025936 Ga0207670_10090548 Ga0207670_100905482 308
245 3300025942 Ga0207689_10043050 Ga0207689_100430504 308
246 3300026089 Ga0207648_10041166 Ga0207648_100411663 308
247 3300026095 Ga0207676_10030963 Ga0207676_100309633 308
248 3300026118 Ga0207675_100076660 Ga0207675_1000766602 308
249 3300046475 Ga0495639_0141765 Ga0495639_0141765_135_1076 308
250 3300046476 Ga0495662_0010089 Ga0495662_0010089_765_1706 308
251 3300046516 Ga0495628_0113451 Ga0495628_0113451_203_1144 308
252 3300046517 Ga0495630_0006364 Ga0495630_0006364_5991_6932 308
253 3300046690 Ga0495624_0027751 Ga0495624_0027751_1679_2620 308
254 3300047318 Ga0495636_0052206 Ga0495636_0052206_21_1013 308
255 3300047319 Ga0495674_0194566 Ga0495674_0194566_569_1510 308
256 3300047445 Ga0495677_0047183 Ga0495677_0047183_634_1566 308
257 3300049586 Ga0501070_0036022 Ga0501070_0036022_774_1718 308
258 3300049742 Ga0501080_0210890 Ga0501080_0210890_630_1574 308
259 3300049744 Ga0501083_0011934 Ga0501083_0011934_3886_4830 308
260 3300050496 nmdc:mga07m45_12274_c1 nmdc:mga07m45_12274_c1_109_1245 308
261 3300050512 nmdc:mga0n895_51200_c1 nmdc:mga0n895_51200_c1_2940_3884 308
262 3300050513 nmdc:mga0rr50_340174_c1 nmdc:mga0rr50_340174_c1_97_1074 308
263 3300054114 Ga0501084_0273568 Ga0501084_0273568_149_1096 308
264 3300060353 Ga0501082_0054856 Ga0501082_0054856_614_1618 308
265 3300005334 Ga0068869_100019219 Ga0068869_1000192193 309
266 3300005336 Ga0070680_100148819 Ga0070680_1001488191 309
267 3300005353 Ga0070669_100004770 Ga0070669_10000477010 309
268 3300005440 Ga0070705_100087470 Ga0070705_1000874701 309
269 3300005441 Ga0070700_100003507 Ga0070700_1000035077 309
270 3300005441 Ga0070700_100265184 Ga0070700_1002651842 309
271 3300005459 Ga0068867_100001086 Ga0068867_1000010862 309
272 3300005544 Ga0070686_100012900 Ga0070686_1000129003 309
273 3300005615 Ga0070702_100049806 Ga0070702_1000498062 309
274 3300005719 Ga0068861_100009341 Ga0068861_1000093412 309
275 3300005843 Ga0068860_100467608 Ga0068860_1004676082 309
276 3300005844 Ga0068862_100010767 Ga0068862_1000107679 309
277 3300005844 Ga0068862_100361354 Ga0068862_1003613542 309
278 3300005985 Ga0081539_10132285 Ga0081539_101322852 309
279 3300006163 Ga0070715_10039621 Ga0070715_100396212 309
280 3300006844 Ga0075428_100254586 Ga0075428_1002545862 309
281 3300006844 Ga0075428_100672709 Ga0075428_1006727091 309
282 3300006847 Ga0075431_100021141 Ga0075431_1000211416 309
283 3300006847 Ga0075431_100091893 Ga0075431_1000918932 309
284 3300006852 Ga0075433_10141798 Ga0075433_101417983 309
285 3300006871 Ga0075434_100049920 Ga0075434_1000499203 309
286 3300006881 Ga0068865_100023360 Ga0068865_1000233603 309
287 3300007076 Ga0075435_100001341 Ga0075435_1000013416 309
288 3300007076 Ga0075435_100037184 Ga0075435_1000371845 309
289 3300007076 Ga0075435_100195112 Ga0075435_1001951121 309
290 3300009094 Ga0111539_10038861 Ga0111539_100388615 309
291 3300009094 Ga0111539_10129330 Ga0111539_101293302 309
292 3300009147 Ga0114129_10015516 Ga0114129_100155166 309
293 3300009148 Ga0105243_10012737 Ga0105243_100127372 309
294 3300009176 Ga0105242_10205843 Ga0105242_102058432 309
295 3300009553 Ga0105249_10063386 Ga0105249_100633862 309
296 3300014326 Ga0157380_10013461 Ga0157380_100134612 309
297 3300025908 Ga0207643_10036858 Ga0207643_100368583 309
298 3300025912 Ga0207707_10007969 Ga0207707_100079699 309
299 3300025917 Ga0207660_10225371 Ga0207660_102253712 309
300 3300025918 Ga0207662_10205031 Ga0207662_102050312 309
301 3300025921 Ga0207652_10084697 Ga0207652_100846972 309
302 3300025923 Ga0207681_10039208 Ga0207681_100392083 309
303 3300025935 Ga0207709_10002954 Ga0207709_100029542 309
304 3300025937 Ga0207669_10034033 Ga0207669_100340332 309
305 3300025938 Ga0207704_10000959 Ga0207704_1000095910 309
306 3300025972 Ga0207668_10268237 Ga0207668_102682372 309
307 3300026075 Ga0207708_10012201 Ga0207708_100122013 309
308 3300026089 Ga0207648_10004422 Ga0207648_100044226 309
309 3300026118 Ga0207675_100003929 Ga0207675_1000039296 309
310 3300027360 Ga0209969_1000217 Ga0209969_10002174 309
311 3300027364 Ga0209967_1000307 Ga0209967_10003074 309
312 3300027378 Ga0209981_1001368 Ga0209981_10013682 309
313 3300027462 Ga0210000_1002801 Ga0210000_10028012 309
314 3300027526 Ga0209968_1001103 Ga0209968_10011034 309
315 3300027543 Ga0209999_1000946 Ga0209999_10009465 309
316 3300027907 Ga0207428_10036411 Ga0207428_100364113 309
317 3300027907 Ga0207428_10062275 Ga0207428_100622753 309
318 3300027907 Ga0207428_10108610 Ga0207428_101086102 309
319 3300028380 Ga0268265_10003470 Ga0268265_1000347010 309
320 3300028380 Ga0268265_10374043 Ga0268265_103740432 309
321 3300035111 Ga0373923_0061129 Ga0373923_0061129_516_1460 309
322 3300035117 Ga0373953_0063429 Ga0373953_0063429_405_1349 309
323 3300035118 Ga0373954_0000033 Ga0373954_0000033_29452_30396 309
324 3300035118 Ga0373954_0038525 Ga0373954_0038525_681_1625 309
325 3300035119 Ga0373956_0032194 Ga0373956_0032194_1009_1953 309
326 3300035120 Ga0373957_0013064 Ga0373957_0013064_545_1489 309
327 3300035172 Ga0373955_0021854 Ga0373955_0021854_1163_2107 309
328 3300035410 Ga0373924_0003359 Ga0373924_0003359_4261_5205 309
329 3300035724 Ga0373933_0002353 Ga0373933_0002353_1972_2916 309
330 3300035724 Ga0373933_0006414 Ga0373933_0006414_2808_3752 309
331 3300035724 Ga0373933_0121621 Ga0373933_0121621_22_1038 309
332 3300036401 Ga0373937_0000377 Ga0373937_0000377_32813_33757 309
333 3300036401 Ga0373937_0003134 Ga0373937_0003134_5398_6342 309
334 3300036401 Ga0373937_0028570 Ga0373937_0028570_2209_3168 309
335 3300042876 Ga0451577_0003923 Ga0451577_0003923_2744_3739 309
336 3300044712 Ga0453684_0101355 Ga0453684_0101355_1910_2905 309
337 3300044712 Ga0453684_0233298 Ga0453684_0233298_673_1671 309
338 3300046543 Ga0495645_0096540 Ga0495645_0096540_218_1162 309
339 3300046559 Ga0495667_0042381 Ga0495667_0042381_1058_2002 309
340 3300046663 Ga0495635_0104280 Ga0495635_0104280_207_1223 309
341 3300046680 Ga0495646_0072339 Ga0495646_0072339_919_1863 309
342 3300046683 Ga0495658_0005282 Ga0495658_0005282_1526_2542 309
343 3300046689 Ga0495613_0116652 Ga0495613_0116652_300_1316 309
344 3300046809 Ga0495600_0041694 Ga0495600_0041694_1663_2607 309
345 3300047319 Ga0495674_0096297 Ga0495674_0096297_1409_2425 309
346 3300048088 Ga0495602_0129132 Ga0495602_0129132_243_1187 309
347 3300050507 nmdc:mga05p37_21838_c1 nmdc:mga05p37_21838_c1_2100_3047 309
348 3300050508 nmdc:mga09592_352557_c1 nmdc:mga09592_352557_c1_101_1048 309
349 3300050509 nmdc:mga0qj67_705_c1 nmdc:mga0qj67_705_c1_19011_19958 309
350 3300050510 nmdc:mga06r32_318505_c1 nmdc:mga06r32_318505_c1_492_1439 309
351 3300050510 nmdc:mga06r32_48707_c1 nmdc:mga06r32_48707_c1_1254_2201 309
352 3300050511 nmdc:mga08y16_365591_c1 nmdc:mga08y16_365591_c1_117_1064 309
353 3300050511 nmdc:mga08y16_71819_c1 nmdc:mga08y16_71819_c1_1710_2654 309
354 3300050511 nmdc:mga08y16_72879_c1 nmdc:mga08y16_72879_c1_1523_2467 309
355 3300050512 nmdc:mga0n895_55158_c1 nmdc:mga0n895_55158_c1_319_1263 309
356 3300050512 nmdc:mga0n895_58125_c1 nmdc:mga0n895_58125_c1_1122_2069 309
357 3300050513 nmdc:mga0rr50_173168_c1 nmdc:mga0rr50_173168_c1_752_1696 309
358 3300050513 nmdc:mga0rr50_31256_c1 nmdc:mga0rr50_31256_c1_1988_2935 309
359 3300050514 nmdc:mga08x19_56565_c1 nmdc:mga08x19_56565_c1_1067_2014 309
360 3300053078 Ga0495612_0097143 Ga0495612_0097143_131_1147 309
361 3300005336 Ga0070680_100035618 Ga0070680_1000356183 310
362 3300005336 Ga0070680_100080743 Ga0070680_1000807432 310
363 3300005440 Ga0070705_100099966 Ga0070705_1000999662 310
364 3300005444 Ga0070694_100008469 Ga0070694_1000084696 310
365 3300005458 Ga0070681_10009509 Ga0070681_100095095 310
366 3300005458 Ga0070681_10022535 Ga0070681_100225354 310
367 3300005530 Ga0070679_100004740 Ga0070679_1000047407 310
368 3300005530 Ga0070679_100008970 Ga0070679_1000089708 310
369 3300005530 Ga0070679_100458460 Ga0070679_1004584602 310
370 3300005545 Ga0070695_100108643 Ga0070695_1001086432 310
371 3300005546 Ga0070696_100071825 Ga0070696_1000718252 310
372 3300005563 Ga0068855_100004439 Ga0068855_10000443914 310
373 3300005617 Ga0068859_100007812 Ga0068859_1000078125 310
374 3300006847 Ga0075431_100009047 Ga0075431_1000090474 310
375 3300006880 Ga0075429_100000638 Ga0075429_10000063821 310
376 3300006914 Ga0075436_100122725 Ga0075436_1001227251 310
377 3300006931 Ga0097620_100007812 Ga0097620_1000078125 310
378 3300007788 Ga0099795_10030113 Ga0099795_100301132 310
379 3300009093 Ga0105240_10031668 Ga0105240_100316688 310
380 3300009093 Ga0105240_10100319 Ga0105240_101003193 310
381 3300009147 Ga0114129_10007443 Ga0114129_100074437 310
382 3300009176 Ga0105242_10132848 Ga0105242_101328482 310
383 3300009551 Ga0105238_10030346 Ga0105238_100303463 310
384 3300013104 Ga0157370_10033935 Ga0157370_100339354 310
385 3300013104 Ga0157370_10037271 Ga0157370_100372712 310
386 3300025909 Ga0207705_10027375 Ga0207705_100273752 310
387 3300025912 Ga0207707_10008127 Ga0207707_100081277 310
388 3300025915 Ga0207693_10219308 Ga0207693_102193081 310
389 3300025919 Ga0207657_10028298 Ga0207657_100282984 310
390 3300025921 Ga0207652_10033083 Ga0207652_100330833 310
391 3300025921 Ga0207652_10049017 Ga0207652_100490172 310
392 3300025921 Ga0207652_10189807 Ga0207652_101898072 310
393 3300025924 Ga0207694_10160138 Ga0207694_101601382 310
394 3300025927 Ga0207687_10085226 Ga0207687_100852262 310
395 3300025934 Ga0207686_10006662 Ga0207686_100066627 310
396 3300025939 Ga0207665_10002514 Ga0207665_100025147 310
397 3300036401 Ga0373937_0055460 Ga0373937_0055460_1834_2829 310
398 3300045051 Ga0451576_0006891 Ga0451576_0006891_4095_5054 310
399 3300046492 Ga0495585_0093133 Ga0495585_0093133_625_1599 310
400 3300046520 Ga0495637_0023375 Ga0495637_0023375_1221_2219 310
401 3300047318 Ga0495636_0017975 Ga0495636_0017975_791_1768 310
402 3300047320 Ga0495672_0042125 Ga0495672_0042125_15_974 310
403 3300048091 Ga0495626_0021987 Ga0495626_0021987_594_1592 310
404 3300048905 Ga0496102_0554357 Ga0496102_0554357_25_1023 310
405 3300048906 Ga0496103_0270195 Ga0496103_0270195_44_1042 310
406 3300048909 Ga0496106_0208169 Ga0496106_0208169_366_1364 310
407 3300048911 Ga0496108_0082335 Ga0496108_0082335_621_1619 310
408 3300049578 Ga0501042_0290360 Ga0501042_0290360_62_1033 310
409 3300049587 Ga0501071_0000638 Ga0501071_0000638_3073_4044 310
410 3300049588 Ga0501072_0039243 Ga0501072_0039243_1211_2182 310
411 3300049591 Ga0501075_0051262 Ga0501075_0051262_1693_2664 310
412 3300049592 Ga0501076_0068664 Ga0501076_0068664_1177_2148 310
413 3300049741 Ga0501079_0040802 Ga0501079_0040802_914_1885 310
414 3300049742 Ga0501080_0049394 Ga0501080_0049394_1042_2013 310
415 3300049743 Ga0501081_0103777 Ga0501081_0103777_923_1894 310
416 3300050507 nmdc:mga05p37_980_c1 nmdc:mga05p37_980_c1_21063_22022 310
417 3300050508 nmdc:mga09592_947_c1 nmdc:mga09592_947_c1_5725_6684 310
418 3300050510 nmdc:mga06r32_2106_c1 nmdc:mga06r32_2106_c1_10790_11749 310
419 3300050514 nmdc:mga08x19_157982_c1 nmdc:mga08x19_157982_c1_511_1482 310
420 3300050514 nmdc:mga08x19_81297_c1 nmdc:mga08x19_81297_c1_343_1314 310
421 3300054114 Ga0501084_0104571 Ga0501084_0104571_1148_2119 310
422 3300005328 Ga0070676_10008106 Ga0070676_100081065 311
423 3300005330 Ga0070690_100005969 Ga0070690_1000059693 311
424 3300005331 Ga0070670_100222170 Ga0070670_1002221702 311
425 3300005333 Ga0070677_10002411 Ga0070677_100024115 311
426 3300005334 Ga0068869_100004332 Ga0068869_1000043323 311
427 3300005335 Ga0070666_10004949 Ga0070666_100049493 311
428 3300005339 Ga0070660_100149037 Ga0070660_1001490372 311
429 3300005343 Ga0070687_100034083 Ga0070687_1000340832 311
430 3300005355 Ga0070671_100317408 Ga0070671_1003174082 311
431 3300005356 Ga0070674_100056559 Ga0070674_1000565592 311
432 3300005367 Ga0070667_100030785 Ga0070667_1000307851 311
433 3300005441 Ga0070700_100077649 Ga0070700_1000776492 311
434 3300005456 Ga0070678_100036514 Ga0070678_1000365142 311
435 3300005457 Ga0070662_100020143 Ga0070662_1000201431 311
436 3300005459 Ga0068867_100006301 Ga0068867_1000063015 311
437 3300005530 Ga0070679_100199967 Ga0070679_1001999672 311
438 3300005543 Ga0070672_100004725 Ga0070672_1000047254 311
439 3300005616 Ga0068852_100012855 Ga0068852_1000128554 311
440 3300005617 Ga0068859_100128891 Ga0068859_1001288912 311
441 3300005618 Ga0068864_100067142 Ga0068864_1000671422 311
442 3300005719 Ga0068861_100006046 Ga0068861_1000060464 311
443 3300005841 Ga0068863_100009149 Ga0068863_1000091495 311
444 3300005842 Ga0068858_100006541 Ga0068858_1000065413 311
445 3300005843 Ga0068860_100000445 Ga0068860_10000044543 311
446 3300005844 Ga0068862_100098450 Ga0068862_1000984503 311
447 3300006048 Ga0075363_100044891 Ga0075363_1000448913 311
448 3300006177 Ga0075362_10032612 Ga0075362_100326123 311
449 3300006178 Ga0075367_10002066 Ga0075367_100020665 311
450 3300006186 Ga0075369_10001746 Ga0075369_100017466 311
451 3300006353 Ga0075370_10001147 Ga0075370_100011477 311
452 3300006881 Ga0068865_100002093 Ga0068865_1000020935 311
453 3300006931 Ga0097620_100128892 Ga0097620_1001288922 311
454 3300007076 Ga0075435_100267804 Ga0075435_1002678042 311
455 3300009094 Ga0111539_10107535 Ga0111539_101075352 311
456 3300009148 Ga0105243_10021971 Ga0105243_100219715 311
457 3300009176 Ga0105242_10035175 Ga0105242_100351752 311
458 3300009553 Ga0105249_10372687 Ga0105249_103726872 311
459 3300013306 Ga0163162_10054073 Ga0163162_100540734 311
460 3300013308 Ga0157375_10012725 Ga0157375_100127255 311
461 3300013308 Ga0157375_10476969 Ga0157375_104769691 311
462 3300014326 Ga0157380_10015790 Ga0157380_100157903 311
463 3300014968 Ga0157379_10205795 Ga0157379_102057951 311
464 3300014969 Ga0157376_10156917 Ga0157376_101569172 311
465 3300017792 Ga0163161_10020823 Ga0163161_100208232 311
466 3300025315 Ga0207697_10015533 Ga0207697_100155332 311
467 3300025893 Ga0207682_10008973 Ga0207682_100089732 311
468 3300025899 Ga0207642_10002491 Ga0207642_100024914 311
469 3300025903 Ga0207680_10005090 Ga0207680_100050905 311
470 3300025907 Ga0207645_10004582 Ga0207645_100045829 311
471 3300025918 Ga0207662_10001475 Ga0207662_100014753 311
472 3300025922 Ga0207646_10264735 Ga0207646_102647352 311
473 3300025923 Ga0207681_10008531 Ga0207681_100085312 311
474 3300025926 Ga0207659_10075986 Ga0207659_100759862 311
475 3300025931 Ga0207644_10330995 Ga0207644_103309952 311
476 3300025933 Ga0207706_10009798 Ga0207706_100097987 311
477 3300025934 Ga0207686_10085036 Ga0207686_100850362 311
478 3300025935 Ga0207709_10048266 Ga0207709_100482663 311
479 3300025937 Ga0207669_10019212 Ga0207669_100192124 311
480 3300025938 Ga0207704_10010842 Ga0207704_100108422 311
481 3300025940 Ga0207691_10010762 Ga0207691_100107625 311
482 3300025942 Ga0207689_10004853 Ga0207689_100048535 311
483 3300025945 Ga0207679_10132562 Ga0207679_101325622 311
484 3300025961 Ga0207712_10011898 Ga0207712_100118984 311
485 3300025972 Ga0207668_10012804 Ga0207668_100128043 311
486 3300025986 Ga0207658_10003494 Ga0207658_100034949 311
487 3300025986 Ga0207658_10027074 Ga0207658_100270744 311
488 3300026035 Ga0207703_10001799 Ga0207703_100017999 311
489 3300026067 Ga0207678_10063914 Ga0207678_100639143 311
490 3300026088 Ga0207641_10015255 Ga0207641_100152552 311
491 3300026089 Ga0207648_10004667 Ga0207648_100046679 311
492 3300026095 Ga0207676_10052933 Ga0207676_100529334 311
493 3300026118 Ga0207675_100007314 Ga0207675_1000073145 311
494 3300026121 Ga0207683_10054461 Ga0207683_100544614 311
495 3300026142 Ga0207698_10048625 Ga0207698_100486252 311
496 3300028380 Ga0268265_10004016 Ga0268265_100040163 311
497 3300028381 Ga0268264_10020878 Ga0268264_100208785 311
498 3300031456 Ga0307513_10013819 Ga0307513_100138197 311
499 3300031548 Ga0307408_100048450 Ga0307408_1000484502 311
500 3300031731 Ga0307405_10003735 Ga0307405_100037354 311
501 3300031824 Ga0307413_10026207 Ga0307413_100262074 311
502 3300031852 Ga0307410_10013767 Ga0307410_100137672 311
503 3300031901 Ga0307406_10005448 Ga0307406_100054483 311
504 3300031903 Ga0307407_10002451 Ga0307407_100024514 311
505 3300031911 Ga0307412_10009014 Ga0307412_100090143 311
506 3300031995 Ga0307409_100022174 Ga0307409_1000221744 311
507 3300032002 Ga0307416_100001584 Ga0307416_10000158412 311
508 3300032004 Ga0307414_10031261 Ga0307414_100312614 311
509 3300032005 Ga0307411_10002419 Ga0307411_100024192 311
510 3300035398 Ga0316574_0006010 Ga0316574_0006010_3672_4691 311
511 3300036401 Ga0373937_0113545 Ga0373937_0113545_34_1059 311
512 3300037466 Ga0395898_0091709 Ga0395898_0091709_829_1836 311
513 3300037471 Ga0395905_0151024 Ga0395905_0151024_266_1273 311
514 3300037471 Ga0395905_0275369 Ga0395905_0275369_214_1230 311
515 3300038443 Ga0395901_0211074 Ga0395901_0211074_496_1503 311
516 3300039437 Ga0436365_1397879 Ga0436365_1397879_51_1010 311
517 3300039438 Ga0436360_1095664 Ga0436360_1095664_247_1257 311
518 3300039450 Ga0436363_0707452 Ga0436363_0707452_2053_3030 311
519 3300046542 Ga0495597_0011926 Ga0495597_0011926_2774_3730 311
520 3300046674 Ga0495588_0048044 Ga0495588_0048044_581_1570 311
521 3300047443 Ga0495687_000174 Ga0495687_000174_83230_84186 311
522 3300049587 Ga0501071_0192928 Ga0501071_0192928_427_1476 311
523 3300050490 nmdc:mga03n38_52854_c1 nmdc:mga03n38_52854_c1_431_1408 311
524 3300050493 nmdc:mga0k408_1076_c1 nmdc:mga0k408_1076_c1_665_1642 311
525 3300050494 nmdc:mga06z11_13801_c1 nmdc:mga06z11_13801_c1_2345_3322 311
526 3300050496 nmdc:mga07m45_756_c1 nmdc:mga07m45_756_c1_10335_11312 311
527 3300050513 nmdc:mga0rr50_173434_c1 nmdc:mga0rr50_173434_c1_121_1122 311
528 3300050516 nmdc:mga0sz30_6627_c1 nmdc:mga0sz30_6627_c1_2369_3346 311
529 3300005440 Ga0070705_100100317 Ga0070705_1001003172 312
530 3300005445 Ga0070708_100071167 Ga0070708_1000711673 312
531 3300005467 Ga0070706_100056652 Ga0070706_1000566523 312
532 3300005467 Ga0070706_100069571 Ga0070706_1000695713 312
533 3300005468 Ga0070707_100125374 Ga0070707_1001253742 312
534 3300005471 Ga0070698_100128136 Ga0070698_1001281362 312
535 3300005518 Ga0070699_100012263 Ga0070699_1000122632 312
536 3300005536 Ga0070697_100028919 Ga0070697_1000289192 312
537 3300006846 Ga0075430_100016752 Ga0075430_1000167524 312
538 3300006847 Ga0075431_100055100 Ga0075431_1000551002 312
539 3300006880 Ga0075429_100070657 Ga0075429_1000706573 312
540 3300007076 Ga0075435_100019365 Ga0075435_1000193653 312
541 3300009147 Ga0114129_10267830 Ga0114129_102678303 312
542 3300009148 Ga0105243_10225236 Ga0105243_102252362 312
543 3300013297 Ga0157378_10287237 Ga0157378_102872372 312
544 3300025910 Ga0207684_10019197 Ga0207684_100191972 312
545 3300025910 Ga0207684_10052702 Ga0207684_100527022 312
546 3300025922 Ga0207646_10053523 Ga0207646_100535232 312
547 3300025922 Ga0207646_10303116 Ga0207646_103031162 312
548 3300026041 Ga0207639_10036147 Ga0207639_100361472 312
549 3300034816 Ga0373930_0036247 Ga0373930_0036247_19_1023 312
550 3300045051 Ga0451576_0066649 Ga0451576_0066649_1361_2365 312
551 3300046472 Ga0495580_0046786 Ga0495580_0046786_818_1822 312
552 3300046664 Ga0495659_0012239 Ga0495659_0012239_1383_2387 312
553 3300050508 nmdc:mga09592_48847_c1 nmdc:mga09592_48847_c1_1582_2586 312
554 3300050509 nmdc:mga0qj67_9318_c1 nmdc:mga0qj67_9318_c1_494_1498 312
555 3300050512 nmdc:mga0n895_418421_c1 nmdc:mga0n895_418421_c1_90_1094 312
556 3300050515 nmdc:mga0a205_329800_c1 nmdc:mga0a205_329800_c1_235_1239 312
557 3300005331 Ga0070670_100246288 Ga0070670_1002462882 313
558 3300005334 Ga0068869_100002122 Ga0068869_1000021226 313
559 3300005337 Ga0070682_100078008 Ga0070682_1000780081 313
560 3300005338 Ga0068868_100006941 Ga0068868_1000069416 313
561 3300005354 Ga0070675_100027777 Ga0070675_1000277774 313
562 3300005355 Ga0070671_100245386 Ga0070671_1002453862 313
563 3300005366 Ga0070659_100024761 Ga0070659_1000247613 313
564 3300005455 Ga0070663_100007618 Ga0070663_1000076184 313
565 3300005455 Ga0070663_100284924 Ga0070663_1002849242 313
566 3300005456 Ga0070678_100108183 Ga0070678_1001081832 313
567 3300005457 Ga0070662_100014240 Ga0070662_1000142404 313
568 3300005457 Ga0070662_100014845 Ga0070662_1000148452 313
569 3300005539 Ga0068853_100019417 Ga0068853_1000194173 313
570 3300005543 Ga0070672_100009264 Ga0070672_1000092644 313
571 3300005547 Ga0070693_100100341 Ga0070693_1001003412 313
572 3300005548 Ga0070665_100165095 Ga0070665_1001650952 313
573 3300005563 Ga0068855_100081449 Ga0068855_1000814492 313
574 3300005564 Ga0070664_100085179 Ga0070664_1000851792 313
575 3300005564 Ga0070664_100144464 Ga0070664_1001444641 313
576 3300005564 Ga0070664_100232032 Ga0070664_1002320321 313
577 3300005578 Ga0068854_100014049 Ga0068854_1000140492 313
578 3300005614 Ga0068856_100002754 Ga0068856_1000027547 313
579 3300005616 Ga0068852_100014774 Ga0068852_1000147744 313
580 3300005616 Ga0068852_100126502 Ga0068852_1001265022 313
581 3300005616 Ga0068852_100211164 Ga0068852_1002111642 313
582 3300005618 Ga0068864_100014331 Ga0068864_1000143313 313
583 3300005719 Ga0068861_100002723 Ga0068861_1000027238 313
584 3300005834 Ga0068851_10097805 Ga0068851_100978052 313
585 3300005841 Ga0068863_100145777 Ga0068863_1001457772 313
586 3300005842 Ga0068858_100003275 Ga0068858_10000327513 313
587 3300005843 Ga0068860_100003813 Ga0068860_10000381314 313
588 3300005843 Ga0068860_100055223 Ga0068860_1000552234 313
589 3300005844 Ga0068862_100038290 Ga0068862_1000382903 313
590 3300006237 Ga0097621_100017213 Ga0097621_1000172133 313
591 3300006358 Ga0068871_100016517 Ga0068871_1000165173 313
592 3300009093 Ga0105240_10251643 Ga0105240_102516432 313
593 3300009177 Ga0105248_10077605 Ga0105248_100776054 313
594 3300009551 Ga0105238_10028562 Ga0105238_100285624 313
595 3300009551 Ga0105238_10069909 Ga0105238_100699092 313
596 3300010375 Ga0105239_10102136 Ga0105239_101021362 313
597 3300013100 Ga0157373_10008856 Ga0157373_100088565 313
598 3300013102 Ga0157371_10071907 Ga0157371_100719072 313
599 3300013296 Ga0157374_10107158 Ga0157374_101071582 313
600 3300013296 Ga0157374_10115310 Ga0157374_101153102 313
601 3300013306 Ga0163162_10012088 Ga0163162_100120884 313
602 3300013307 Ga0157372_10038032 Ga0157372_100380322 313
603 3300013307 Ga0157372_10115147 Ga0157372_101151473 313
604 3300013308 Ga0157375_10451756 Ga0157375_104517562 313
605 3300014745 Ga0157377_10003326 Ga0157377_100033264 313
606 3300014968 Ga0157379_10012126 Ga0157379_100121265 313
607 3300014968 Ga0157379_10075966 Ga0157379_100759663 313
608 3300014969 Ga0157376_10003522 Ga0157376_100035227 313
609 3300017792 Ga0163161_10007610 Ga0163161_100076104 313
610 3300025321 Ga0207656_10021654 Ga0207656_100216543 313
611 3300025893 Ga0207682_10011656 Ga0207682_100116562 313
612 3300025901 Ga0207688_10012083 Ga0207688_100120833 313
613 3300025907 Ga0207645_10014016 Ga0207645_100140163 313
614 3300025909 Ga0207705_10028425 Ga0207705_100284253 313
615 3300025914 Ga0207671_10012655 Ga0207671_100126554 313
616 3300025919 Ga0207657_10090018 Ga0207657_100900182 313
617 3300025920 Ga0207649_10040599 Ga0207649_100405993 313
618 3300025920 Ga0207649_10171098 Ga0207649_101710982 313
619 3300025924 Ga0207694_10028565 Ga0207694_100285652 313
620 3300025925 Ga0207650_10024459 Ga0207650_100244593 313
621 3300025926 Ga0207659_10009561 Ga0207659_100095614 313
622 3300025926 Ga0207659_10086740 Ga0207659_100867402 313
623 3300025933 Ga0207706_10002472 Ga0207706_100024725 313
624 3300025938 Ga0207704_10045219 Ga0207704_100452192 313
625 3300025940 Ga0207691_10006274 Ga0207691_100062745 313
626 3300025940 Ga0207691_10097865 Ga0207691_100978652 313
627 3300025941 Ga0207711_10031936 Ga0207711_100319362 313
628 3300025942 Ga0207689_10003145 Ga0207689_100031455 313
629 3300025944 Ga0207661_10182866 Ga0207661_101828662 313
630 3300025945 Ga0207679_10050998 Ga0207679_100509983 313
631 3300025945 Ga0207679_10249345 Ga0207679_102493452 313
632 3300025949 Ga0207667_10125317 Ga0207667_101253173 313
633 3300025981 Ga0207640_10289708 Ga0207640_102897081 313
634 3300025986 Ga0207658_10114250 Ga0207658_101142502 313
635 3300026023 Ga0207677_10003875 Ga0207677_100038754 313
636 3300026035 Ga0207703_10191997 Ga0207703_101919972 313
637 3300026041 Ga0207639_10109127 Ga0207639_101091271 313
638 3300026067 Ga0207678_10064277 Ga0207678_100642772 313
639 3300026078 Ga0207702_10102791 Ga0207702_101027913 313
640 3300026078 Ga0207702_10331977 Ga0207702_103319772 313
641 3300026095 Ga0207676_10011922 Ga0207676_100119223 313
642 3300026116 Ga0207674_10105895 Ga0207674_101058952 313
643 3300026118 Ga0207675_100004517 Ga0207675_10000451711 313
644 3300026121 Ga0207683_10166820 Ga0207683_101668202 313
645 3300026121 Ga0207683_10392501 Ga0207683_103925012 313
646 3300026142 Ga0207698_10033857 Ga0207698_100338573 313
647 3300026142 Ga0207698_10187381 Ga0207698_101873812 313
648 3300026142 Ga0207698_10329061 Ga0207698_103290612 313
649 3300028380 Ga0268265_10077352 Ga0268265_100773522 313
650 3300028381 Ga0268264_10015864 Ga0268264_100158644 313
651 3300028381 Ga0268264_10100740 Ga0268264_101007402 313
652 3300035207 Ga0373942_0033933 Ga0373942_0033933_169_1146 313
653 3300035691 Ga0373931_0006797 Ga0373931_0006797_3052_4029 313
654 3300041512 Ga0451853_1410340 Ga0451853_1410340_85_1065 313
655 3300048903 Ga0496100_0036459 Ga0496100_0036459_780_1757 313
656 3300048904 Ga0496101_0011006 Ga0496101_0011006_3584_4561 313
657 3300048905 Ga0496102_0018381 Ga0496102_0018381_3322_4299 313
658 3300048907 Ga0496104_0072463 Ga0496104_0072463_1054_2031 313
659 3300048909 Ga0496106_0187932 Ga0496106_0187932_341_1318 313
660 3300048910 Ga0496107_0008481 Ga0496107_0008481_4996_5973 313
661 3300048911 Ga0496108_0025297 Ga0496108_0025297_2149_3126 313
662 3300048912 Ga0496109_0058844 Ga0496109_0058844_2298_3275 313
663 3300048913 Ga0496110_0018001 Ga0496110_0018001_3786_4763 313
664 3300048914 Ga0496111_0086443 Ga0496111_0086443_239_1216 313
665 3300048917 Ga0496114_0020230 Ga0496114_0020230_1703_2680 313
666 3300048918 Ga0496115_0012118 Ga0496115_0012118_2965_3942 313
667 3300005614 Ga0068856_100021873 Ga0068856_1000218736 314
668 3300006871 Ga0075434_100000132 Ga0075434_1000001329 314
669 3300006914 Ga0075436_100073824 Ga0075436_1000738242 314
670 3300007076 Ga0075435_100006450 Ga0075435_1000064504 314
671 3300014497 Ga0182008_10049438 Ga0182008_100494382 314
672 3300014968 Ga0157379_10501204 Ga0157379_105012041 314
673 3300025939 Ga0207665_10044076 Ga0207665_100440763 314
674 3300026078 Ga0207702_10012690 Ga0207702_100126905 314
675 3300035692 Ga0373935_0129958 Ga0373935_0129958_267_1265 314
676 3300050512 nmdc:mga0n895_119372_c1 nmdc:mga0n895_119372_c1_544_1536 314
677 3300050513 nmdc:mga0rr50_17843_c1 nmdc:mga0rr50_17843_c1_823_1815 314
678 3300050513 nmdc:mga0rr50_38273_c1 nmdc:mga0rr50_38273_c1_750_1856 314
679 3300050514 nmdc:mga08x19_166506_c1 nmdc:mga08x19_166506_c1_216_1322 314
680 3300059426 Ga0590077_003466 Ga0590077_003466_107_1090 314
681 3300025949 Ga0207667_10132106 Ga0207667_101321063 315
682 3300035083 Ga0373926_0049702 Ga0373926_0049702_451_1470 315
683 3300037312 Ga0395899_0199703 Ga0395899_0199703_148_1254 315
684 3300037418 Ga0395900_0010670 Ga0395900_0010670_1741_2847 315
685 3300037466 Ga0395898_0017213 Ga0395898_0017213_6112_7218 315
686 3300037471 Ga0395905_0225980 Ga0395905_0225980_57_1163 315
687 3300038443 Ga0395901_0024791 Ga0395901_0024791_4258_5364 315
688 3300038443 Ga0395901_0108297 Ga0395901_0108297_961_2067 315
689 3300044656 Ga0466969_0067162 Ga0466969_0067162_70_1179 315
690 3300044683 Ga0466965_0144803 Ga0466965_0144803_33_1142 315
691 3300044684 Ga0466966_0003903 Ga0466966_0003903_7293_8402 315
692 3300044735 Ga0466968_0019351 Ga0466968_0019351_1294_2424 315
693 3300005327 Ga0070658_10313918 Ga0070658_103139182 316
694 3300005331 Ga0070670_100002757 Ga0070670_1000027572 316
695 3300005354 Ga0070675_100123555 Ga0070675_1001235552 316
696 3300005355 Ga0070671_100036410 Ga0070671_1000364102 316
697 3300005364 Ga0070673_100274156 Ga0070673_1002741562 316
698 3300005456 Ga0070678_100002569 Ga0070678_1000025692 316
699 3300005543 Ga0070672_100154305 Ga0070672_1001543052 316
700 3300005618 Ga0068864_100275623 Ga0068864_1002756232 316
701 3300005834 Ga0068851_10063975 Ga0068851_100639752 316
702 3300006237 Ga0097621_100115999 Ga0097621_1001159992 316
703 3300006358 Ga0068871_100095369 Ga0068871_1000953692 316
704 3300013308 Ga0157375_10032862 Ga0157375_100328625 316
705 3300014969 Ga0157376_10032818 Ga0157376_100328183 316
706 3300025321 Ga0207656_10053593 Ga0207656_100535932 316
707 3300025925 Ga0207650_10002987 Ga0207650_100029876 316
708 3300025926 Ga0207659_10008417 Ga0207659_100084173 316
709 3300025931 Ga0207644_10096851 Ga0207644_100968512 316
710 3300025940 Ga0207691_10018605 Ga0207691_100186053 316
711 3300025945 Ga0207679_10207510 Ga0207679_102075102 316
712 3300025960 Ga0207651_10317358 Ga0207651_103173582 316
713 3300026095 Ga0207676_10003245 Ga0207676_100032453 316
714 3300026121 Ga0207683_10006504 Ga0207683_100065042 316
715 3300031711 Ga0265314_10044571 Ga0265314_100445712 316
716 3300031711 Ga0265314_10084490 Ga0265314_100844902 316
717 3300037068 Ga0373925_0142864 Ga0373925_0142864_247_1266 316
718 3300037312 Ga0395899_0081316 Ga0395899_0081316_139_1176 316
719 3300037418 Ga0395900_0021369 Ga0395900_0021369_956_1993 316
720 3300037471 Ga0395905_0000180 Ga0395905_0000180_94460_95497 316
721 3300037471 Ga0395905_0035447 Ga0395905_0035447_3349_4386 316
722 3300037471 Ga0395905_0055651 Ga0395905_0055651_2382_3410 316
723 3300037471 Ga0395905_0087092 Ga0395905_0087092_1239_2273 316
724 3300038443 Ga0395901_0061190 Ga0395901_0061190_1770_2807 316
725 3300046476 Ga0495662_0082312 Ga0495662_0082312_89_1108 316
726 3300046543 Ga0495645_0042727 Ga0495645_0042727_1239_2255 316
727 3300046663 Ga0495635_0113405 Ga0495635_0113405_568_1587 316
728 3300046683 Ga0495658_0056038 Ga0495658_0056038_543_1562 316
729 3300046689 Ga0495613_0138516 Ga0495613_0138516_609_1628 316
730 3300049571 Ga0501034_0093439 Ga0501034_0093439_1923_2957 316
731 3300049580 Ga0501046_0161104 Ga0501046_0161104_451_1485 316
732 3300049590 Ga0501074_0206978 Ga0501074_0206978_242_1276 316
733 3300049742 Ga0501080_0015068 Ga0501080_0015068_1666_2700 316
734 3300049822 Ga0501035_0025466 Ga0501035_0025466_3181_4215 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

39

311

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lb8-assembly1.cif.gz_B structure of a ferrichrome importer fhucdb from e. coli 0.5557 16 281
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4911 22 297
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4884 12 297
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4881 22 297
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4754 12 297
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8441 22 293 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8264 26 293 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7865 26 293 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7726 26 291 1.10.3470.10
af_P32720_52_318_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7607 30 291 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A2V6TNZ8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9918 21 262 GO:0005886
GO:0015658
AF-A0A536V8Q0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9916 2 316 GO:0005886
GO:0015658
AF-A0A521YMR3-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9912 1 314 GO:0005886
GO:0015658
AF-A0A521VKR8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9903 1 315 GO:0005886
GO:0015658
AF-A0A1S8FII9-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9903 1 316 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
91.33 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map