F478223

General Info

Members Datasets Scaffolds Average Seq Length
735 296 718 217

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0093253|Ga0495643_0093253_125_808
Length 227
Sequence VSETKPDETRPADAGPVTVVLVDDHAMFRTGVRAELAQAPSVDVVGEAADTAEAVAVVLRTKPEVVLLDVHLPGGGGGEVIRQVHPKEPGVRFLALSVSDAAEDVIGTIRAGARGYVTKSITGDDLVSAIGRVADGDAVFSPRLAGFVLDAFAGTEAPSVDDDLDRLTQREREVLRLIARGYAYKEIAKELFISVKTVETHVSAVLRKLQLSNRYELTRWATDRRLV

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2643221561 Nocardioides sp. Root151 Isolate Unclassified
3 2643221696 Nocardioides sp. Root140 Isolate Unclassified
4 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
5 2739367898 Nocardioides sp. CF479 Isolate Unclassified
6 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
7 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
8 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
9 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
10 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
11 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
12 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
13 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
14 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
15 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
16 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
201 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
202 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
205 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
206 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
207 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
210 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
211 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
212 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
213 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
214 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
215 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
216 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
222 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
259 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
260 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
273 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
274 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
278 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
288 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
289 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
294 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
296 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.73
Metatranscriptomes 0.95
Isolates 2.31

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 8.71
Nodule 0.14
Rhizoplane 10.34
Rhizosphere 77.96
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24738J21930_10010742 3300002075 Bacteria 2030
2 JGI24744J21845_10008086 3300002077 Bacteria 2172
3 Ga0070658_10474628 3300005327 Bacteria 1079
4 Ga0070683_100009817 3300005329 Bacteria 8201
5 Ga0070683_100023908 3300005329 Bacteria 5470
6 Ga0070683_100036540 3300005329 Bacteria 4495
7 Ga0070683_100096868 3300005329 Bacteria 2775
8 Ga0070683_100136532 3300005329 Bacteria 2323
9 Ga0070683_100201360 3300005329 Bacteria 1890
10 Ga0070683_100376421 3300005329 Bacteria 1353
11 Ga0070670_100111300 3300005331 Bacteria 2359
12 Ga0068869_100176885 3300005334 Bacteria 1671
13 Ga0070680_100073191 3300005336 Bacteria 2817
14 Ga0070682_100002682 3300005337 Bacteria 9845
15 Ga0070682_100013692 3300005337 Bacteria 4674
16 Ga0070682_100069770 3300005337 Bacteria 2245
17 Ga0070682_100293176 3300005337 Bacteria 1191
18 Ga0070682_100398046 3300005337 Bacteria 1041
19 Ga0068868_100065622 3300005338 Bacteria 2884
20 Ga0068868_100184226 3300005338 Bacteria 1733
21 Ga0070660_100036084 3300005339 Bacteria 3744
22 Ga0070660_100048141 3300005339 Bacteria 3273
23 Ga0070660_100161448 3300005339 Bacteria 1806
24 Ga0070691_10026426 3300005341 Bacteria 2705
25 Ga0070661_100092126 3300005344 Bacteria 2245
26 Ga0070692_10005693 3300005345 Bacteria 5346
27 Ga0070692_10025132 3300005345 Bacteria 2934
28 Ga0070692_10097940 3300005345 Bacteria 1604
29 Ga0070675_100147591 3300005354 Bacteria 2015
30 Ga0070675_100263189 3300005354 Bacteria 1512
31 Ga0070671_100045236 3300005355 Bacteria 3659
32 Ga0070673_100029253 3300005364 Bacteria 4107
33 Ga0070659_100089414 3300005366 Bacteria 2467
34 Ga0070659_100093200 3300005366 Bacteria 2417
35 Ga0070659_100166232 3300005366 Bacteria 1805
36 Ga0070659_100200249 3300005366 Bacteria 1644
37 Ga0070659_100338641 3300005366 Bacteria 1260
38 Ga0070659_100438344 3300005366 Bacteria 1106
39 Ga0070667_100007583 3300005367 Bacteria 8999
40 Ga0070667_100065010 3300005367 Bacteria 3097
41 Ga0070667_100405868 3300005367 Bacteria 1241
42 Ga0070714_100001446 3300005435 Bacteria 17298
43 Ga0070701_10122806 3300005438 Bacteria 1466
44 Ga0070701_10185773 3300005438 Bacteria 1220
45 Ga0070700_100034575 3300005441 Bacteria 3053
46 Ga0070700_100137214 3300005441 Bacteria 1658
47 Ga0070663_100019332 3300005455 Bacteria 4486
48 Ga0070663_100049350 3300005455 Bacteria 2988
49 Ga0070663_100575854 3300005455 Bacteria 944
50 Ga0070678_100155551 3300005456 Bacteria 1846
51 Ga0070678_100341965 3300005456 Bacteria 1284
52 Ga0070662_100164417 3300005457 Bacteria 1738
53 Ga0070681_10114956 3300005458 Bacteria 2629
54 Ga0070681_10260928 3300005458 Bacteria 1645
55 Ga0070681_10656618 3300005458 Bacteria 964
56 Ga0068867_100074370 3300005459 Bacteria 2547
57 Ga0070685_10064620 3300005466 Bacteria 2152
58 Ga0070698_100000363 3300005471 Bacteria 46987
59 Ga0070679_100112171 3300005530 Bacteria 2713
60 Ga0070679_100160437 3300005530 Bacteria 2223
61 Ga0070679_100436345 3300005530 Bacteria 1255
62 Ga0070679_100987741 3300005530 Bacteria 786
63 Ga0070684_100028263 3300005535 Bacteria 4743
64 Ga0070684_100178752 3300005535 Bacteria 1929
65 Ga0068853_100022084 3300005539 Bacteria 5310
66 Ga0070672_100019305 3300005543 Bacteria 4945
67 Ga0070686_100055918 3300005544 Bacteria 2530
68 Ga0070693_100018875 3300005547 Bacteria 3608
69 Ga0070665_100000450 3300005548 Bacteria 59867
70 Ga0070665_100212342 3300005548 Bacteria 1936
71 Ga0070665_100366668 3300005548 Bacteria 1447
72 Ga0070704_100584115 3300005549 Bacteria 980
73 Ga0068855_100113651 3300005563 Bacteria 3106
74 Ga0068855_100206224 3300005563 Bacteria 2211
75 Ga0068855_100233922 3300005563 Bacteria 2056
76 Ga0068855_100276624 3300005563 Bacteria 1866
77 Ga0070664_100158709 3300005564 Bacteria 2000
78 Ga0070664_100176753 3300005564 Bacteria 1896
79 Ga0070664_100529217 3300005564 Bacteria 1089
80 Ga0068857_100009886 3300005577 Bacteria 8283
81 Ga0068857_100537716 3300005577 Bacteria 1100
82 Ga0068854_100084599 3300005578 Bacteria 2347
83 Ga0068854_100206351 3300005578 Bacteria 1548
84 Ga0068856_100028796 3300005614 Bacteria 5427
85 Ga0068856_100841420 3300005614 Bacteria 937
86 Ga0068856_101246478 3300005614 Bacteria 759
87 Ga0070702_100011043 3300005615 Bacteria 4481
88 Ga0068852_100050155 3300005616 Bacteria 3574
89 Ga0068852_101138780 3300005616 Bacteria 801
90 Ga0068859_100054057 3300005617 Bacteria 4039
91 Ga0068864_100111739 3300005618 Bacteria 2435
92 Ga0068861_100561646 3300005719 Bacteria 1042
93 Ga0068870_10003307 3300005840 Bacteria 6812
94 Ga0068870_10011892 3300005840 Bacteria 4050
95 Ga0068870_10239403 3300005840 Bacteria 1120
96 Ga0068863_100076596 3300005841 Bacteria 3164
97 Ga0068858_100077027 3300005842 Bacteria 3097
98 Ga0068858_100120615 3300005842 Bacteria 2452
99 Ga0068860_100000304 3300005843 Bacteria 68193
100 Ga0068860_100100284 3300005843 Bacteria 2762
101 Ga0081540_1050807 3300005983 Bacteria 2055
102 Ga0081539_10036418 3300005985 Bacteria 2945
103 Ga0075365_10025922 3300006038 Bacteria 3715
104 Ga0075365_10027382 3300006038 Bacteria 3627
105 Ga0075365_10043487 3300006038 Bacteria 2941
106 Ga0075365_10063640 3300006038 Bacteria 2470
107 Ga0075365_10192855 3300006038 Bacteria 1426
108 Ga0075365_10215429 3300006038 Bacteria 1346
109 Ga0075365_10262099 3300006038 Bacteria 1215
110 Ga0075365_10275209 3300006038 Bacteria 1184
111 Ga0075368_10003543 3300006042 Bacteria 5228
112 Ga0075368_10018608 3300006042 Bacteria 2611
113 Ga0075368_10019857 3300006042 Bacteria 2539
114 Ga0075368_10280626 3300006042 Bacteria 716
115 Ga0075363_100002765 3300006048 Bacteria 7273
116 Ga0075363_100007893 3300006048 Bacteria 4928
117 Ga0075363_100011133 3300006048 Bacteria 4299
118 Ga0075363_100099949 3300006048 Bacteria 1604
119 Ga0075364_10009391 3300006051 Bacteria 5865
120 Ga0075364_10034188 3300006051 Bacteria 3278
121 Ga0075364_10039261 3300006051 Bacteria 3068
122 Ga0075364_10039542 3300006051 Bacteria 3058
123 Ga0075364_10065390 3300006051 Bacteria 2387
124 Ga0075364_10066532 3300006051 Bacteria 2367
125 Ga0075364_10089036 3300006051 Bacteria 2047
126 Ga0075364_10142496 3300006051 Bacteria 1613
127 Ga0075364_10477882 3300006051 Bacteria 852
128 Ga0070712_100568552 3300006175 Bacteria 957
129 Ga0075362_10058501 3300006177 Bacteria 1738
130 Ga0075362_10059421 3300006177 Bacteria 1726
131 Ga0075367_10009420 3300006178 Bacteria 5105
132 Ga0075367_10030512 3300006178 Bacteria 3091
133 Ga0097621_101045862 3300006237 Bacteria 765
134 Ga0075370_10006935 3300006353 Bacteria 5739
135 Ga0075370_10015383 3300006353 Bacteria 4096
136 Ga0075370_10015524 3300006353 Bacteria 4079
137 Ga0068871_100072529 3300006358 Bacteria 2836
138 Ga0068871_100084567 3300006358 Bacteria 2633
139 Ga0075428_100965489 3300006844 Bacteria 903
140 Ga0075431_100111265 3300006847 Bacteria 2826
141 Ga0075434_100067274 3300006871 Bacteria 3569
142 Ga0068865_100003722 3300006881 Bacteria 9154
143 Ga0068865_100464631 3300006881 Bacteria 1049
144 Ga0068865_100856564 3300006881 Bacteria 788
145 Ga0075436_100066751 3300006914 Bacteria 2487
146 Ga0097620_100054056 3300006931 Bacteria 4039
147 Ga0075435_100037138 3300007076 Bacteria 3877
148 Ga0105251_10110283 3300009011 Bacteria 1254
149 Ga0105240_10010898 3300009093 Bacteria 12736
150 Ga0105240_10103159 3300009093 Bacteria 3466
151 Ga0105240_10698213 3300009093 Bacteria 1108
152 Ga0111539_10057392 3300009094 Bacteria 4624
153 Ga0111539_10167102 3300009094 Bacteria 2571
154 Ga0111539_10637774 3300009094 Bacteria 1240
155 Ga0105245_10000359 3300009098 Bacteria 42584
156 Ga0105245_10119505 3300009098 Bacteria 2460
157 Ga0105245_10623655 3300009098 Bacteria 1107
158 Ga0105245_10953672 3300009098 Bacteria 901
159 Ga0105247_10046783 3300009101 Bacteria 2656
160 Ga0114129_10076786 3300009147 Bacteria 4649
161 Ga0105243_10020111 3300009148 Bacteria 5061
162 Ga0105243_10097702 3300009148 Bacteria 2431
163 Ga0105243_10439882 3300009148 Bacteria 1221
164 Ga0105241_10034837 3300009174 Bacteria 3785
165 Ga0105248_10061101 3300009177 Bacteria 4230
166 Ga0105248_10212297 3300009177 Bacteria 2181
167 Ga0105248_10227251 3300009177 Bacteria 2101
168 Ga0105237_10015753 3300009545 Bacteria 7862
169 Ga0105237_10074076 3300009545 Bacteria 3396
170 Ga0105237_10193530 3300009545 Bacteria 2033
171 Ga0105237_10645230 3300009545 Bacteria 1065
172 Ga0105237_11041106 3300009545 Bacteria 825
173 Ga0105238_10104253 3300009551 Bacteria 2817
174 Ga0105238_10217634 3300009551 Bacteria 1886
175 Ga0105249_10362547 3300009553 Bacteria 1471
176 Ga0105249_10482721 3300009553 Bacteria 1282
177 Ga0105249_10759378 3300009553 Bacteria 1032
178 Ga0105249_11689487 3300009553 Bacteria 706
179 Ga0105029_103857 3300009984 Bacteria 1017
180 Ga0105239_10012602 3300010375 Bacteria 9408
181 Ga0105239_10012785 3300010375 Bacteria 9339
182 Ga0105239_10026655 3300010375 Bacteria 6361
183 Ga0105239_10174678 3300010375 Bacteria 2403
184 Ga0105239_10728758 3300010375 Bacteria 1134
185 Ga0105246_10003745 3300011119 Bacteria 9219
186 Ga0157316_1017087 3300012510 Bacteria 753
187 Ga0157373_10085704 3300013100 Bacteria 2220
188 Ga0157371_10079734 3300013102 Bacteria 2319
189 Ga0157371_10121099 3300013102 Bacteria 1860
190 Ga0157370_10063407 3300013104 Bacteria 3502
191 Ga0157370_10282298 3300013104 Bacteria 1534
192 Ga0157370_10332198 3300013104 Bacteria 1401
193 Ga0157369_10339687 3300013105 Bacteria 1560
194 Ga0157369_10661706 3300013105 Bacteria 1077
195 Ga0157374_10065627 3300013296 Bacteria 3409
196 Ga0157378_10339060 3300013297 Bacteria 1465
197 Ga0163162_10002746 3300013306 Bacteria 16703
198 Ga0157372_10035893 3300013307 Bacteria 5460
199 Ga0157372_10101197 3300013307 Bacteria 3289
200 Ga0157372_10166981 3300013307 Bacteria 2545
201 Ga0157372_10205672 3300013307 Bacteria 2281
202 Ga0157372_10752040 3300013307 Bacteria 1133
203 Ga0157375_10008143 3300013308 Bacteria 9170
204 Ga0157375_10154397 3300013308 Bacteria 2433
205 Ga0157375_10500986 3300013308 Bacteria 1379
206 Ga0157380_10051037 3300014326 Bacteria 3269
207 Ga0157380_10257426 3300014326 Bacteria 1583
208 Ga0157380_10882182 3300014326 Bacteria 919
209 Ga0157380_11590112 3300014326 Bacteria 709
210 Ga0157377_10087620 3300014745 Bacteria 1832
211 Ga0157377_10515834 3300014745 Bacteria 838
212 Ga0157379_10039351 3300014968 Bacteria 4218
213 Ga0157376_10349216 3300014969 Bacteria 1415
214 Ga0163161_10009496 3300017792 Bacteria 6731
215 Ga0163161_10171846 3300017792 Bacteria 1657
216 Ga0163161_10531334 3300017792 Bacteria 962
217 Ga0206356_10664571 3300020070 Bacteria 1562
218 Ga0206354_10301906 3300020081 Bacteria 1062
219 Ga0206354_10855475 3300020081 Bacteria 1286
220 Ga0206353_10122393 3300020082 Bacteria 4372
221 Ga0206353_11030654 3300020082 Bacteria 1223
222 Ga0206353_11521123 3300020082 Bacteria 8188
223 Ga0206353_11743485 3300020082 Bacteria 1224
224 Ga0213876_10081593 3300021384 Bacteria 1710
225 Ga0213875_10049861 3300021388 Bacteria 1962
226 Ga0207697_10027155 3300025315 Bacteria 2341
227 Ga0207656_10055751 3300025321 Bacteria 1721
228 Ga0207692_10085843 3300025898 Bacteria 1694
229 Ga0207710_10081738 3300025900 Bacteria 1500
230 Ga0207688_10015206 3300025901 Bacteria 4175
231 Ga0207688_10015922 3300025901 Bacteria 4077
232 Ga0207688_10123391 3300025901 Bacteria 1513
233 Ga0207688_10197705 3300025901 Bacteria 1204
234 Ga0207647_10041476 3300025904 Bacteria 2893
235 Ga0207647_10063353 3300025904 Bacteria 2249
236 Ga0207647_10067410 3300025904 Bacteria 2169
237 Ga0207647_10100243 3300025904 Bacteria 1719
238 Ga0207647_10202195 3300025904 Bacteria 1149
239 Ga0207645_10018549 3300025907 Bacteria 4575
240 Ga0207643_10000100 3300025908 Bacteria 58884
241 Ga0207643_10003328 3300025908 Bacteria 8661
242 Ga0207705_10048003 3300025909 Bacteria 3071
243 Ga0207705_10048274 3300025909 Bacteria 3061
244 Ga0207654_10184265 3300025911 Bacteria 1364
245 Ga0207707_10120932 3300025912 Bacteria 2289
246 Ga0207707_10261355 3300025912 Bacteria 1502
247 Ga0207707_10278319 3300025912 Bacteria 1450
248 Ga0207695_10025646 3300025913 Bacteria 6593
249 Ga0207695_10206410 3300025913 Bacteria 1877
250 Ga0207695_10341210 3300025913 Bacteria 1386
251 Ga0207671_10025439 3300025914 Bacteria 4446
252 Ga0207671_10122276 3300025914 Bacteria 1990
253 Ga0207671_10128858 3300025914 Bacteria 1940
254 Ga0207660_10653575 3300025917 Bacteria 857
255 Ga0207662_10005149 3300025918 Bacteria 6938
256 Ga0207662_10039986 3300025918 Bacteria 2754
257 Ga0207662_10144930 3300025918 Bacteria 1507
258 Ga0207662_10332443 3300025918 Bacteria 1017
259 Ga0207657_10010726 3300025919 Bacteria 9124
260 Ga0207657_10060396 3300025919 Bacteria 3253
261 Ga0207657_10074462 3300025919 Bacteria 2867
262 Ga0207649_10058045 3300025920 Bacteria 2422
263 Ga0207652_10313789 3300025921 Bacteria 1415
264 Ga0207694_10089127 3300025924 Bacteria 2433
265 Ga0207650_10282776 3300025925 Bacteria 1351
266 Ga0207659_10100631 3300025926 Bacteria 2178
267 Ga0207659_10293625 3300025926 Bacteria 1333
268 Ga0207687_10002966 3300025927 Bacteria 11494
269 Ga0207687_10058267 3300025927 Bacteria 2717
270 Ga0207687_10063166 3300025927 Bacteria 2621
271 Ga0207687_10398679 3300025927 Bacteria 1131
272 Ga0207687_10754813 3300025927 Bacteria 828
273 Ga0207664_10298077 3300025929 Bacteria 1418
274 Ga0207690_10010372 3300025932 Bacteria 5534
275 Ga0207690_10014869 3300025932 Bacteria 4710
276 Ga0207690_10047931 3300025932 Bacteria 2837
277 Ga0207690_10071359 3300025932 Bacteria 2395
278 Ga0207706_10272717 3300025933 Bacteria 1476
279 Ga0207686_10033772 3300025934 Bacteria 3056
280 Ga0207709_10670833 3300025935 Bacteria 827
281 Ga0207669_10040905 3300025937 Bacteria 2693
282 Ga0207669_10448619 3300025937 Bacteria 1022
283 Ga0207704_10066534 3300025938 Bacteria 2262
284 Ga0207704_10348033 3300025938 Bacteria 1153
285 Ga0207691_10009704 3300025940 Bacteria 9236
286 Ga0207691_10016940 3300025940 Bacteria 6915
287 Ga0207711_10057824 3300025941 Bacteria 3334
288 Ga0207689_10045864 3300025942 Bacteria 3614
289 Ga0207689_10117355 3300025942 Bacteria 2188
290 Ga0207689_10332680 3300025942 Bacteria 1261
291 Ga0207661_10012431 3300025944 Bacteria 6187
292 Ga0207661_10031047 3300025944 Bacteria 4122
293 Ga0207661_10035436 3300025944 Bacteria 3889
294 Ga0207661_10041082 3300025944 Bacteria 3639
295 Ga0207661_10044358 3300025944 Bacteria 3514
296 Ga0207661_10064962 3300025944 Bacteria 2960
297 Ga0207661_10097305 3300025944 Bacteria 2464
298 Ga0207661_10140032 3300025944 Bacteria 2081
299 Ga0207661_10738946 3300025944 Bacteria 905
300 Ga0207661_10892336 3300025944 Bacteria 819
301 Ga0207679_10081212 3300025945 Bacteria 2478
302 Ga0207679_10094241 3300025945 Bacteria 2324
303 Ga0207679_10171342 3300025945 Bacteria 1787
304 Ga0207679_10270967 3300025945 Bacteria 1452
305 Ga0207679_10777112 3300025945 Bacteria 872
306 Ga0207667_10155460 3300025949 Bacteria 2353
307 Ga0207667_10249536 3300025949 Bacteria 1815
308 Ga0207667_10304779 3300025949 Bacteria 1627
309 Ga0207667_10945749 3300025949 Bacteria 851
310 Ga0207651_10023558 3300025960 Bacteria 3791
311 Ga0207651_10051552 3300025960 Bacteria 2801
312 Ga0207712_10275685 3300025961 Bacteria 1370
313 Ga0207640_10077392 3300025981 Bacteria 2261
314 Ga0207658_10009016 3300025986 Bacteria 6766
315 Ga0207658_10028588 3300025986 Bacteria 3927
316 Ga0207658_10365979 3300025986 Bacteria 1259
317 Ga0207658_10385369 3300025986 Bacteria 1229
318 Ga0207677_10714709 3300026023 Bacteria 890
319 Ga0207677_10764601 3300026023 Bacteria 862
320 Ga0207703_10106370 3300026035 Bacteria 2386
321 Ga0207639_10392818 3300026041 Bacteria 1248
322 Ga0207678_10002842 3300026067 Bacteria 15701
323 Ga0207678_10068635 3300026067 Bacteria 3041
324 Ga0207708_10000786 3300026075 Bacteria 23943
325 Ga0207708_10052761 3300026075 Bacteria 3097
326 Ga0207702_10103325 3300026078 Bacteria 2520
327 Ga0207702_10639022 3300026078 Bacteria 1046
328 Ga0207702_11341243 3300026078 Bacteria 709
329 Ga0207641_10222852 3300026088 Bacteria 1749
330 Ga0207641_10557923 3300026088 Bacteria 1118
331 Ga0207648_10123460 3300026089 Bacteria 2277
332 Ga0207648_10462872 3300026089 Bacteria 1156
333 Ga0207676_10067002 3300026095 Bacteria 2866
334 Ga0207674_10038543 3300026116 Bacteria 4957
335 Ga0207674_10260536 3300026116 Bacteria 1681
336 Ga0207674_10282679 3300026116 Bacteria 1607
337 Ga0207674_10862854 3300026116 Bacteria 873
338 Ga0207675_100197651 3300026118 Bacteria 1931
339 Ga0207675_100917568 3300026118 Bacteria 892
340 Ga0207683_10000565 3300026121 Bacteria 34282
341 Ga0207683_10094315 3300026121 Bacteria 2667
342 Ga0207683_10172921 3300026121 Bacteria 1957
343 Ga0207698_10054593 3300026142 Bacteria 3074
344 Ga0207698_10058156 3300026142 Bacteria 2995
345 Ga0207698_10182676 3300026142 Bacteria 1860
346 Ga0207698_10222333 3300026142 Bacteria 1707
347 Ga0207428_10053593 3300027907 Bacteria 3216
348 Ga0268266_10004579 3300028379 Bacteria 13206
349 Ga0268266_10058281 3300028379 Bacteria 3325
350 Ga0268266_10276895 3300028379 Bacteria 1559
351 Ga0268266_10885167 3300028379 Bacteria 863
352 Ga0268264_10038630 3300028381 Bacteria 3940
353 Ga0268264_10300168 3300028381 Bacteria 1512
354 Ga0314311_1124506 3300030733 Bacteria 991
355 Ga0307408_100393487 3300031548 Bacteria 1188
356 Ga0307408_100503294 3300031548 Bacteria 1061
357 Ga0307405_10096666 3300031731 Bacteria 1970
358 Ga0307405_10379074 3300031731 Bacteria 1100
359 Ga0307413_10040012 3300031824 Bacteria 2732
360 Ga0307413_10295835 3300031824 Bacteria 1225
361 Ga0307413_10408564 3300031824 Bacteria 1066
362 Ga0307410_10039162 3300031852 Bacteria 3110
363 Ga0307410_10299767 3300031852 Bacteria 1268
364 Ga0307410_10308953 3300031852 Bacteria 1250
365 Ga0307410_10481075 3300031852 Bacteria 1018
366 Ga0307410_10525675 3300031852 Bacteria 977
367 Ga0307406_10094187 3300031901 Bacteria 2024
368 Ga0307406_10100755 3300031901 Bacteria 1967
369 Ga0307407_10098732 3300031903 Bacteria 1807
370 Ga0307407_10466002 3300031903 Bacteria 920
371 Ga0307412_10206428 3300031911 Bacteria 1496
372 Ga0307412_10343032 3300031911 Bacteria 1196
373 Ga0307409_100071034 3300031995 Bacteria 2766
374 Ga0307409_100128509 3300031995 Bacteria 2160
375 Ga0307409_100257482 3300031995 Bacteria 1599
376 Ga0307409_100339704 3300031995 Bacteria 1412
377 Ga0307409_101194215 3300031995 Bacteria 784
378 Ga0307416_100030850 3300032002 Bacteria 4028
379 Ga0307416_100170926 3300032002 Bacteria 2023
380 Ga0307416_100302006 3300032002 Bacteria 1592
381 Ga0307416_100418949 3300032002 Bacteria 1382
382 Ga0307416_100833295 3300032002 Bacteria 1020
383 Ga0307416_101377175 3300032002 Bacteria 811
384 Ga0307414_10571288 3300032004 Bacteria 1010
385 Ga0307411_10086488 3300032005 Bacteria 2175
386 Ga0307415_100030331 3300032126 Bacteria 3469
387 Ga0307415_100031405 3300032126 Bacteria 3421
388 Ga0307415_100213819 3300032126 Bacteria 1540
389 Ga0316574_0352021 3300035398 Bacteria 932
390 Ga0373947_0695791 3300035725 Bacteria 693
391 Ga0395898_0172914 3300037466 Bacteria 2065
392 Ga0395905_0021832 3300037471 Bacteria 6055
393 Ga0395905_0405804 3300037471 Bacteria 1258
394 Ga0436364_1506248 3300037853 Bacteria 3015
395 Ga0395901_0084177 3300038443 Bacteria 3324
396 Ga0395901_0320662 3300038443 Bacteria 1603
397 Ga0395901_0808815 3300038443 Bacteria 926
398 Ga0436365_0005613 3300039437 Bacteria 2285
399 Ga0439438_020715 3300041405 Bacteria 1843
400 Ga0451853_0740919 3300041512 Bacteria 1524
401 Ga0451853_0786083 3300041512 Bacteria 972
402 Ga0451853_4119957 3300041512 Bacteria 2352
403 Ga0439445_0038825 3300042004 Bacteria 1260
404 Ga0439448_0011570 3300042005 Bacteria 2631
405 Ga0450914_007739 3300042118 Bacteria 978
406 Ga0439458_0009932 3300042157 Bacteria 2119
407 Ga0439434_0003200 3300042435 Bacteria 4809
408 Ga0466972_0009367 3300044658 Bacteria 4923
409 Ga0466972_0062815 3300044658 Bacteria 1779
410 Ga0466972_0064381 3300044658 Bacteria 1755
411 Ga0466972_0093198 3300044658 Bacteria 1428
412 Ga0466965_0005158 3300044683 Bacteria 5864
413 Ga0466965_0016158 3300044683 Bacteria 3548
414 Ga0466965_0045897 3300044683 Bacteria 2162
415 Ga0466965_0374484 3300044683 Bacteria 783
416 Ga0466966_0008820 3300044684 Bacteria 6676
417 Ga0466966_0009895 3300044684 Bacteria 6320
418 Ga0466966_0016377 3300044684 Bacteria 4899
419 Ga0466966_0019540 3300044684 Bacteria 4457
420 Ga0466966_0027302 3300044684 Bacteria 3723
421 Ga0466966_0082754 3300044684 Bacteria 1997
422 Ga0466966_0121636 3300044684 Bacteria 1603
423 Ga0466966_0466367 3300044684 Bacteria 759
424 Ga0466961_0005682 3300044693 Bacteria 7887
425 Ga0466961_0012524 3300044693 Bacteria 5427
426 Ga0466961_0030207 3300044693 Bacteria 3483
427 Ga0466961_0078603 3300044693 Bacteria 2089
428 Ga0466961_0080179 3300044693 Bacteria 2066
429 Ga0466961_0108550 3300044693 Bacteria 1747
430 Ga0466961_0268145 3300044693 Bacteria 1046
431 Ga0466961_0378045 3300044693 Bacteria 860
432 Ga0466961_0424427 3300044693 Bacteria 806
433 Ga0466963_0010373 3300044694 Bacteria 5639
434 Ga0466963_0021922 3300044694 Bacteria 4038
435 Ga0466963_0105852 3300044694 Bacteria 1928
436 Ga0466963_0201424 3300044694 Bacteria 1392
437 Ga0466963_0239434 3300044694 Bacteria 1272
438 Ga0466964_0005603 3300044706 Bacteria 4666
439 Ga0466964_0043570 3300044706 Bacteria 1821
440 Ga0466964_0219482 3300044706 Bacteria 922
441 Ga0466971_0019657 3300044719 Bacteria 3001
442 Ga0466971_0139750 3300044719 Bacteria 1127
443 Ga0466968_0020207 3300044735 Bacteria 2686
444 Ga0466968_0082192 3300044735 Bacteria 1417
445 Ga0466970_0007594 3300044765 Bacteria 5435
446 Ga0466970_0009506 3300044765 Bacteria 4916
447 Ga0466970_0027086 3300044765 Bacteria 3006
448 Ga0466970_0039692 3300044765 Bacteria 2499
449 Ga0466970_0048016 3300044765 Bacteria 2276
450 Ga0466970_0054941 3300044765 Bacteria 2126
451 Ga0466970_0191582 3300044765 Bacteria 1136
452 Ga0466970_0324227 3300044765 Bacteria 871
453 Ga0466957_0016712 3300044842 Bacteria 4292
454 Ga0466957_0025147 3300044842 Bacteria 3528
455 Ga0466957_0063950 3300044842 Bacteria 2263
456 Ga0466957_0066993 3300044842 Bacteria 2215
457 Ga0466957_0067043 3300044842 Bacteria 2214
458 Ga0466960_0000389 3300044901 Bacteria 15045
459 Ga0466960_0027309 3300044901 Bacteria 2602
460 Ga0466960_0028802 3300044901 Bacteria 2544
461 Ga0466960_0055071 3300044901 Bacteria 1933
462 Ga0466960_0075534 3300044901 Bacteria 1686
463 Ga0466960_0337797 3300044901 Bacteria 856
464 Ga0466959_0009269 3300045049 Bacteria 6995
465 Ga0466959_0010923 3300045049 Bacteria 6511
466 Ga0466959_0033462 3300045049 Bacteria 3801
467 Ga0466959_0052515 3300045049 Bacteria 2984
468 Ga0466959_0167677 3300045049 Bacteria 1541
469 Ga0466959_0286977 3300045049 Bacteria 1129
470 Ga0466959_0288228 3300045049 Bacteria 1126
471 Ga0466959_0324629 3300045049 Bacteria 1052
472 Ga0466959_0469566 3300045049 Bacteria 852
473 Ga0466958_0025759 3300045836 Bacteria 3470
474 Ga0466958_0097642 3300045836 Bacteria 1823
475 Ga0466958_0101486 3300045836 Bacteria 1789
476 Ga0466958_0107958 3300045836 Bacteria 1736
477 Ga0466958_0346969 3300045836 Bacteria 955
478 Ga0466967_0000727 3300045976 Bacteria 16858
479 Ga0466967_0006336 3300045976 Bacteria 8357
480 Ga0466967_0006597 3300045976 Bacteria 8243
481 Ga0466967_0026519 3300045976 Bacteria 4801
482 Ga0466967_0048979 3300045976 Bacteria 3693
483 Ga0466967_0082642 3300045976 Bacteria 2903
484 Ga0466967_0115486 3300045976 Bacteria 2472
485 Ga0466967_0152013 3300045976 Bacteria 2164
486 Ga0466967_0182440 3300045976 Bacteria 1980
487 Ga0466967_0219638 3300045976 Bacteria 1805
488 Ga0466967_0276146 3300045976 Bacteria 1611
489 Ga0466967_0385555 3300045976 Bacteria 1361
490 Ga0466967_0434117 3300045976 Bacteria 1282
491 Ga0466967_0671600 3300045976 Bacteria 1025
492 Ga0466967_1169824 3300045976 Bacteria 766
493 Ga0495603_0118031 3300046455 Bacteria 1547
494 Ga0495582_0515591 3300046473 Bacteria 691
495 Ga0495639_0181426 3300046475 Bacteria 1025
496 Ga0495664_0018905 3300046477 Bacteria 3955
497 Ga0495643_0093253 3300046522 Bacteria 1551
498 Ga0495648_0021804 3300046524 Bacteria 4427
499 Ga0495645_0278894 3300046543 Bacteria 1100
500 Ga0495635_0348638 3300046663 Bacteria 988
501 Ga0495635_0492966 3300046663 Bacteria 807
502 Ga0495657_0107759 3300046675 Bacteria 1768
503 Ga0495658_0514730 3300046683 Bacteria 766
504 Ga0495680_0106793 3300047322 Bacteria 2080
505 Ga0496100_0082924 3300048903 Bacteria 2169
506 Ga0496100_0215927 3300048903 Bacteria 1405
507 Ga0496100_0335432 3300048903 Bacteria 1139
508 Ga0496102_0008533 3300048905 Bacteria 8785
509 Ga0496102_0062971 3300048905 Bacteria 3396
510 Ga0496102_0149808 3300048905 Bacteria 2191
511 Ga0496102_0399641 3300048905 Bacteria 1292
512 Ga0496102_0506586 3300048905 Bacteria 1129
513 Ga0496102_0589081 3300048905 Bacteria 1035
514 Ga0496102_0626871 3300048905 Bacteria 998
515 Ga0496103_0070358 3300048906 Bacteria 2189
516 Ga0496103_0417721 3300048906 Bacteria 861
517 Ga0496104_0004891 3300048907 Bacteria 11682
518 Ga0496104_0061498 3300048907 Bacteria 3560
519 Ga0496104_0064806 3300048907 Bacteria 3466
520 Ga0496104_0280978 3300048907 Bacteria 1578
521 Ga0496104_0391999 3300048907 Bacteria 1301
522 Ga0496105_0016582 3300048908 Bacteria 5882
523 Ga0496105_0031900 3300048908 Bacteria 4321
524 Ga0496105_0149894 3300048908 Bacteria 1917
525 Ga0496106_0063822 3300048909 Bacteria 2800
526 Ga0496106_0073228 3300048909 Bacteria 2620
527 Ga0496106_0140054 3300048909 Bacteria 1902
528 Ga0496106_0171225 3300048909 Bacteria 1721
529 Ga0496106_0303692 3300048909 Bacteria 1280
530 Ga0496107_0010995 3300048910 Bacteria 6296
531 Ga0496107_0056858 3300048910 Bacteria 2827
532 Ga0496107_0132739 3300048910 Bacteria 1839
533 Ga0496107_0216495 3300048910 Bacteria 1424
534 Ga0496107_0518866 3300048910 Bacteria 883
535 Ga0496107_0610816 3300048910 Bacteria 805
536 Ga0496108_0034934 3300048911 Bacteria 4177
537 Ga0496108_0039949 3300048911 Bacteria 3910
538 Ga0496108_0049105 3300048911 Bacteria 3529
539 Ga0496108_0052559 3300048911 Bacteria 3415
540 Ga0496108_0129466 3300048911 Bacteria 2169
541 Ga0496109_0009876 3300048912 Bacteria 8148
542 Ga0496109_0047925 3300048912 Bacteria 3887
543 Ga0496109_0051661 3300048912 Bacteria 3744
544 Ga0496109_0052834 3300048912 Bacteria 3705
545 Ga0496109_0069632 3300048912 Bacteria 3227
546 Ga0496109_0113315 3300048912 Bacteria 2522
547 Ga0496109_0153136 3300048912 Bacteria 2159
548 Ga0496109_0349155 3300048912 Bacteria 1397
549 Ga0496109_0798912 3300048912 Bacteria 881
550 Ga0496110_0018218 3300048913 Bacteria 5885
551 Ga0496110_0118546 3300048913 Bacteria 2383
552 Ga0496110_0177292 3300048913 Bacteria 1935
553 Ga0496110_0404397 3300048913 Bacteria 1244
554 Ga0496111_0005153 3300048914 Bacteria 8333
555 Ga0496111_0027398 3300048914 Bacteria 4031
556 Ga0496111_0031104 3300048914 Bacteria 3800
557 Ga0496111_0088925 3300048914 Bacteria 2262
558 Ga0496111_0211399 3300048914 Bacteria 1441
559 Ga0496112_0468731 3300048915 Bacteria 1197
560 Ga0496113_0062276 3300048916 Bacteria 2817
561 Ga0496113_0077007 3300048916 Bacteria 2549
562 Ga0496113_0091951 3300048916 Bacteria 2339
563 Ga0496113_0168130 3300048916 Bacteria 1736
564 Ga0496113_0248578 3300048916 Bacteria 1420
565 Ga0496114_0018030 3300048917 Bacteria 5703
566 Ga0496114_0020867 3300048917 Bacteria 5320
567 Ga0496114_0023003 3300048917 Bacteria 5080
568 Ga0496114_0027407 3300048917 Bacteria 4666
569 Ga0496114_0029410 3300048917 Bacteria 4516
570 Ga0496114_0052772 3300048917 Bacteria 3387
571 Ga0496114_0148944 3300048917 Bacteria 2030
572 Ga0496114_0290411 3300048917 Bacteria 1443
573 Ga0496114_0291482 3300048917 Bacteria 1440
574 Ga0496114_0350137 3300048917 Bacteria 1306
575 Ga0496114_0376250 3300048917 Bacteria 1257
576 Ga0496114_0453728 3300048917 Bacteria 1135
577 Ga0496115_0001170 3300048918 Bacteria 18807
578 Ga0496115_0018278 3300048918 Bacteria 5379
579 Ga0496115_0264211 3300048918 Bacteria 1415
580 Ga0496115_0275362 3300048918 Bacteria 1382
581 Ga0496119_0000104 3300048922 Bacteria 121325
582 Ga0496120_0005467 3300048923 Bacteria 10127
583 Ga0501031_0015220 3300049568 Bacteria 4995
584 Ga0501031_0062971 3300049568 Bacteria 2417
585 Ga0501031_0392452 3300049568 Bacteria 898
586 Ga0501032_0075124 3300049569 Bacteria 2251
587 Ga0501033_0001922 3300049570 Bacteria 18091
588 Ga0501034_0018756 3300049571 Bacteria 7090
589 Ga0501034_0085044 3300049571 Bacteria 3165
590 Ga0501034_0180748 3300049571 Bacteria 2074
591 Ga0501036_0015244 3300049572 Bacteria 6418
592 Ga0501036_0132273 3300049572 Bacteria 2106
593 Ga0501036_0480201 3300049572 Bacteria 1035
594 Ga0501038_0005918 3300049574 Bacteria 11303
595 Ga0501038_0268816 3300049574 Bacteria 1345
596 Ga0501038_0562591 3300049574 Bacteria 866
597 Ga0501039_0040907 3300049575 Bacteria 3578
598 Ga0501039_0121897 3300049575 Bacteria 2044
599 Ga0501039_0138563 3300049575 Bacteria 1911
600 Ga0501039_0170345 3300049575 Bacteria 1712
601 Ga0501039_0212082 3300049575 Bacteria 1523
602 Ga0501039_0252390 3300049575 Bacteria 1387
603 Ga0501040_0079656 3300049576 Bacteria 2268
604 Ga0501040_0098835 3300049576 Bacteria 2034
605 Ga0501042_0018167 3300049578 Bacteria 4866
606 Ga0501042_0057247 3300049578 Bacteria 2782
607 Ga0501042_0095761 3300049578 Bacteria 2133
608 Ga0501043_0006006 3300049579 Bacteria 9764
609 Ga0501043_0045801 3300049579 Bacteria 3439
610 Ga0501043_0251777 3300049579 Bacteria 1360
611 Ga0501043_0484381 3300049579 Bacteria 926
612 Ga0501046_0000633 3300049580 Bacteria 34519
613 Ga0501046_0020040 3300049580 Bacteria 5537
614 Ga0501047_0234615 3300049581 Bacteria 1686
615 Ga0501047_0629933 3300049581 Bacteria 893
616 Ga0501048_0021335 3300049582 Bacteria 4741
617 Ga0501048_0063280 3300049582 Bacteria 2617
618 Ga0501048_0349230 3300049582 Bacteria 1055
619 Ga0501048_0375680 3300049582 Bacteria 1015
620 Ga0501048_0576193 3300049582 Bacteria 808
621 Ga0501067_0012114 3300049583 Bacteria 4781
622 Ga0501067_0117417 3300049583 Bacteria 1479
623 Ga0501068_0051744 3300049584 Bacteria 2485
624 Ga0501068_0141420 3300049584 Bacteria 1509
625 Ga0501069_0005208 3300049585 Bacteria 6761
626 Ga0501069_0043323 3300049585 Bacteria 2491
627 Ga0501069_0106759 3300049585 Bacteria 1592
628 Ga0501069_0265888 3300049585 Bacteria 1002
629 Ga0501070_0030673 3300049586 Bacteria 4504
630 Ga0501070_0046658 3300049586 Bacteria 3602
631 Ga0501070_0063609 3300049586 Bacteria 3056
632 Ga0501070_0074887 3300049586 Bacteria 2802
633 Ga0501070_0075161 3300049586 Bacteria 2796
634 Ga0501070_0248511 3300049586 Bacteria 1455
635 Ga0501070_0328614 3300049586 Bacteria 1243
636 Ga0501070_0339743 3300049586 Bacteria 1220
637 Ga0501070_0525340 3300049586 Bacteria 949
638 Ga0501070_0909123 3300049586 Bacteria 686
639 Ga0501071_0005496 3300049587 Bacteria 8154
640 Ga0501071_0030203 3300049587 Bacteria 3832
641 Ga0501071_0060675 3300049587 Bacteria 2738
642 Ga0501071_0265008 3300049587 Bacteria 1298
643 Ga0501071_0310804 3300049587 Bacteria 1196
644 Ga0501072_0011083 3300049588 Bacteria 6879
645 Ga0501073_0032743 3300049589 Bacteria 3705
646 Ga0501073_0113022 3300049589 Bacteria 1883
647 Ga0501073_0210246 3300049589 Bacteria 1344
648 Ga0501074_0073098 3300049590 Bacteria 2463
649 Ga0501074_0125153 3300049590 Bacteria 1838
650 Ga0501074_0293894 3300049590 Bacteria 1154
651 Ga0501074_0430433 3300049590 Bacteria 936
652 Ga0501075_0247680 3300049591 Bacteria 1358
653 Ga0501079_0076481 3300049741 Bacteria 2589
654 Ga0501079_0308937 3300049741 Bacteria 1237
655 Ga0501079_0398283 3300049741 Bacteria 1080
656 Ga0501080_0006057 3300049742 Bacteria 10841
657 Ga0501080_0070239 3300049742 Bacteria 3257
658 Ga0501080_0182781 3300049742 Bacteria 1929
659 Ga0501080_0335595 3300049742 Bacteria 1366
660 Ga0501081_0310541 3300049743 Bacteria 1158
661 Ga0501083_0252621 3300049744 Bacteria 1147
662 Ga0501083_0370333 3300049744 Bacteria 932
663 Ga0501044_0011939 3300049823 Bacteria 9414
664 Ga0501044_0187060 3300049823 Bacteria 2035
665 Ga0501045_0117317 3300049824 Bacteria 1976
666 Ga0501045_0449536 3300049824 Bacteria 958
667 nmdc:mga03683_179737_c1 3300050489 Bacteria 965
668 nmdc:mga03n38_1274_c1 3300050490 Bacteria 7089
669 nmdc:mga00v17_19640_c1 3300050491 Bacteria 3862
670 nmdc:mga00v17_243217_c1 3300050491 Bacteria 1167
671 nmdc:mga00v17_2605_c1 3300050491 Bacteria 9247
672 nmdc:mga00v17_393393_c1 3300050491 Bacteria 901
673 nmdc:mga00v17_60527_c1 3300050491 Bacteria 2326
674 nmdc:mga00v17_65549_c1 3300050491 Bacteria 1689
675 nmdc:mga0yw44_119577_c1 3300050492 Bacteria 1696
676 nmdc:mga0yw44_167598_c1 3300050492 Bacteria 1441
677 nmdc:mga0yw44_1903_c1 3300050492 Bacteria 8611
678 nmdc:mga0yw44_20892_c1 3300050492 Bacteria 3643
679 nmdc:mga0yw44_228022_c1 3300050492 Bacteria 1236
680 nmdc:mga0yw44_230278_c2 3300050492 Bacteria 768
681 nmdc:mga0yw44_29800_c1 3300050492 Bacteria 3155
682 nmdc:mga0yw44_417933_c1 3300050492 Bacteria 908
683 nmdc:mga0yw44_50103_c1 3300050492 Bacteria 2524
684 nmdc:mga0yw44_65071_c1 3300050492 Bacteria 2246
685 nmdc:mga06z11_13579_c1 3300050494 Bacteria 3582
686 nmdc:mga06z11_265827_c1 3300050494 Bacteria 1013
687 nmdc:mga06z11_371447_c1 3300050494 Bacteria 858
688 nmdc:mga06z11_523129_c1 3300050494 Bacteria 719
689 nmdc:mga06z11_70175_c1 3300050494 Bacteria 1852
690 nmdc:mga04h51_11830_c1 3300050495 Bacteria 2433
691 nmdc:mga04h51_39291_c1 3300050495 Bacteria 1537
692 nmdc:mga07m45_73681_c1 3300050496 Bacteria 1944
693 nmdc:mga07m45_85565_c1 3300050496 Bacteria 1803
694 nmdc:mga07m45_9631_c1 3300050496 Bacteria 5021
695 nmdc:mga05p37_220164_c1 3300050507 Bacteria 2291
696 nmdc:mga08y16_29745_c1 3300050511 Bacteria 5751
697 nmdc:mga08y16_496685_c1 3300050511 Bacteria 1240
698 nmdc:mga08x19_117537_c1 3300050514 Bacteria 1779
699 nmdc:mga0a205_83665_c1 3300050515 Bacteria 2035
700 Ga0495601_0317901 3300053077 Bacteria 1014
701 Ga0495595_0078290 3300053084 Bacteria 1572
702 Ga0495595_0112457 3300053084 Bacteria 1321
703 Ga0495619_0005036 3300053085 Bacteria 8391
704 Ga0495619_0415006 3300053085 Bacteria 929
705 Ga0500644_0000678 3300053088 Bacteria 12375
706 Ga0500573_0101552 3300053140 Bacteria 1618
707 Ga0500573_0173864 3300053140 Bacteria 1162
708 Ga0500620_041692 3300053155 Bacteria 1509
709 Ga0501084_0075926 3300054114 Bacteria 2816
710 Ga0501084_0253839 3300054114 Bacteria 1484
711 Ga0501084_0530923 3300054114 Bacteria 995
712 Ga0590075_109851 3300059424 Bacteria 720
713 Ga0590077_026068 3300059426 Bacteria 1262
714 Ga0501082_0009085 3300060353 Bacteria 8574
715 Ga0501082_0435360 3300060353 Bacteria 1145
716 Ga0501082_0863155 3300060353 Bacteria 792
717 Ga0466962_0139255 3300061719 Bacteria 1175
718 Ga0530510_0145546 3300061734 Bacteria 1748

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0084177 Ga0395901_0084177_2310_2951 187
2 3300009177 Ga0105248_10227251 Ga0105248_102272512 188
3 3300025904 Ga0207647_10202195 Ga0207647_102021952 189
4 3300049590 Ga0501074_0430433 Ga0501074_0430433_14_595 189
5 3300006038 Ga0075365_10025922 Ga0075365_100259224 191
6 3300050492 nmdc:mga0yw44_20892_c1 nmdc:mga0yw44_20892_c1_2433_3128 191
7 3300045976 Ga0466967_0434117 Ga0466967_0434117_607_1245 193
8 3300048917 Ga0496114_0018030 Ga0496114_0018030_2621_3274 193
9 3300035398 Ga0316574_0352021 Ga0316574_0352021_215_859 195
10 3300045976 Ga0466967_0026519 Ga0466967_0026519_803_1456 196
11 3300044694 Ga0466963_0201424 Ga0466963_0201424_315_1004 197
12 3300053088 Ga0500644_0000678 Ga0500644_0000678_24_632 197
13 3300048909 Ga0496106_0171225 Ga0496106_0171225_14_625 198
14 3300050494 nmdc:mga06z11_265827_c1 nmdc:mga06z11_265827_c1_291_926 198
15 3300054114 Ga0501084_0530923 Ga0501084_0530923_13_627 198
16 3300005471 Ga0070698_100000363 Ga0070698_10000036316 200
17 3300041405 Ga0439438_020715 Ga0439438_020715_981_1610 200
18 3300042004 Ga0439445_0038825 Ga0439445_0038825_195_824 200
19 3300042435 Ga0439434_0003200 Ga0439434_0003200_2462_3091 200
20 3300048911 Ga0496108_0129466 Ga0496108_0129466_1156_1806 200
21 3300049582 Ga0501048_0576193 Ga0501048_0576193_60_689 200
22 3300049587 Ga0501071_0030203 Ga0501071_0030203_3090_3719 200
23 3300049824 Ga0501045_0117317 Ga0501045_0117317_347_976 200
24 3300060353 Ga0501082_0435360 Ga0501082_0435360_96_725 200
25 iso_pu_bacteria 2643221561 2643824120 202
26 iso_pu_bacteria 2643221696 2644533426 202
27 3300005329 Ga0070683_100096868 Ga0070683_1000968682 203
28 3300009545 Ga0105237_10193530 Ga0105237_101935303 203
29 3300020082 Ga0206353_11521123 Ga0206353_115211235 203
30 3300025914 Ga0207671_10128858 Ga0207671_101288581 203
31 3300025944 Ga0207661_10097305 Ga0207661_100973052 203
32 3300049586 Ga0501070_0030673 Ga0501070_0030673_718_1359 203
33 3300049586 Ga0501070_0063609 Ga0501070_0063609_26_667 203
34 3300049586 Ga0501070_0328614 Ga0501070_0328614_202_843 203
35 iso_pu_bacteria 2773857762 2774394499 203
36 iso_pu_bacteria 2808606439 2809194647 203
37 iso_pu_bacteria 2811994878 2812349388 203
38 iso_pu_bacteria 2891968417 2891972900 203
39 3300025904 Ga0207647_10067410 Ga0207647_100674103 204
40 3300049568 Ga0501031_0015220 Ga0501031_0015220_3485_4117 204
41 3300049570 Ga0501033_0001922 Ga0501033_0001922_10417_11052 204
42 3300049571 Ga0501034_0180748 Ga0501034_0180748_516_1148 204
43 3300049572 Ga0501036_0015244 Ga0501036_0015244_2147_2779 204
44 3300049575 Ga0501039_0040907 Ga0501039_0040907_1110_1742 204
45 3300049578 Ga0501042_0018167 Ga0501042_0018167_2688_3320 204
46 3300049579 Ga0501043_0006006 Ga0501043_0006006_3375_4007 204
47 3300049579 Ga0501043_0045801 Ga0501043_0045801_1933_2568 204
48 3300049580 Ga0501046_0000633 Ga0501046_0000633_14206_14841 204
49 3300049580 Ga0501046_0020040 Ga0501046_0020040_4063_4695 204
50 3300049581 Ga0501047_0629933 Ga0501047_0629933_43_678 204
51 3300049582 Ga0501048_0021335 Ga0501048_0021335_3035_3667 204
52 3300049586 Ga0501070_0248511 Ga0501070_0248511_745_1377 204
53 3300049586 Ga0501070_0909123 Ga0501070_0909123_23_664 204
54 3300049589 Ga0501073_0032743 Ga0501073_0032743_2692_3324 204
55 3300049742 Ga0501080_0006057 Ga0501080_0006057_6343_6975 204
56 3300050492 nmdc:mga0yw44_65071_c1 nmdc:mga0yw44_65071_c1_1312_1950 204
57 3300005337 Ga0070682_100293176 Ga0070682_1002931761 205
58 3300005354 Ga0070675_100263189 Ga0070675_1002631892 205
59 3300005366 Ga0070659_100338641 Ga0070659_1003386412 205
60 3300005438 Ga0070701_10185773 Ga0070701_101857732 205
61 3300005548 Ga0070665_100366668 Ga0070665_1003666681 205
62 3300005719 Ga0068861_100561646 Ga0068861_1005616462 205
63 3300005840 Ga0068870_10239403 Ga0068870_102394032 205
64 3300009551 Ga0105238_10104253 Ga0105238_101042533 205
65 3300013308 Ga0157375_10008143 Ga0157375_100081433 205
66 3300014326 Ga0157380_10257426 Ga0157380_102574263 205
67 3300017792 Ga0163161_10009496 Ga0163161_100094963 205
68 3300025901 Ga0207688_10123391 Ga0207688_101233912 205
69 3300025945 Ga0207679_10094241 Ga0207679_100942411 205
70 3300026118 Ga0207675_100197651 Ga0207675_1001976513 205
71 3300026142 Ga0207698_10182676 Ga0207698_101826762 205
72 3300030733 Ga0314311_1124506 Ga0314311_11245062 205
73 3300031548 Ga0307408_100503294 Ga0307408_1005032942 205
74 3300031852 Ga0307410_10299767 Ga0307410_102997672 205
75 3300031995 Ga0307409_100071034 Ga0307409_1000710343 205
76 3300032002 Ga0307416_100302006 Ga0307416_1003020062 205
77 3300032002 Ga0307416_100833295 Ga0307416_1008332952 205
78 3300037471 Ga0395905_0021832 Ga0395905_0021832_5224_5868 205
79 3300041512 Ga0451853_4119957 Ga0451853_4119957_550_1212 205
80 3300044658 Ga0466972_0062815 Ga0466972_0062815_859_1497 205
81 3300044693 Ga0466961_0108550 Ga0466961_0108550_1086_1724 205
82 3300044765 Ga0466970_0027086 Ga0466970_0027086_441_1079 205
83 3300044765 Ga0466970_0039692 Ga0466970_0039692_379_1017 205
84 3300044901 Ga0466960_0075534 Ga0466960_0075534_285_923 205
85 3300045976 Ga0466967_0385555 Ga0466967_0385555_592_1230 205
86 3300048917 Ga0496114_0350137 Ga0496114_0350137_166_828 205
87 3300049569 Ga0501032_0075124 Ga0501032_0075124_1539_2183 205
88 3300049571 Ga0501034_0018756 Ga0501034_0018756_187_831 205
89 3300049574 Ga0501038_0005918 Ga0501038_0005918_5053_5697 205
90 3300049578 Ga0501042_0057247 Ga0501042_0057247_76_720 205
91 3300049579 Ga0501043_0251777 Ga0501043_0251777_644_1288 205
92 3300049581 Ga0501047_0234615 Ga0501047_0234615_660_1304 205
93 3300049584 Ga0501068_0051744 Ga0501068_0051744_1303_1965 205
94 3300049823 Ga0501044_0011939 Ga0501044_0011939_2670_3314 205
95 3300049824 Ga0501045_0449536 Ga0501045_0449536_229_873 205
96 3300005337 Ga0070682_100398046 Ga0070682_1003980462 206
97 3300005367 Ga0070667_100007583 Ga0070667_1000075836 206
98 3300005563 Ga0068855_100113651 Ga0068855_1001136512 206
99 3300005563 Ga0068855_100276624 Ga0068855_1002766243 206
100 3300005614 Ga0068856_100841420 Ga0068856_1008414202 206
101 3300005616 Ga0068852_101138780 Ga0068852_1011387801 206
102 3300006038 Ga0075365_10275209 Ga0075365_102752092 206
103 3300006051 Ga0075364_10089036 Ga0075364_100890362 206
104 3300006844 Ga0075428_100965489 Ga0075428_1009654891 206
105 3300006881 Ga0068865_100856564 Ga0068865_1008565642 206
106 3300009093 Ga0105240_10010898 Ga0105240_1001089812 206
107 3300009148 Ga0105243_10439882 Ga0105243_104398822 206
108 3300009545 Ga0105237_10015753 Ga0105237_100157536 206
109 3300009545 Ga0105237_11041106 Ga0105237_110411061 206
110 3300010375 Ga0105239_10026655 Ga0105239_100266553 206
111 3300010375 Ga0105239_10728758 Ga0105239_107287582 206
112 3300012510 Ga0157316_1017087 Ga0157316_10170871 206
113 3300013105 Ga0157369_10661706 Ga0157369_106617062 206
114 3300013307 Ga0157372_10752040 Ga0157372_107520402 206
115 3300013308 Ga0157375_10154397 Ga0157375_101543972 206
116 3300014969 Ga0157376_10349216 Ga0157376_103492163 206
117 3300021384 Ga0213876_10081593 Ga0213876_100815932 206
118 3300025904 Ga0207647_10063353 Ga0207647_100633532 206
119 3300025913 Ga0207695_10025646 Ga0207695_100256464 206
120 3300025913 Ga0207695_10341210 Ga0207695_103412102 206
121 3300025914 Ga0207671_10025439 Ga0207671_100254392 206
122 3300025917 Ga0207660_10653575 Ga0207660_106535751 206
123 3300025918 Ga0207662_10144930 Ga0207662_101449301 206
124 3300025949 Ga0207667_10249536 Ga0207667_102495362 206
125 3300025949 Ga0207667_10304779 Ga0207667_103047791 206
126 3300025986 Ga0207658_10009016 Ga0207658_100090163 206
127 3300026121 Ga0207683_10094315 Ga0207683_100943152 206
128 3300028379 Ga0268266_10276895 Ga0268266_102768951 206
129 3300031824 Ga0307413_10295835 Ga0307413_102958352 206
130 3300031852 Ga0307410_10525675 Ga0307410_105256752 206
131 3300031995 Ga0307409_100257482 Ga0307409_1002574822 206
132 3300031995 Ga0307409_101194215 Ga0307409_1011942151 206
133 3300037471 Ga0395905_0405804 Ga0395905_0405804_313_963 206
134 3300039437 Ga0436365_0005613 Ga0436365_0005613_618_1262 206
135 3300044658 Ga0466972_0009367 Ga0466972_0009367_54_689 206
136 3300044658 Ga0466972_0064381 Ga0466972_0064381_194_838 206
137 3300044683 Ga0466965_0374484 Ga0466965_0374484_28_672 206
138 3300044684 Ga0466966_0008820 Ga0466966_0008820_4618_5253 206
139 3300044684 Ga0466966_0009895 Ga0466966_0009895_3196_3831 206
140 3300044684 Ga0466966_0027302 Ga0466966_0027302_610_1245 206
141 3300044684 Ga0466966_0121636 Ga0466966_0121636_588_1226 206
142 3300044684 Ga0466966_0466367 Ga0466966_0466367_110_745 206
143 3300044693 Ga0466961_0005682 Ga0466961_0005682_3976_4611 206
144 3300044693 Ga0466961_0012524 Ga0466961_0012524_3812_4447 206
145 3300044693 Ga0466961_0078603 Ga0466961_0078603_706_1341 206
146 3300044693 Ga0466961_0080179 Ga0466961_0080179_1033_1668 206
147 3300044693 Ga0466961_0378045 Ga0466961_0378045_128_769 206
148 3300044694 Ga0466963_0021922 Ga0466963_0021922_3224_3859 206
149 3300044694 Ga0466963_0239434 Ga0466963_0239434_600_1247 206
150 3300044706 Ga0466964_0043570 Ga0466964_0043570_509_1144 206
151 3300044719 Ga0466971_0139750 Ga0466971_0139750_180_815 206
152 3300044735 Ga0466968_0020207 Ga0466968_0020207_700_1335 206
153 3300044765 Ga0466970_0007594 Ga0466970_0007594_3681_4319 206
154 3300044765 Ga0466970_0191582 Ga0466970_0191582_471_1109 206
155 3300044765 Ga0466970_0324227 Ga0466970_0324227_49_684 206
156 3300044842 Ga0466957_0067043 Ga0466957_0067043_666_1298 206
157 3300044901 Ga0466960_0055071 Ga0466960_0055071_233_868 206
158 3300045049 Ga0466959_0009269 Ga0466959_0009269_2898_3533 206
159 3300045049 Ga0466959_0010923 Ga0466959_0010923_3764_4399 206
160 3300045049 Ga0466959_0052515 Ga0466959_0052515_1850_2485 206
161 3300045049 Ga0466959_0286977 Ga0466959_0286977_355_993 206
162 3300045049 Ga0466959_0288228 Ga0466959_0288228_394_1032 206
163 3300045049 Ga0466959_0324629 Ga0466959_0324629_308_943 206
164 3300045049 Ga0466959_0469566 Ga0466959_0469566_143_784 206
165 3300045836 Ga0466958_0025759 Ga0466958_0025759_2656_3291 206
166 3300045836 Ga0466958_0346969 Ga0466958_0346969_284_919 206
167 3300045976 Ga0466967_0006336 Ga0466967_0006336_7284_7919 206
168 3300045976 Ga0466967_0082642 Ga0466967_0082642_2042_2674 206
169 3300045976 Ga0466967_0219638 Ga0466967_0219638_412_1044 206
170 3300045976 Ga0466967_0276146 Ga0466967_0276146_228_863 206
171 3300046524 Ga0495648_0021804 Ga0495648_0021804_723_1361 206
172 3300046663 Ga0495635_0348638 Ga0495635_0348638_303_938 206
173 3300046663 Ga0495635_0492966 Ga0495635_0492966_75_722 206
174 3300046675 Ga0495657_0107759 Ga0495657_0107759_131_778 206
175 3300047322 Ga0495680_0106793 Ga0495680_0106793_1114_1761 206
176 3300048903 Ga0496100_0215927 Ga0496100_0215927_714_1352 206
177 3300048905 Ga0496102_0149808 Ga0496102_0149808_918_1565 206
178 3300048905 Ga0496102_0506586 Ga0496102_0506586_354_998 206
179 3300048905 Ga0496102_0626871 Ga0496102_0626871_339_977 206
180 3300048907 Ga0496104_0004891 Ga0496104_0004891_9094_9741 206
181 3300048907 Ga0496104_0280978 Ga0496104_0280978_365_1003 206
182 3300048908 Ga0496105_0016582 Ga0496105_0016582_1475_2122 206
183 3300048908 Ga0496105_0149894 Ga0496105_0149894_516_1154 206
184 3300048909 Ga0496106_0063822 Ga0496106_0063822_965_1612 206
185 3300048910 Ga0496107_0010995 Ga0496107_0010995_5171_5818 206
186 3300048910 Ga0496107_0216495 Ga0496107_0216495_502_1149 206
187 3300048911 Ga0496108_0034934 Ga0496108_0034934_19_666 206
188 3300048912 Ga0496109_0009876 Ga0496109_0009876_3921_4568 206
189 3300048912 Ga0496109_0051661 Ga0496109_0051661_2699_3346 206
190 3300048912 Ga0496109_0069632 Ga0496109_0069632_1338_1976 206
191 3300048912 Ga0496109_0153136 Ga0496109_0153136_550_1197 206
192 3300048913 Ga0496110_0177292 Ga0496110_0177292_728_1375 206
193 3300048914 Ga0496111_0088925 Ga0496111_0088925_216_863 206
194 3300048916 Ga0496113_0062276 Ga0496113_0062276_1746_2393 206
195 3300048916 Ga0496113_0077007 Ga0496113_0077007_1817_2464 206
196 3300048916 Ga0496113_0168130 Ga0496113_0168130_1071_1718 206
197 3300048917 Ga0496114_0020867 Ga0496114_0020867_327_971 206
198 3300048917 Ga0496114_0027407 Ga0496114_0027407_2635_3279 206
199 3300048917 Ga0496114_0052772 Ga0496114_0052772_656_1303 206
200 3300048917 Ga0496114_0376250 Ga0496114_0376250_251_889 206
201 3300048917 Ga0496114_0453728 Ga0496114_0453728_344_988 206
202 3300048918 Ga0496115_0001170 Ga0496115_0001170_3309_3956 206
203 3300048918 Ga0496115_0018278 Ga0496115_0018278_2188_2832 206
204 3300049571 Ga0501034_0085044 Ga0501034_0085044_601_1251 206
205 3300049574 Ga0501038_0268816 Ga0501038_0268816_42_680 206
206 3300049582 Ga0501048_0375680 Ga0501048_0375680_18_656 206
207 3300049585 Ga0501069_0265888 Ga0501069_0265888_299_949 206
208 3300049586 Ga0501070_0074887 Ga0501070_0074887_1153_1803 206
209 3300049586 Ga0501070_0339743 Ga0501070_0339743_94_732 206
210 3300049742 Ga0501080_0070239 Ga0501080_0070239_628_1278 206
211 3300049742 Ga0501080_0182781 Ga0501080_0182781_1272_1910 206
212 3300049744 Ga0501083_0370333 Ga0501083_0370333_267_917 206
213 3300049823 Ga0501044_0187060 Ga0501044_0187060_1016_1654 206
214 3300050491 nmdc:mga00v17_243217_c1 nmdc:mga00v17_243217_c1_33_683 206
215 3300050492 nmdc:mga0yw44_119577_c1 nmdc:mga0yw44_119577_c1_948_1586 206
216 3300050492 nmdc:mga0yw44_1903_c1 nmdc:mga0yw44_1903_c1_4118_4768 206
217 3300053077 Ga0495601_0317901 Ga0495601_0317901_135_782 206
218 3300053084 Ga0495595_0078290 Ga0495595_0078290_128_763 206
219 3300053084 Ga0495595_0112457 Ga0495595_0112457_271_918 206
220 3300053085 Ga0495619_0005036 Ga0495619_0005036_7300_7947 206
221 3300053085 Ga0495619_0415006 Ga0495619_0415006_192_827 206
222 iso_pu_bacteria 2675903058 2676473601 206
223 iso_pu_bacteria 2827628540 2827632114 206
224 3300005455 Ga0070663_100575854 Ga0070663_1005758541 207
225 3300005458 Ga0070681_10656618 Ga0070681_106566182 207
226 3300005530 Ga0070679_100987741 Ga0070679_1009877411 207
227 3300006051 Ga0075364_10477882 Ga0075364_104778822 207
228 3300025912 Ga0207707_10278319 Ga0207707_102783192 207
229 3300025944 Ga0207661_10035436 Ga0207661_100354362 207
230 3300026116 Ga0207674_10282679 Ga0207674_102826792 207
231 3300041512 Ga0451853_0786083 Ga0451853_0786083_201_851 207
232 3300044684 Ga0466966_0082754 Ga0466966_0082754_67_717 207
233 3300044693 Ga0466961_0030207 Ga0466961_0030207_21_662 207
234 3300044765 Ga0466970_0009506 Ga0466970_0009506_220_861 207
235 3300044901 Ga0466960_0337797 Ga0466960_0337797_159_806 207
236 3300045976 Ga0466967_0000727 Ga0466967_0000727_5653_6300 207
237 3300048917 Ga0496114_0023003 Ga0496114_0023003_646_1302 207
238 3300049575 Ga0501039_0138563 Ga0501039_0138563_894_1550 207
239 3300049591 Ga0501075_0247680 Ga0501075_0247680_194_850 207
240 3300049741 Ga0501079_0308937 Ga0501079_0308937_200_856 207
241 3300053140 Ga0500573_0173864 Ga0500573_0173864_350_1009 207
242 3300005329 Ga0070683_100376421 Ga0070683_1003764212 208
243 3300005548 Ga0070665_100212342 Ga0070665_1002123423 208
244 3300005983 Ga0081540_1050807 Ga0081540_10508074 208
245 3300006038 Ga0075365_10192855 Ga0075365_101928552 208
246 3300006042 Ga0075368_10018608 Ga0075368_100186081 208
247 3300006048 Ga0075363_100002765 Ga0075363_1000027654 208
248 3300006051 Ga0075364_10142496 Ga0075364_101424962 208
249 3300006178 Ga0075367_10009420 Ga0075367_100094206 208
250 3300009093 Ga0105240_10103159 Ga0105240_101031591 208
251 3300009553 Ga0105249_10759378 Ga0105249_107593782 208
252 3300014326 Ga0157380_11590112 Ga0157380_115901121 208
253 3300020082 Ga0206353_11743485 Ga0206353_117434852 208
254 3300026116 Ga0207674_10862854 Ga0207674_108628542 208
255 3300028379 Ga0268266_10885167 Ga0268266_108851672 208
256 3300031731 Ga0307405_10379074 Ga0307405_103790742 208
257 3300031824 Ga0307413_10408564 Ga0307413_104085642 208
258 3300031852 Ga0307410_10039162 Ga0307410_100391622 208
259 3300031852 Ga0307410_10308953 Ga0307410_103089532 208
260 3300031901 Ga0307406_10100755 Ga0307406_101007553 208
261 3300031911 Ga0307412_10206428 Ga0307412_102064282 208
262 3300031995 Ga0307409_100339704 Ga0307409_1003397042 208
263 3300032002 Ga0307416_100030850 Ga0307416_1000308503 208
264 3300032002 Ga0307416_100418949 Ga0307416_1004189492 208
265 3300032005 Ga0307411_10086488 Ga0307411_100864883 208
266 3300032126 Ga0307415_100030331 Ga0307415_1000303312 208
267 3300032126 Ga0307415_100031405 Ga0307415_1000314052 208
268 3300041512 Ga0451853_0740919 Ga0451853_0740919_356_1021 208
269 3300044683 Ga0466965_0005158 Ga0466965_0005158_1130_1783 208
270 3300044683 Ga0466965_0045897 Ga0466965_0045897_853_1533 208
271 3300044684 Ga0466966_0016377 Ga0466966_0016377_4092_4772 208
272 3300044694 Ga0466963_0105852 Ga0466963_0105852_929_1579 208
273 3300044706 Ga0466964_0005603 Ga0466964_0005603_3076_3729 208
274 3300045976 Ga0466967_0006597 Ga0466967_0006597_3055_3705 208
275 3300045976 Ga0466967_0115486 Ga0466967_0115486_1484_2134 208
276 3300045976 Ga0466967_0671600 Ga0466967_0671600_77_733 208
277 3300048912 Ga0496109_0052834 Ga0496109_0052834_535_1179 208
278 3300049568 Ga0501031_0392452 Ga0501031_0392452_233_883 208
279 3300049572 Ga0501036_0480201 Ga0501036_0480201_154_852 208
280 3300049574 Ga0501038_0562591 Ga0501038_0562591_157_822 208
281 3300050491 nmdc:mga00v17_393393_c1 nmdc:mga00v17_393393_c1_28_696 208
282 3300050492 nmdc:mga0yw44_228022_c1 nmdc:mga0yw44_228022_c1_555_1214 208
283 3300050492 nmdc:mga0yw44_50103_c1 nmdc:mga0yw44_50103_c1_18_686 208
284 3300050495 nmdc:mga04h51_11830_c1 nmdc:mga04h51_11830_c1_99_767 208
285 3300050496 nmdc:mga07m45_73681_c1 nmdc:mga07m45_73681_c1_274_942 208
286 3300061719 Ga0466962_0139255 Ga0466962_0139255_150_830 208
287 iso_pu_bacteria 2739367898 2740167227 208
288 iso_pu_bacteria 2857481737 2857485783 208
289 iso_pu_bacteria 8054609563 8054613898 208
290 3300005367 Ga0070667_100065010 Ga0070667_1000650104 209
291 3300005458 Ga0070681_10260928 Ga0070681_102609282 209
292 3300005530 Ga0070679_100112171 Ga0070679_1001121712 209
293 3300005577 Ga0068857_100537716 Ga0068857_1005377161 209
294 3300005843 Ga0068860_100000304 Ga0068860_10000030410 209
295 3300005985 Ga0081539_10036418 Ga0081539_100364183 209
296 3300006038 Ga0075365_10027382 Ga0075365_100273822 209
297 3300006042 Ga0075368_10019857 Ga0075368_100198572 209
298 3300006048 Ga0075363_100099949 Ga0075363_1000999492 209
299 3300006051 Ga0075364_10039261 Ga0075364_100392612 209
300 3300006051 Ga0075364_10065390 Ga0075364_100653901 209
301 3300006175 Ga0070712_100568552 Ga0070712_1005685521 209
302 3300006178 Ga0075367_10030512 Ga0075367_100305123 209
303 3300006353 Ga0075370_10006935 Ga0075370_100069354 209
304 3300009148 Ga0105243_10097702 Ga0105243_100977022 209
305 3300009553 Ga0105249_11689487 Ga0105249_116894871 209
306 3300013297 Ga0157378_10339060 Ga0157378_103390602 209
307 3300020081 Ga0206354_10301906 Ga0206354_103019061 209
308 3300020082 Ga0206353_10122393 Ga0206353_101223933 209
309 3300025898 Ga0207692_10085843 Ga0207692_100858432 209
310 3300025904 Ga0207647_10100243 Ga0207647_101002431 209
311 3300025912 Ga0207707_10261355 Ga0207707_102613552 209
312 3300025942 Ga0207689_10117355 Ga0207689_101173553 209
313 3300025986 Ga0207658_10028588 Ga0207658_100285884 209
314 3300026088 Ga0207641_10557923 Ga0207641_105579231 209
315 3300026116 Ga0207674_10260536 Ga0207674_102605362 209
316 3300028381 Ga0268264_10038630 Ga0268264_100386301 209
317 3300037466 Ga0395898_0172914 Ga0395898_0172914_711_1379 209
318 3300044658 Ga0466972_0093198 Ga0466972_0093198_186_863 209
319 3300044684 Ga0466966_0019540 Ga0466966_0019540_1660_2337 209
320 3300044693 Ga0466961_0268145 Ga0466961_0268145_197_874 209
321 3300044694 Ga0466963_0010373 Ga0466963_0010373_1251_1928 209
322 3300044706 Ga0466964_0219482 Ga0466964_0219482_216_893 209
323 3300044719 Ga0466971_0019657 Ga0466971_0019657_1291_1968 209
324 3300044735 Ga0466968_0082192 Ga0466968_0082192_664_1341 209
325 3300044842 Ga0466957_0016712 Ga0466957_0016712_3074_3751 209
326 3300044842 Ga0466957_0066993 Ga0466957_0066993_1527_2204 209
327 3300044901 Ga0466960_0000389 Ga0466960_0000389_7711_8373 209
328 3300045049 Ga0466959_0167677 Ga0466959_0167677_515_1192 209
329 3300045836 Ga0466958_0097642 Ga0466958_0097642_934_1611 209
330 3300048905 Ga0496102_0062971 Ga0496102_0062971_1778_2437 209
331 3300048905 Ga0496102_0399641 Ga0496102_0399641_265_921 209
332 3300048910 Ga0496107_0518866 Ga0496107_0518866_43_699 209
333 3300048922 Ga0496119_0000104 Ga0496119_0000104_98231_98890 209
334 3300048923 Ga0496120_0005467 Ga0496120_0005467_3640_4299 209
335 3300049575 Ga0501039_0170345 Ga0501039_0170345_773_1435 209
336 3300049578 Ga0501042_0095761 Ga0501042_0095761_198_860 209
337 3300049582 Ga0501048_0063280 Ga0501048_0063280_958_1620 209
338 3300049587 Ga0501071_0060675 Ga0501071_0060675_930_1592 209
339 3300049590 Ga0501074_0073098 Ga0501074_0073098_1201_1872 209
340 3300049741 Ga0501079_0398283 Ga0501079_0398283_263_925 209
341 3300050491 nmdc:mga00v17_60527_c1 nmdc:mga00v17_60527_c1_1315_1977 209
342 3300050492 nmdc:mga0yw44_167598_c1 nmdc:mga0yw44_167598_c1_544_1233 209
343 3300050492 nmdc:mga0yw44_29800_c1 nmdc:mga0yw44_29800_c1_322_990 209
344 3300050494 nmdc:mga06z11_13579_c1 nmdc:mga06z11_13579_c1_203_871 209
345 3300053140 Ga0500573_0101552 Ga0500573_0101552_916_1584 209
346 3300059424 Ga0590075_109851 Ga0590075_109851_68_709 209
347 3300061734 Ga0530510_0145546 Ga0530510_0145546_379_1041 209
348 3300005327 Ga0070658_10474628 Ga0070658_104746281 210
349 3300005329 Ga0070683_100009817 Ga0070683_1000098176 210
350 3300005334 Ga0068869_100176885 Ga0068869_1001768852 210
351 3300005337 Ga0070682_100002682 Ga0070682_1000026822 210
352 3300005339 Ga0070660_100161448 Ga0070660_1001614482 210
353 3300005345 Ga0070692_10025132 Ga0070692_100251323 210
354 3300005366 Ga0070659_100093200 Ga0070659_1000932002 210
355 3300005367 Ga0070667_100405868 Ga0070667_1004058681 210
356 3300005456 Ga0070678_100341965 Ga0070678_1003419651 210
357 3300005530 Ga0070679_100436345 Ga0070679_1004363452 210
358 3300005548 Ga0070665_100000450 Ga0070665_10000045046 210
359 3300005563 Ga0068855_100233922 Ga0068855_1002339222 210
360 3300005564 Ga0070664_100158709 Ga0070664_1001587092 210
361 3300005577 Ga0068857_100009886 Ga0068857_1000098863 210
362 3300005614 Ga0068856_100028796 Ga0068856_1000287967 210
363 3300005842 Ga0068858_100120615 Ga0068858_1001206152 210
364 3300005843 Ga0068860_100100284 Ga0068860_1001002842 210
365 3300006038 Ga0075365_10043487 Ga0075365_100434872 210
366 3300006038 Ga0075365_10215429 Ga0075365_102154292 210
367 3300006042 Ga0075368_10003543 Ga0075368_100035433 210
368 3300006048 Ga0075363_100007893 Ga0075363_1000078933 210
369 3300006177 Ga0075362_10058501 Ga0075362_100585012 210
370 3300006353 Ga0075370_10015383 Ga0075370_100153832 210
371 3300006358 Ga0068871_100072529 Ga0068871_1000725292 210
372 3300006881 Ga0068865_100464631 Ga0068865_1004646312 210
373 3300009098 Ga0105245_10000359 Ga0105245_1000035930 210
374 3300009098 Ga0105245_10623655 Ga0105245_106236552 210
375 3300009545 Ga0105237_10074076 Ga0105237_100740762 210
376 3300009984 Ga0105029_103857 Ga0105029_1038571 210
377 3300010375 Ga0105239_10012785 Ga0105239_100127853 210
378 3300011119 Ga0105246_10003745 Ga0105246_100037452 210
379 3300013102 Ga0157371_10121099 Ga0157371_101210992 210
380 3300013105 Ga0157369_10339687 Ga0157369_103396872 210
381 3300013306 Ga0163162_10002746 Ga0163162_100027463 210
382 3300013307 Ga0157372_10035893 Ga0157372_100358936 210
383 3300014968 Ga0157379_10039351 Ga0157379_100393513 210
384 3300025901 Ga0207688_10197705 Ga0207688_101977052 210
385 3300025904 Ga0207647_10041476 Ga0207647_100414762 210
386 3300025909 Ga0207705_10048003 Ga0207705_100480031 210
387 3300025918 Ga0207662_10332443 Ga0207662_103324431 210
388 3300025919 Ga0207657_10010726 Ga0207657_100107267 210
389 3300025921 Ga0207652_10313789 Ga0207652_103137892 210
390 3300025926 Ga0207659_10293625 Ga0207659_102936251 210
391 3300025927 Ga0207687_10398679 Ga0207687_103986792 210
392 3300025927 Ga0207687_10754813 Ga0207687_107548131 210
393 3300025929 Ga0207664_10298077 Ga0207664_102980772 210
394 3300025932 Ga0207690_10010372 Ga0207690_100103722 210
395 3300025933 Ga0207706_10272717 Ga0207706_102727171 210
396 3300025934 Ga0207686_10033772 Ga0207686_100337722 210
397 3300025937 Ga0207669_10448619 Ga0207669_104486192 210
398 3300025938 Ga0207704_10348033 Ga0207704_103480331 210
399 3300025942 Ga0207689_10332680 Ga0207689_103326802 210
400 3300025944 Ga0207661_10031047 Ga0207661_100310473 210
401 3300025944 Ga0207661_10892336 Ga0207661_108923362 210
402 3300025945 Ga0207679_10171342 Ga0207679_101713422 210
403 3300025949 Ga0207667_10945749 Ga0207667_109457491 210
404 3300025986 Ga0207658_10365979 Ga0207658_103659791 210
405 3300026041 Ga0207639_10392818 Ga0207639_103928181 210
406 3300026089 Ga0207648_10462872 Ga0207648_104628721 210
407 3300026116 Ga0207674_10038543 Ga0207674_100385433 210
408 3300026121 Ga0207683_10172921 Ga0207683_101729212 210
409 3300028379 Ga0268266_10004579 Ga0268266_100045799 210
410 3300031731 Ga0307405_10096666 Ga0307405_100966662 210
411 3300045049 Ga0466959_0033462 Ga0466959_0033462_2486_3145 210
412 3300045836 Ga0466958_0107958 Ga0466958_0107958_51_710 210
413 3300046455 Ga0495603_0118031 Ga0495603_0118031_20_688 210
414 3300048905 Ga0496102_0008533 Ga0496102_0008533_6350_7000 210
415 3300048905 Ga0496102_0589081 Ga0496102_0589081_16_672 210
416 3300048906 Ga0496103_0070358 Ga0496103_0070358_324_974 210
417 3300048912 Ga0496109_0047925 Ga0496109_0047925_149_799 210
418 3300048914 Ga0496111_0005153 Ga0496111_0005153_529_1179 210
419 3300048915 Ga0496112_0468731 Ga0496112_0468731_38_727 210
420 3300048916 Ga0496113_0248578 Ga0496113_0248578_694_1344 210
421 3300048917 Ga0496114_0148944 Ga0496114_0148944_968_1636 210
422 3300048917 Ga0496114_0291482 Ga0496114_0291482_388_1038 210
423 3300049586 Ga0501070_0525340 Ga0501070_0525340_209_922 210
424 3300050492 nmdc:mga0yw44_230278_c2 nmdc:mga0yw44_230278_c2_22_690 210
425 3300050492 nmdc:mga0yw44_417933_c1 nmdc:mga0yw44_417933_c1_38_715 210
426 3300050494 nmdc:mga06z11_70175_c1 nmdc:mga06z11_70175_c1_327_1004 210
427 3300050495 nmdc:mga04h51_39291_c1 nmdc:mga04h51_39291_c1_557_1234 210
428 3300050496 nmdc:mga07m45_85565_c1 nmdc:mga07m45_85565_c1_194_871 210
429 3300059426 Ga0590077_026068 Ga0590077_026068_460_1104 210
430 iso_pu_bacteria 2984576629 2984579769 210
431 iso_pu_bacteria 2990256926 2990257375 210
432 3300006051 Ga0075364_10039542 Ga0075364_100395422 211
433 3300006177 Ga0075362_10059421 Ga0075362_100594213 211
434 3300009094 Ga0111539_10637774 Ga0111539_106377742 211
435 3300009098 Ga0105245_10953672 Ga0105245_109536722 211
436 3300025927 Ga0207687_10002966 Ga0207687_100029669 211
437 3300026078 Ga0207702_10639022 Ga0207702_106390222 211
438 3300026142 Ga0207698_10058156 Ga0207698_100581562 211
439 3300049572 Ga0501036_0132273 Ga0501036_0132273_109_777 211
440 3300049575 Ga0501039_0121897 Ga0501039_0121897_244_912 211
441 3300049583 Ga0501067_0012114 Ga0501067_0012114_79_747 211
442 3300049583 Ga0501067_0117417 Ga0501067_0117417_497_1165 211
443 3300049585 Ga0501069_0005208 Ga0501069_0005208_2665_3333 211
444 3300049586 Ga0501070_0046658 Ga0501070_0046658_107_775 211
445 3300049586 Ga0501070_0075161 Ga0501070_0075161_107_775 211
446 3300049587 Ga0501071_0005496 Ga0501071_0005496_6379_7047 211
447 3300049587 Ga0501071_0265008 Ga0501071_0265008_580_1248 211
448 3300049587 Ga0501071_0310804 Ga0501071_0310804_544_1179 211
449 3300049588 Ga0501072_0011083 Ga0501072_0011083_2836_3504 211
450 3300049589 Ga0501073_0113022 Ga0501073_0113022_1109_1777 211
451 3300049589 Ga0501073_0210246 Ga0501073_0210246_107_775 211
452 3300049590 Ga0501074_0125153 Ga0501074_0125153_443_1111 211
453 3300049741 Ga0501079_0076481 Ga0501079_0076481_247_915 211
454 3300049742 Ga0501080_0335595 Ga0501080_0335595_384_1052 211
455 3300049744 Ga0501083_0252621 Ga0501083_0252621_401_1069 211
456 3300050489 nmdc:mga03683_179737_c1 nmdc:mga03683_179737_c1_251_886 211
457 3300050491 nmdc:mga00v17_65549_c1 nmdc:mga00v17_65549_c1_213_848 211
458 3300050511 nmdc:mga08y16_496685_c1 nmdc:mga08y16_496685_c1_149_817 211
459 3300054114 Ga0501084_0075926 Ga0501084_0075926_1431_2099 211
460 3300054114 Ga0501084_0253839 Ga0501084_0253839_742_1410 211
461 3300060353 Ga0501082_0009085 Ga0501082_0009085_6586_7254 211
462 3300005329 Ga0070683_100023908 Ga0070683_1000239082 212
463 3300005331 Ga0070670_100111300 Ga0070670_1001113003 212
464 3300005336 Ga0070680_100073191 Ga0070680_1000731914 212
465 3300005337 Ga0070682_100013692 Ga0070682_1000136926 212
466 3300005338 Ga0068868_100065622 Ga0068868_1000656224 212
467 3300005339 Ga0070660_100048141 Ga0070660_1000481415 212
468 3300005341 Ga0070691_10026426 Ga0070691_100264262 212
469 3300005344 Ga0070661_100092126 Ga0070661_1000921263 212
470 3300005345 Ga0070692_10097940 Ga0070692_100979402 212
471 3300005354 Ga0070675_100147591 Ga0070675_1001475913 212
472 3300005355 Ga0070671_100045236 Ga0070671_1000452364 212
473 3300005366 Ga0070659_100166232 Ga0070659_1001662322 212
474 3300005435 Ga0070714_100001446 Ga0070714_10000144610 212
475 3300005441 Ga0070700_100137214 Ga0070700_1001372141 212
476 3300005455 Ga0070663_100049350 Ga0070663_1000493504 212
477 3300005456 Ga0070678_100155551 Ga0070678_1001555512 212
478 3300005458 Ga0070681_10114956 Ga0070681_101149562 212
479 3300005466 Ga0070685_10064620 Ga0070685_100646202 212
480 3300005530 Ga0070679_100160437 Ga0070679_1001604373 212
481 3300005547 Ga0070693_100018875 Ga0070693_1000188753 212
482 3300005563 Ga0068855_100206224 Ga0068855_1002062242 212
483 3300005578 Ga0068854_100206351 Ga0068854_1002063512 212
484 3300005615 Ga0070702_100011043 Ga0070702_1000110434 212
485 3300005617 Ga0068859_100054057 Ga0068859_1000540574 212
486 3300005840 Ga0068870_10011892 Ga0068870_100118922 212
487 3300005841 Ga0068863_100076596 Ga0068863_1000765963 212
488 3300005842 Ga0068858_100077027 Ga0068858_1000770272 212
489 3300006038 Ga0075365_10063640 Ga0075365_100636402 212
490 3300006038 Ga0075365_10262099 Ga0075365_102620992 212
491 3300006042 Ga0075368_10280626 Ga0075368_102806261 212
492 3300006051 Ga0075364_10009391 Ga0075364_100093912 212
493 3300006051 Ga0075364_10066532 Ga0075364_100665321 212
494 3300006358 Ga0068871_100084567 Ga0068871_1000845672 212
495 3300006847 Ga0075431_100111265 Ga0075431_1001112653 212
496 3300006871 Ga0075434_100067274 Ga0075434_1000672742 212
497 3300006914 Ga0075436_100066751 Ga0075436_1000667512 212
498 3300006931 Ga0097620_100054056 Ga0097620_1000540562 212
499 3300007076 Ga0075435_100037138 Ga0075435_1000371384 212
500 3300009011 Ga0105251_10110283 Ga0105251_101102832 212
501 3300009093 Ga0105240_10698213 Ga0105240_106982132 212
502 3300009094 Ga0111539_10057392 Ga0111539_100573922 212
503 3300009101 Ga0105247_10046783 Ga0105247_100467834 212
504 3300009147 Ga0114129_10076786 Ga0114129_100767863 212
505 3300009174 Ga0105241_10034837 Ga0105241_100348374 212
506 3300009177 Ga0105248_10061101 Ga0105248_100611012 212
507 3300009551 Ga0105238_10217634 Ga0105238_102176342 212
508 3300010375 Ga0105239_10174678 Ga0105239_101746784 212
509 3300013100 Ga0157373_10085704 Ga0157373_100857042 212
510 3300013102 Ga0157371_10079734 Ga0157371_100797343 212
511 3300013104 Ga0157370_10063407 Ga0157370_100634072 212
512 3300013104 Ga0157370_10282298 Ga0157370_102822982 212
513 3300013296 Ga0157374_10065627 Ga0157374_100656275 212
514 3300013307 Ga0157372_10205672 Ga0157372_102056723 212
515 3300014326 Ga0157380_10882182 Ga0157380_108821822 212
516 3300014745 Ga0157377_10087620 Ga0157377_100876203 212
517 3300020082 Ga0206353_11030654 Ga0206353_110306542 212
518 3300021388 Ga0213875_10049861 Ga0213875_100498612 212
519 3300025321 Ga0207656_10055751 Ga0207656_100557512 212
520 3300025900 Ga0207710_10081738 Ga0207710_100817382 212
521 3300025901 Ga0207688_10015922 Ga0207688_100159222 212
522 3300025907 Ga0207645_10018549 Ga0207645_100185492 212
523 3300025908 Ga0207643_10000100 Ga0207643_1000010013 212
524 3300025909 Ga0207705_10048274 Ga0207705_100482744 212
525 3300025911 Ga0207654_10184265 Ga0207654_101842652 212
526 3300025912 Ga0207707_10120932 Ga0207707_101209323 212
527 3300025913 Ga0207695_10206410 Ga0207695_102064103 212
528 3300025918 Ga0207662_10039986 Ga0207662_100399861 212
529 3300025919 Ga0207657_10060396 Ga0207657_100603962 212
530 3300025920 Ga0207649_10058045 Ga0207649_100580452 212
531 3300025924 Ga0207694_10089127 Ga0207694_100891273 212
532 3300025925 Ga0207650_10282776 Ga0207650_102827763 212
533 3300025926 Ga0207659_10100631 Ga0207659_101006313 212
534 3300025927 Ga0207687_10058267 Ga0207687_100582671 212
535 3300025935 Ga0207709_10670833 Ga0207709_106708331 212
536 3300025940 Ga0207691_10009704 Ga0207691_1000970410 212
537 3300025942 Ga0207689_10045864 Ga0207689_100458642 212
538 3300025944 Ga0207661_10012431 Ga0207661_100124316 212
539 3300025944 Ga0207661_10041082 Ga0207661_100410823 212
540 3300025944 Ga0207661_10064962 Ga0207661_100649622 212
541 3300025945 Ga0207679_10081212 Ga0207679_100812124 212
542 3300025945 Ga0207679_10777112 Ga0207679_107771122 212
543 3300025949 Ga0207667_10155460 Ga0207667_101554603 212
544 3300025960 Ga0207651_10051552 Ga0207651_100515522 212
545 3300026023 Ga0207677_10714709 Ga0207677_107147092 212
546 3300026035 Ga0207703_10106370 Ga0207703_101063703 212
547 3300026067 Ga0207678_10002842 Ga0207678_100028424 212
548 3300026075 Ga0207708_10052761 Ga0207708_100527612 212
549 3300026078 Ga0207702_10103325 Ga0207702_101033252 212
550 3300026088 Ga0207641_10222852 Ga0207641_102228522 212
551 3300026095 Ga0207676_10067002 Ga0207676_100670024 212
552 3300026121 Ga0207683_10000565 Ga0207683_100005652 212
553 3300026142 Ga0207698_10222333 Ga0207698_102223332 212
554 3300027907 Ga0207428_10053593 Ga0207428_100535934 212
555 3300028379 Ga0268266_10058281 Ga0268266_100582813 212
556 3300028381 Ga0268264_10300168 Ga0268264_103001682 212
557 3300037853 Ga0436364_1506248 Ga0436364_1506248_249_887 212
558 3300042005 Ga0439448_0011570 Ga0439448_0011570_1599_2264 212
559 3300042118 Ga0450914_007739 Ga0450914_007739_302_967 212
560 3300042157 Ga0439458_0009932 Ga0439458_0009932_879_1544 212
561 3300044683 Ga0466965_0016158 Ga0466965_0016158_1456_2094 212
562 3300044765 Ga0466970_0054941 Ga0466970_0054941_111_785 212
563 3300044901 Ga0466960_0027309 Ga0466960_0027309_1190_1864 212
564 3300044901 Ga0466960_0028802 Ga0466960_0028802_772_1410 212
565 3300045836 Ga0466958_0101486 Ga0466958_0101486_324_962 212
566 3300045976 Ga0466967_0048979 Ga0466967_0048979_2720_3391 212
567 3300045976 Ga0466967_0152013 Ga0466967_0152013_46_723 212
568 3300045976 Ga0466967_0182440 Ga0466967_0182440_385_1062 212
569 3300045976 Ga0466967_1169824 Ga0466967_1169824_64_732 212
570 3300046475 Ga0495639_0181426 Ga0495639_0181426_73_753 212
571 3300046477 Ga0495664_0018905 Ga0495664_0018905_2080_2730 212
572 3300046522 Ga0495643_0093253 Ga0495643_0093253_125_808 212
573 3300046543 Ga0495645_0278894 Ga0495645_0278894_226_876 212
574 3300048903 Ga0496100_0335432 Ga0496100_0335432_433_1098 212
575 3300048906 Ga0496103_0417721 Ga0496103_0417721_132_797 212
576 3300048907 Ga0496104_0061498 Ga0496104_0061498_1562_2227 212
577 3300048908 Ga0496105_0031900 Ga0496105_0031900_1903_2568 212
578 3300048909 Ga0496106_0073228 Ga0496106_0073228_1441_2106 212
579 3300048910 Ga0496107_0056858 Ga0496107_0056858_510_1175 212
580 3300048912 Ga0496109_0349155 Ga0496109_0349155_601_1266 212
581 3300048913 Ga0496110_0118546 Ga0496110_0118546_1702_2367 212
582 3300048914 Ga0496111_0031104 Ga0496111_0031104_1507_2172 212
583 3300048916 Ga0496113_0091951 Ga0496113_0091951_259_924 212
584 3300048918 Ga0496115_0264211 Ga0496115_0264211_450_1115 212
585 3300049585 Ga0501069_0106759 Ga0501069_0106759_503_1177 212
586 3300050491 nmdc:mga00v17_2605_c1 nmdc:mga00v17_2605_c1_6569_7261 212
587 3300050494 nmdc:mga06z11_523129_c1 nmdc:mga06z11_523129_c1_34_672 212
588 3300050507 nmdc:mga05p37_220164_c1 nmdc:mga05p37_220164_c1_751_1416 212
589 3300050514 nmdc:mga08x19_117537_c1 nmdc:mga08x19_117537_c1_836_1501 212
590 3300050515 nmdc:mga0a205_83665_c1 nmdc:mga0a205_83665_c1_970_1635 212
591 iso_pu_bacteria 2515154155 2515856568 212
592 iso_pu_bacteria 2837268691 2837269130 212
593 iso_pu_bacteria 2868088558 2868092705 212
594 3300005329 Ga0070683_100136532 Ga0070683_1001365322 213
595 3300005337 Ga0070682_100069770 Ga0070682_1000697702 213
596 3300005339 Ga0070660_100036084 Ga0070660_1000360842 213
597 3300005366 Ga0070659_100089414 Ga0070659_1000894142 213
598 3300005366 Ga0070659_100438344 Ga0070659_1004383441 213
599 3300005455 Ga0070663_100019332 Ga0070663_1000193325 213
600 3300005535 Ga0070684_100178752 Ga0070684_1001787522 213
601 3300005564 Ga0070664_100529217 Ga0070664_1005292172 213
602 3300005614 Ga0068856_101246478 Ga0068856_1012464782 213
603 3300006048 Ga0075363_100011133 Ga0075363_1000111331 213
604 3300006051 Ga0075364_10034188 Ga0075364_100341884 213
605 3300006237 Ga0097621_101045862 Ga0097621_1010458621 213
606 3300006353 Ga0075370_10015524 Ga0075370_100155244 213
607 3300009545 Ga0105237_10645230 Ga0105237_106452302 213
608 3300009553 Ga0105249_10482721 Ga0105249_104827212 213
609 3300010375 Ga0105239_10012602 Ga0105239_100126027 213
610 3300013307 Ga0157372_10166981 Ga0157372_101669812 213
611 3300013308 Ga0157375_10500986 Ga0157375_105009861 213
612 3300017792 Ga0163161_10531334 Ga0163161_105313341 213
613 3300020070 Ga0206356_10664571 Ga0206356_106645712 213
614 3300020081 Ga0206354_10855475 Ga0206354_108554752 213
615 3300025914 Ga0207671_10122276 Ga0207671_101222761 213
616 3300025919 Ga0207657_10074462 Ga0207657_100744622 213
617 3300025932 Ga0207690_10014869 Ga0207690_100148694 213
618 3300025932 Ga0207690_10047931 Ga0207690_100479312 213
619 3300025932 Ga0207690_10071359 Ga0207690_100713593 213
620 3300025944 Ga0207661_10044358 Ga0207661_100443583 213
621 3300026067 Ga0207678_10068635 Ga0207678_100686353 213
622 3300026078 Ga0207702_11341243 Ga0207702_113412431 213
623 3300031548 Ga0307408_100393487 Ga0307408_1003934872 213
624 3300031824 Ga0307413_10040012 Ga0307413_100400122 213
625 3300031852 Ga0307410_10481075 Ga0307410_104810752 213
626 3300031901 Ga0307406_10094187 Ga0307406_100941872 213
627 3300031903 Ga0307407_10098732 Ga0307407_100987321 213
628 3300031903 Ga0307407_10466002 Ga0307407_104660022 213
629 3300031911 Ga0307412_10343032 Ga0307412_103430322 213
630 3300031995 Ga0307409_100128509 Ga0307409_1001285092 213
631 3300032002 Ga0307416_100170926 Ga0307416_1001709262 213
632 3300032002 Ga0307416_101377175 Ga0307416_1013771751 213
633 3300032004 Ga0307414_10571288 Ga0307414_105712882 213
634 3300032126 Ga0307415_100213819 Ga0307415_1002138192 213
635 3300035725 Ga0373947_0695791 Ga0373947_0695791_14_664 213
636 3300038443 Ga0395901_0320662 Ga0395901_0320662_898_1569 213
637 3300038443 Ga0395901_0808815 Ga0395901_0808815_198_842 213
638 3300044693 Ga0466961_0424427 Ga0466961_0424427_141_794 213
639 3300044765 Ga0466970_0048016 Ga0466970_0048016_979_1632 213
640 3300044842 Ga0466957_0025147 Ga0466957_0025147_661_1311 213
641 3300044842 Ga0466957_0063950 Ga0466957_0063950_407_1060 213
642 3300046473 Ga0495582_0515591 Ga0495582_0515591_11_661 213
643 3300048903 Ga0496100_0082924 Ga0496100_0082924_335_985 213
644 3300048907 Ga0496104_0064806 Ga0496104_0064806_2285_2935 213
645 3300048907 Ga0496104_0391999 Ga0496104_0391999_231_881 213
646 3300048909 Ga0496106_0140054 Ga0496106_0140054_290_940 213
647 3300048910 Ga0496107_0610816 Ga0496107_0610816_86_736 213
648 3300048911 Ga0496108_0049105 Ga0496108_0049105_1679_2329 213
649 3300048911 Ga0496108_0052559 Ga0496108_0052559_2682_3332 213
650 3300048912 Ga0496109_0798912 Ga0496109_0798912_164_814 213
651 3300048913 Ga0496110_0018218 Ga0496110_0018218_1255_1896 213
652 3300048913 Ga0496110_0404397 Ga0496110_0404397_547_1197 213
653 3300048914 Ga0496111_0027398 Ga0496111_0027398_46_696 213
654 3300048917 Ga0496114_0290411 Ga0496114_0290411_605_1255 213
655 3300048918 Ga0496115_0275362 Ga0496115_0275362_587_1237 213
656 3300049576 Ga0501040_0079656 Ga0501040_0079656_1471_2121 213
657 3300049584 Ga0501068_0141420 Ga0501068_0141420_751_1401 213
658 3300049585 Ga0501069_0043323 Ga0501069_0043323_397_1047 213
659 3300050490 nmdc:mga03n38_1274_c1 nmdc:mga03n38_1274_c1_2675_3394 213
660 3300050491 nmdc:mga00v17_19640_c1 nmdc:mga00v17_19640_c1_2673_3392 213
661 3300050494 nmdc:mga06z11_371447_c1 nmdc:mga06z11_371447_c1_29_748 213
662 3300050496 nmdc:mga07m45_9631_c1 nmdc:mga07m45_9631_c1_2661_3380 213
663 3300053155 Ga0500620_041692 Ga0500620_041692_199_849 213
664 3300060353 Ga0501082_0863155 Ga0501082_0863155_34_684 213
665 3300002075 JGI24738J21930_10010742 JGI24738J21930_100107422 214
666 3300002077 JGI24744J21845_10008086 JGI24744J21845_100080862 214
667 3300005329 Ga0070683_100036540 Ga0070683_1000365402 214
668 3300005329 Ga0070683_100201360 Ga0070683_1002013602 214
669 3300005338 Ga0068868_100184226 Ga0068868_1001842262 214
670 3300005345 Ga0070692_10005693 Ga0070692_100056934 214
671 3300005364 Ga0070673_100029253 Ga0070673_1000292533 214
672 3300005366 Ga0070659_100200249 Ga0070659_1002002492 214
673 3300005438 Ga0070701_10122806 Ga0070701_101228062 214
674 3300005441 Ga0070700_100034575 Ga0070700_1000345753 214
675 3300005457 Ga0070662_100164417 Ga0070662_1001644172 214
676 3300005459 Ga0068867_100074370 Ga0068867_1000743702 214
677 3300005535 Ga0070684_100028263 Ga0070684_1000282634 214
678 3300005539 Ga0068853_100022084 Ga0068853_1000220842 214
679 3300005543 Ga0070672_100019305 Ga0070672_1000193052 214
680 3300005544 Ga0070686_100055918 Ga0070686_1000559182 214
681 3300005549 Ga0070704_100584115 Ga0070704_1005841152 214
682 3300005564 Ga0070664_100176753 Ga0070664_1001767532 214
683 3300005578 Ga0068854_100084599 Ga0068854_1000845992 214
684 3300005616 Ga0068852_100050155 Ga0068852_1000501554 214
685 3300005618 Ga0068864_100111739 Ga0068864_1001117393 214
686 3300005840 Ga0068870_10003307 Ga0068870_100033073 214
687 3300006881 Ga0068865_100003722 Ga0068865_1000037224 214
688 3300009094 Ga0111539_10167102 Ga0111539_101671022 214
689 3300009098 Ga0105245_10119505 Ga0105245_101195053 214
690 3300009148 Ga0105243_10020111 Ga0105243_100201113 214
691 3300009177 Ga0105248_10212297 Ga0105248_102122972 214
692 3300009553 Ga0105249_10362547 Ga0105249_103625472 214
693 3300013104 Ga0157370_10332198 Ga0157370_103321982 214
694 3300013307 Ga0157372_10101197 Ga0157372_101011973 214
695 3300014326 Ga0157380_10051037 Ga0157380_100510374 214
696 3300014745 Ga0157377_10515834 Ga0157377_105158342 214
697 3300017792 Ga0163161_10171846 Ga0163161_101718462 214
698 3300025315 Ga0207697_10027155 Ga0207697_100271552 214
699 3300025901 Ga0207688_10015206 Ga0207688_100152063 214
700 3300025908 Ga0207643_10003328 Ga0207643_100033284 214
701 3300025918 Ga0207662_10005149 Ga0207662_100051494 214
702 3300025927 Ga0207687_10063166 Ga0207687_100631662 214
703 3300025937 Ga0207669_10040905 Ga0207669_100409053 214
704 3300025938 Ga0207704_10066534 Ga0207704_100665342 214
705 3300025940 Ga0207691_10016940 Ga0207691_100169402 214
706 3300025941 Ga0207711_10057824 Ga0207711_100578242 214
707 3300025944 Ga0207661_10140032 Ga0207661_101400322 214
708 3300025944 Ga0207661_10738946 Ga0207661_107389461 214
709 3300025945 Ga0207679_10270967 Ga0207679_102709672 214
710 3300025960 Ga0207651_10023558 Ga0207651_100235583 214
711 3300025961 Ga0207712_10275685 Ga0207712_102756852 214
712 3300025981 Ga0207640_10077392 Ga0207640_100773923 214
713 3300025986 Ga0207658_10385369 Ga0207658_103853692 214
714 3300026023 Ga0207677_10764601 Ga0207677_107646011 214
715 3300026075 Ga0207708_10000786 Ga0207708_1000078615 214
716 3300026089 Ga0207648_10123460 Ga0207648_101234602 214
717 3300026118 Ga0207675_100917568 Ga0207675_1009175682 214
718 3300026142 Ga0207698_10054593 Ga0207698_100545933 214
719 3300046683 Ga0495658_0514730 Ga0495658_0514730_47_727 214
720 3300048909 Ga0496106_0303692 Ga0496106_0303692_125_769 214
721 3300048910 Ga0496107_0132739 Ga0496107_0132739_716_1360 214
722 3300048911 Ga0496108_0039949 Ga0496108_0039949_2923_3567 214
723 3300048912 Ga0496109_0113315 Ga0496109_0113315_632_1276 214
724 3300048914 Ga0496111_0211399 Ga0496111_0211399_205_849 214
725 3300048917 Ga0496114_0029410 Ga0496114_0029410_2414_3058 214
726 3300049568 Ga0501031_0062971 Ga0501031_0062971_466_1119 214
727 3300049575 Ga0501039_0212082 Ga0501039_0212082_564_1217 214
728 3300049575 Ga0501039_0252390 Ga0501039_0252390_73_726 214
729 3300049576 Ga0501040_0098835 Ga0501040_0098835_607_1260 214
730 3300049579 Ga0501043_0484381 Ga0501043_0484381_234_887 214
731 3300049582 Ga0501048_0349230 Ga0501048_0349230_291_944 214
732 3300049590 Ga0501074_0293894 Ga0501074_0293894_447_1100 214
733 3300049743 Ga0501081_0310541 Ga0501081_0310541_362_1015 214
734 3300050511 nmdc:mga08y16_29745_c1 nmdc:mga08y16_29745_c1_1568_2212 214
735 iso_pu_bacteria 2855386786 2855391155 214

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

165

221

0.97

PF00072

Response_reg

Response regulator receiver domain

19

131

0.96

PF08281

Sigma70_r4_2

Sigma-70, region 4

160

209

0.95

PF04545

Sigma70_r4

Sigma-70, region 4

164

211

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsz-assembly1.cif.gz_B crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9664 150 214
4wul-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna 0.9637 152 214
4wsz-assembly1.cif.gz_A crystal structure of the dna binding domains of wild type liar from e. faecalis 0.9615 150 214
4wu4-assembly1.cif.gz_A crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna 0.9588 150 213
7x1k-assembly1.cif.gz_B crystal structure of the flagellar expression regulator degu from listeria monocytogenes 0.9574 151 210
ID Description Score Start End Superfamily
af_O53213_1064_1134_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9681 152 211 1.10.10.10
3qp5D02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9585 154 205 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9551 154 210 1.10.10.10
1zn2A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9526 154 210 1.10.10.10
3eulC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9512 5 120 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7W0MTT7-F1-model_v4 Response regulator transcription factor 0.9396 1 122 GO:0000160
AF-A0A429HPZ9-F1-model_v4 deleted 0.9225 1 139
AF-A0A7X9CUN2-F1-model_v4 deleted 0.9211 4 148
AF-A0A7G8BEC4-F1-model_v4 Response regulator transcription factor 0.9197 2 131 GO:0000160
GO:0003677
AF-A0A1F2RW02-F1-model_v4 Response regulatory domain-containing protein 0.9179 2 130 GO:0000160
GO:0003677

Feature Viewer

pLDDT pTM Quality
86.85 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map