F478223
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 735 | 296 | 718 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300046522|Ga0495643_0093253|Ga0495643_0093253_125_808 |
| Length | 227 |
| Sequence | VSETKPDETRPADAGPVTVVLVDDHAMFRTGVRAELAQAPSVDVVGEAADTAEAVAVVLRTKPEVVLLDVHLPGGGGGEVIRQVHPKEPGVRFLALSVSDAAEDVIGTIRAGARGYVTKSITGDDLVSAIGRVADGDAVFSPRLAGFVLDAFAGTEAPSVDDDLDRLTQREREVLRLIARGYAYKEIAKELFISVKTVETHVSAVLRKLQLSNRYELTRWATDRRLV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 3 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 4 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 5 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 6 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 7 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 8 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 9 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 10 | 2837268691 | Jiangella endophytica KE2-3 | Isolate | Rhizosphere |
| 11 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 12 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 13 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 14 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 15 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 16 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 17 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 18 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 61 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 102 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 117 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 121 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 177 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 188 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 189 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 197 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 198 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 199 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 200 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 201 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 202 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 203 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 204 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 205 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 206 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 207 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 208 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 209 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 210 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 211 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 212 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 213 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 214 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 215 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 216 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 230 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 233 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 234 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 235 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 238 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 239 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 240 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 241 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 242 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 243 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 244 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 245 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 274 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 275 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 276 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 277 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 278 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 279 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 288 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 289 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 290 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 292 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 293 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 296 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.73 |
| Metatranscriptomes | 0.95 |
| Isolates | 2.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 8.71 |
| Nodule | 0.14 |
| Rhizoplane | 10.34 |
| Rhizosphere | 77.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24738J21930_10010742 | 3300002075 | Bacteria | 2030 |
| 2 | JGI24744J21845_10008086 | 3300002077 | Bacteria | 2172 |
| 3 | Ga0070658_10474628 | 3300005327 | Bacteria | 1079 |
| 4 | Ga0070683_100009817 | 3300005329 | Bacteria | 8201 |
| 5 | Ga0070683_100023908 | 3300005329 | Bacteria | 5470 |
| 6 | Ga0070683_100036540 | 3300005329 | Bacteria | 4495 |
| 7 | Ga0070683_100096868 | 3300005329 | Bacteria | 2775 |
| 8 | Ga0070683_100136532 | 3300005329 | Bacteria | 2323 |
| 9 | Ga0070683_100201360 | 3300005329 | Bacteria | 1890 |
| 10 | Ga0070683_100376421 | 3300005329 | Bacteria | 1353 |
| 11 | Ga0070670_100111300 | 3300005331 | Bacteria | 2359 |
| 12 | Ga0068869_100176885 | 3300005334 | Bacteria | 1671 |
| 13 | Ga0070680_100073191 | 3300005336 | Bacteria | 2817 |
| 14 | Ga0070682_100002682 | 3300005337 | Bacteria | 9845 |
| 15 | Ga0070682_100013692 | 3300005337 | Bacteria | 4674 |
| 16 | Ga0070682_100069770 | 3300005337 | Bacteria | 2245 |
| 17 | Ga0070682_100293176 | 3300005337 | Bacteria | 1191 |
| 18 | Ga0070682_100398046 | 3300005337 | Bacteria | 1041 |
| 19 | Ga0068868_100065622 | 3300005338 | Bacteria | 2884 |
| 20 | Ga0068868_100184226 | 3300005338 | Bacteria | 1733 |
| 21 | Ga0070660_100036084 | 3300005339 | Bacteria | 3744 |
| 22 | Ga0070660_100048141 | 3300005339 | Bacteria | 3273 |
| 23 | Ga0070660_100161448 | 3300005339 | Bacteria | 1806 |
| 24 | Ga0070691_10026426 | 3300005341 | Bacteria | 2705 |
| 25 | Ga0070661_100092126 | 3300005344 | Bacteria | 2245 |
| 26 | Ga0070692_10005693 | 3300005345 | Bacteria | 5346 |
| 27 | Ga0070692_10025132 | 3300005345 | Bacteria | 2934 |
| 28 | Ga0070692_10097940 | 3300005345 | Bacteria | 1604 |
| 29 | Ga0070675_100147591 | 3300005354 | Bacteria | 2015 |
| 30 | Ga0070675_100263189 | 3300005354 | Bacteria | 1512 |
| 31 | Ga0070671_100045236 | 3300005355 | Bacteria | 3659 |
| 32 | Ga0070673_100029253 | 3300005364 | Bacteria | 4107 |
| 33 | Ga0070659_100089414 | 3300005366 | Bacteria | 2467 |
| 34 | Ga0070659_100093200 | 3300005366 | Bacteria | 2417 |
| 35 | Ga0070659_100166232 | 3300005366 | Bacteria | 1805 |
| 36 | Ga0070659_100200249 | 3300005366 | Bacteria | 1644 |
| 37 | Ga0070659_100338641 | 3300005366 | Bacteria | 1260 |
| 38 | Ga0070659_100438344 | 3300005366 | Bacteria | 1106 |
| 39 | Ga0070667_100007583 | 3300005367 | Bacteria | 8999 |
| 40 | Ga0070667_100065010 | 3300005367 | Bacteria | 3097 |
| 41 | Ga0070667_100405868 | 3300005367 | Bacteria | 1241 |
| 42 | Ga0070714_100001446 | 3300005435 | Bacteria | 17298 |
| 43 | Ga0070701_10122806 | 3300005438 | Bacteria | 1466 |
| 44 | Ga0070701_10185773 | 3300005438 | Bacteria | 1220 |
| 45 | Ga0070700_100034575 | 3300005441 | Bacteria | 3053 |
| 46 | Ga0070700_100137214 | 3300005441 | Bacteria | 1658 |
| 47 | Ga0070663_100019332 | 3300005455 | Bacteria | 4486 |
| 48 | Ga0070663_100049350 | 3300005455 | Bacteria | 2988 |
| 49 | Ga0070663_100575854 | 3300005455 | Bacteria | 944 |
| 50 | Ga0070678_100155551 | 3300005456 | Bacteria | 1846 |
| 51 | Ga0070678_100341965 | 3300005456 | Bacteria | 1284 |
| 52 | Ga0070662_100164417 | 3300005457 | Bacteria | 1738 |
| 53 | Ga0070681_10114956 | 3300005458 | Bacteria | 2629 |
| 54 | Ga0070681_10260928 | 3300005458 | Bacteria | 1645 |
| 55 | Ga0070681_10656618 | 3300005458 | Bacteria | 964 |
| 56 | Ga0068867_100074370 | 3300005459 | Bacteria | 2547 |
| 57 | Ga0070685_10064620 | 3300005466 | Bacteria | 2152 |
| 58 | Ga0070698_100000363 | 3300005471 | Bacteria | 46987 |
| 59 | Ga0070679_100112171 | 3300005530 | Bacteria | 2713 |
| 60 | Ga0070679_100160437 | 3300005530 | Bacteria | 2223 |
| 61 | Ga0070679_100436345 | 3300005530 | Bacteria | 1255 |
| 62 | Ga0070679_100987741 | 3300005530 | Bacteria | 786 |
| 63 | Ga0070684_100028263 | 3300005535 | Bacteria | 4743 |
| 64 | Ga0070684_100178752 | 3300005535 | Bacteria | 1929 |
| 65 | Ga0068853_100022084 | 3300005539 | Bacteria | 5310 |
| 66 | Ga0070672_100019305 | 3300005543 | Bacteria | 4945 |
| 67 | Ga0070686_100055918 | 3300005544 | Bacteria | 2530 |
| 68 | Ga0070693_100018875 | 3300005547 | Bacteria | 3608 |
| 69 | Ga0070665_100000450 | 3300005548 | Bacteria | 59867 |
| 70 | Ga0070665_100212342 | 3300005548 | Bacteria | 1936 |
| 71 | Ga0070665_100366668 | 3300005548 | Bacteria | 1447 |
| 72 | Ga0070704_100584115 | 3300005549 | Bacteria | 980 |
| 73 | Ga0068855_100113651 | 3300005563 | Bacteria | 3106 |
| 74 | Ga0068855_100206224 | 3300005563 | Bacteria | 2211 |
| 75 | Ga0068855_100233922 | 3300005563 | Bacteria | 2056 |
| 76 | Ga0068855_100276624 | 3300005563 | Bacteria | 1866 |
| 77 | Ga0070664_100158709 | 3300005564 | Bacteria | 2000 |
| 78 | Ga0070664_100176753 | 3300005564 | Bacteria | 1896 |
| 79 | Ga0070664_100529217 | 3300005564 | Bacteria | 1089 |
| 80 | Ga0068857_100009886 | 3300005577 | Bacteria | 8283 |
| 81 | Ga0068857_100537716 | 3300005577 | Bacteria | 1100 |
| 82 | Ga0068854_100084599 | 3300005578 | Bacteria | 2347 |
| 83 | Ga0068854_100206351 | 3300005578 | Bacteria | 1548 |
| 84 | Ga0068856_100028796 | 3300005614 | Bacteria | 5427 |
| 85 | Ga0068856_100841420 | 3300005614 | Bacteria | 937 |
| 86 | Ga0068856_101246478 | 3300005614 | Bacteria | 759 |
| 87 | Ga0070702_100011043 | 3300005615 | Bacteria | 4481 |
| 88 | Ga0068852_100050155 | 3300005616 | Bacteria | 3574 |
| 89 | Ga0068852_101138780 | 3300005616 | Bacteria | 801 |
| 90 | Ga0068859_100054057 | 3300005617 | Bacteria | 4039 |
| 91 | Ga0068864_100111739 | 3300005618 | Bacteria | 2435 |
| 92 | Ga0068861_100561646 | 3300005719 | Bacteria | 1042 |
| 93 | Ga0068870_10003307 | 3300005840 | Bacteria | 6812 |
| 94 | Ga0068870_10011892 | 3300005840 | Bacteria | 4050 |
| 95 | Ga0068870_10239403 | 3300005840 | Bacteria | 1120 |
| 96 | Ga0068863_100076596 | 3300005841 | Bacteria | 3164 |
| 97 | Ga0068858_100077027 | 3300005842 | Bacteria | 3097 |
| 98 | Ga0068858_100120615 | 3300005842 | Bacteria | 2452 |
| 99 | Ga0068860_100000304 | 3300005843 | Bacteria | 68193 |
| 100 | Ga0068860_100100284 | 3300005843 | Bacteria | 2762 |
| 101 | Ga0081540_1050807 | 3300005983 | Bacteria | 2055 |
| 102 | Ga0081539_10036418 | 3300005985 | Bacteria | 2945 |
| 103 | Ga0075365_10025922 | 3300006038 | Bacteria | 3715 |
| 104 | Ga0075365_10027382 | 3300006038 | Bacteria | 3627 |
| 105 | Ga0075365_10043487 | 3300006038 | Bacteria | 2941 |
| 106 | Ga0075365_10063640 | 3300006038 | Bacteria | 2470 |
| 107 | Ga0075365_10192855 | 3300006038 | Bacteria | 1426 |
| 108 | Ga0075365_10215429 | 3300006038 | Bacteria | 1346 |
| 109 | Ga0075365_10262099 | 3300006038 | Bacteria | 1215 |
| 110 | Ga0075365_10275209 | 3300006038 | Bacteria | 1184 |
| 111 | Ga0075368_10003543 | 3300006042 | Bacteria | 5228 |
| 112 | Ga0075368_10018608 | 3300006042 | Bacteria | 2611 |
| 113 | Ga0075368_10019857 | 3300006042 | Bacteria | 2539 |
| 114 | Ga0075368_10280626 | 3300006042 | Bacteria | 716 |
| 115 | Ga0075363_100002765 | 3300006048 | Bacteria | 7273 |
| 116 | Ga0075363_100007893 | 3300006048 | Bacteria | 4928 |
| 117 | Ga0075363_100011133 | 3300006048 | Bacteria | 4299 |
| 118 | Ga0075363_100099949 | 3300006048 | Bacteria | 1604 |
| 119 | Ga0075364_10009391 | 3300006051 | Bacteria | 5865 |
| 120 | Ga0075364_10034188 | 3300006051 | Bacteria | 3278 |
| 121 | Ga0075364_10039261 | 3300006051 | Bacteria | 3068 |
| 122 | Ga0075364_10039542 | 3300006051 | Bacteria | 3058 |
| 123 | Ga0075364_10065390 | 3300006051 | Bacteria | 2387 |
| 124 | Ga0075364_10066532 | 3300006051 | Bacteria | 2367 |
| 125 | Ga0075364_10089036 | 3300006051 | Bacteria | 2047 |
| 126 | Ga0075364_10142496 | 3300006051 | Bacteria | 1613 |
| 127 | Ga0075364_10477882 | 3300006051 | Bacteria | 852 |
| 128 | Ga0070712_100568552 | 3300006175 | Bacteria | 957 |
| 129 | Ga0075362_10058501 | 3300006177 | Bacteria | 1738 |
| 130 | Ga0075362_10059421 | 3300006177 | Bacteria | 1726 |
| 131 | Ga0075367_10009420 | 3300006178 | Bacteria | 5105 |
| 132 | Ga0075367_10030512 | 3300006178 | Bacteria | 3091 |
| 133 | Ga0097621_101045862 | 3300006237 | Bacteria | 765 |
| 134 | Ga0075370_10006935 | 3300006353 | Bacteria | 5739 |
| 135 | Ga0075370_10015383 | 3300006353 | Bacteria | 4096 |
| 136 | Ga0075370_10015524 | 3300006353 | Bacteria | 4079 |
| 137 | Ga0068871_100072529 | 3300006358 | Bacteria | 2836 |
| 138 | Ga0068871_100084567 | 3300006358 | Bacteria | 2633 |
| 139 | Ga0075428_100965489 | 3300006844 | Bacteria | 903 |
| 140 | Ga0075431_100111265 | 3300006847 | Bacteria | 2826 |
| 141 | Ga0075434_100067274 | 3300006871 | Bacteria | 3569 |
| 142 | Ga0068865_100003722 | 3300006881 | Bacteria | 9154 |
| 143 | Ga0068865_100464631 | 3300006881 | Bacteria | 1049 |
| 144 | Ga0068865_100856564 | 3300006881 | Bacteria | 788 |
| 145 | Ga0075436_100066751 | 3300006914 | Bacteria | 2487 |
| 146 | Ga0097620_100054056 | 3300006931 | Bacteria | 4039 |
| 147 | Ga0075435_100037138 | 3300007076 | Bacteria | 3877 |
| 148 | Ga0105251_10110283 | 3300009011 | Bacteria | 1254 |
| 149 | Ga0105240_10010898 | 3300009093 | Bacteria | 12736 |
| 150 | Ga0105240_10103159 | 3300009093 | Bacteria | 3466 |
| 151 | Ga0105240_10698213 | 3300009093 | Bacteria | 1108 |
| 152 | Ga0111539_10057392 | 3300009094 | Bacteria | 4624 |
| 153 | Ga0111539_10167102 | 3300009094 | Bacteria | 2571 |
| 154 | Ga0111539_10637774 | 3300009094 | Bacteria | 1240 |
| 155 | Ga0105245_10000359 | 3300009098 | Bacteria | 42584 |
| 156 | Ga0105245_10119505 | 3300009098 | Bacteria | 2460 |
| 157 | Ga0105245_10623655 | 3300009098 | Bacteria | 1107 |
| 158 | Ga0105245_10953672 | 3300009098 | Bacteria | 901 |
| 159 | Ga0105247_10046783 | 3300009101 | Bacteria | 2656 |
| 160 | Ga0114129_10076786 | 3300009147 | Bacteria | 4649 |
| 161 | Ga0105243_10020111 | 3300009148 | Bacteria | 5061 |
| 162 | Ga0105243_10097702 | 3300009148 | Bacteria | 2431 |
| 163 | Ga0105243_10439882 | 3300009148 | Bacteria | 1221 |
| 164 | Ga0105241_10034837 | 3300009174 | Bacteria | 3785 |
| 165 | Ga0105248_10061101 | 3300009177 | Bacteria | 4230 |
| 166 | Ga0105248_10212297 | 3300009177 | Bacteria | 2181 |
| 167 | Ga0105248_10227251 | 3300009177 | Bacteria | 2101 |
| 168 | Ga0105237_10015753 | 3300009545 | Bacteria | 7862 |
| 169 | Ga0105237_10074076 | 3300009545 | Bacteria | 3396 |
| 170 | Ga0105237_10193530 | 3300009545 | Bacteria | 2033 |
| 171 | Ga0105237_10645230 | 3300009545 | Bacteria | 1065 |
| 172 | Ga0105237_11041106 | 3300009545 | Bacteria | 825 |
| 173 | Ga0105238_10104253 | 3300009551 | Bacteria | 2817 |
| 174 | Ga0105238_10217634 | 3300009551 | Bacteria | 1886 |
| 175 | Ga0105249_10362547 | 3300009553 | Bacteria | 1471 |
| 176 | Ga0105249_10482721 | 3300009553 | Bacteria | 1282 |
| 177 | Ga0105249_10759378 | 3300009553 | Bacteria | 1032 |
| 178 | Ga0105249_11689487 | 3300009553 | Bacteria | 706 |
| 179 | Ga0105029_103857 | 3300009984 | Bacteria | 1017 |
| 180 | Ga0105239_10012602 | 3300010375 | Bacteria | 9408 |
| 181 | Ga0105239_10012785 | 3300010375 | Bacteria | 9339 |
| 182 | Ga0105239_10026655 | 3300010375 | Bacteria | 6361 |
| 183 | Ga0105239_10174678 | 3300010375 | Bacteria | 2403 |
| 184 | Ga0105239_10728758 | 3300010375 | Bacteria | 1134 |
| 185 | Ga0105246_10003745 | 3300011119 | Bacteria | 9219 |
| 186 | Ga0157316_1017087 | 3300012510 | Bacteria | 753 |
| 187 | Ga0157373_10085704 | 3300013100 | Bacteria | 2220 |
| 188 | Ga0157371_10079734 | 3300013102 | Bacteria | 2319 |
| 189 | Ga0157371_10121099 | 3300013102 | Bacteria | 1860 |
| 190 | Ga0157370_10063407 | 3300013104 | Bacteria | 3502 |
| 191 | Ga0157370_10282298 | 3300013104 | Bacteria | 1534 |
| 192 | Ga0157370_10332198 | 3300013104 | Bacteria | 1401 |
| 193 | Ga0157369_10339687 | 3300013105 | Bacteria | 1560 |
| 194 | Ga0157369_10661706 | 3300013105 | Bacteria | 1077 |
| 195 | Ga0157374_10065627 | 3300013296 | Bacteria | 3409 |
| 196 | Ga0157378_10339060 | 3300013297 | Bacteria | 1465 |
| 197 | Ga0163162_10002746 | 3300013306 | Bacteria | 16703 |
| 198 | Ga0157372_10035893 | 3300013307 | Bacteria | 5460 |
| 199 | Ga0157372_10101197 | 3300013307 | Bacteria | 3289 |
| 200 | Ga0157372_10166981 | 3300013307 | Bacteria | 2545 |
| 201 | Ga0157372_10205672 | 3300013307 | Bacteria | 2281 |
| 202 | Ga0157372_10752040 | 3300013307 | Bacteria | 1133 |
| 203 | Ga0157375_10008143 | 3300013308 | Bacteria | 9170 |
| 204 | Ga0157375_10154397 | 3300013308 | Bacteria | 2433 |
| 205 | Ga0157375_10500986 | 3300013308 | Bacteria | 1379 |
| 206 | Ga0157380_10051037 | 3300014326 | Bacteria | 3269 |
| 207 | Ga0157380_10257426 | 3300014326 | Bacteria | 1583 |
| 208 | Ga0157380_10882182 | 3300014326 | Bacteria | 919 |
| 209 | Ga0157380_11590112 | 3300014326 | Bacteria | 709 |
| 210 | Ga0157377_10087620 | 3300014745 | Bacteria | 1832 |
| 211 | Ga0157377_10515834 | 3300014745 | Bacteria | 838 |
| 212 | Ga0157379_10039351 | 3300014968 | Bacteria | 4218 |
| 213 | Ga0157376_10349216 | 3300014969 | Bacteria | 1415 |
| 214 | Ga0163161_10009496 | 3300017792 | Bacteria | 6731 |
| 215 | Ga0163161_10171846 | 3300017792 | Bacteria | 1657 |
| 216 | Ga0163161_10531334 | 3300017792 | Bacteria | 962 |
| 217 | Ga0206356_10664571 | 3300020070 | Bacteria | 1562 |
| 218 | Ga0206354_10301906 | 3300020081 | Bacteria | 1062 |
| 219 | Ga0206354_10855475 | 3300020081 | Bacteria | 1286 |
| 220 | Ga0206353_10122393 | 3300020082 | Bacteria | 4372 |
| 221 | Ga0206353_11030654 | 3300020082 | Bacteria | 1223 |
| 222 | Ga0206353_11521123 | 3300020082 | Bacteria | 8188 |
| 223 | Ga0206353_11743485 | 3300020082 | Bacteria | 1224 |
| 224 | Ga0213876_10081593 | 3300021384 | Bacteria | 1710 |
| 225 | Ga0213875_10049861 | 3300021388 | Bacteria | 1962 |
| 226 | Ga0207697_10027155 | 3300025315 | Bacteria | 2341 |
| 227 | Ga0207656_10055751 | 3300025321 | Bacteria | 1721 |
| 228 | Ga0207692_10085843 | 3300025898 | Bacteria | 1694 |
| 229 | Ga0207710_10081738 | 3300025900 | Bacteria | 1500 |
| 230 | Ga0207688_10015206 | 3300025901 | Bacteria | 4175 |
| 231 | Ga0207688_10015922 | 3300025901 | Bacteria | 4077 |
| 232 | Ga0207688_10123391 | 3300025901 | Bacteria | 1513 |
| 233 | Ga0207688_10197705 | 3300025901 | Bacteria | 1204 |
| 234 | Ga0207647_10041476 | 3300025904 | Bacteria | 2893 |
| 235 | Ga0207647_10063353 | 3300025904 | Bacteria | 2249 |
| 236 | Ga0207647_10067410 | 3300025904 | Bacteria | 2169 |
| 237 | Ga0207647_10100243 | 3300025904 | Bacteria | 1719 |
| 238 | Ga0207647_10202195 | 3300025904 | Bacteria | 1149 |
| 239 | Ga0207645_10018549 | 3300025907 | Bacteria | 4575 |
| 240 | Ga0207643_10000100 | 3300025908 | Bacteria | 58884 |
| 241 | Ga0207643_10003328 | 3300025908 | Bacteria | 8661 |
| 242 | Ga0207705_10048003 | 3300025909 | Bacteria | 3071 |
| 243 | Ga0207705_10048274 | 3300025909 | Bacteria | 3061 |
| 244 | Ga0207654_10184265 | 3300025911 | Bacteria | 1364 |
| 245 | Ga0207707_10120932 | 3300025912 | Bacteria | 2289 |
| 246 | Ga0207707_10261355 | 3300025912 | Bacteria | 1502 |
| 247 | Ga0207707_10278319 | 3300025912 | Bacteria | 1450 |
| 248 | Ga0207695_10025646 | 3300025913 | Bacteria | 6593 |
| 249 | Ga0207695_10206410 | 3300025913 | Bacteria | 1877 |
| 250 | Ga0207695_10341210 | 3300025913 | Bacteria | 1386 |
| 251 | Ga0207671_10025439 | 3300025914 | Bacteria | 4446 |
| 252 | Ga0207671_10122276 | 3300025914 | Bacteria | 1990 |
| 253 | Ga0207671_10128858 | 3300025914 | Bacteria | 1940 |
| 254 | Ga0207660_10653575 | 3300025917 | Bacteria | 857 |
| 255 | Ga0207662_10005149 | 3300025918 | Bacteria | 6938 |
| 256 | Ga0207662_10039986 | 3300025918 | Bacteria | 2754 |
| 257 | Ga0207662_10144930 | 3300025918 | Bacteria | 1507 |
| 258 | Ga0207662_10332443 | 3300025918 | Bacteria | 1017 |
| 259 | Ga0207657_10010726 | 3300025919 | Bacteria | 9124 |
| 260 | Ga0207657_10060396 | 3300025919 | Bacteria | 3253 |
| 261 | Ga0207657_10074462 | 3300025919 | Bacteria | 2867 |
| 262 | Ga0207649_10058045 | 3300025920 | Bacteria | 2422 |
| 263 | Ga0207652_10313789 | 3300025921 | Bacteria | 1415 |
| 264 | Ga0207694_10089127 | 3300025924 | Bacteria | 2433 |
| 265 | Ga0207650_10282776 | 3300025925 | Bacteria | 1351 |
| 266 | Ga0207659_10100631 | 3300025926 | Bacteria | 2178 |
| 267 | Ga0207659_10293625 | 3300025926 | Bacteria | 1333 |
| 268 | Ga0207687_10002966 | 3300025927 | Bacteria | 11494 |
| 269 | Ga0207687_10058267 | 3300025927 | Bacteria | 2717 |
| 270 | Ga0207687_10063166 | 3300025927 | Bacteria | 2621 |
| 271 | Ga0207687_10398679 | 3300025927 | Bacteria | 1131 |
| 272 | Ga0207687_10754813 | 3300025927 | Bacteria | 828 |
| 273 | Ga0207664_10298077 | 3300025929 | Bacteria | 1418 |
| 274 | Ga0207690_10010372 | 3300025932 | Bacteria | 5534 |
| 275 | Ga0207690_10014869 | 3300025932 | Bacteria | 4710 |
| 276 | Ga0207690_10047931 | 3300025932 | Bacteria | 2837 |
| 277 | Ga0207690_10071359 | 3300025932 | Bacteria | 2395 |
| 278 | Ga0207706_10272717 | 3300025933 | Bacteria | 1476 |
| 279 | Ga0207686_10033772 | 3300025934 | Bacteria | 3056 |
| 280 | Ga0207709_10670833 | 3300025935 | Bacteria | 827 |
| 281 | Ga0207669_10040905 | 3300025937 | Bacteria | 2693 |
| 282 | Ga0207669_10448619 | 3300025937 | Bacteria | 1022 |
| 283 | Ga0207704_10066534 | 3300025938 | Bacteria | 2262 |
| 284 | Ga0207704_10348033 | 3300025938 | Bacteria | 1153 |
| 285 | Ga0207691_10009704 | 3300025940 | Bacteria | 9236 |
| 286 | Ga0207691_10016940 | 3300025940 | Bacteria | 6915 |
| 287 | Ga0207711_10057824 | 3300025941 | Bacteria | 3334 |
| 288 | Ga0207689_10045864 | 3300025942 | Bacteria | 3614 |
| 289 | Ga0207689_10117355 | 3300025942 | Bacteria | 2188 |
| 290 | Ga0207689_10332680 | 3300025942 | Bacteria | 1261 |
| 291 | Ga0207661_10012431 | 3300025944 | Bacteria | 6187 |
| 292 | Ga0207661_10031047 | 3300025944 | Bacteria | 4122 |
| 293 | Ga0207661_10035436 | 3300025944 | Bacteria | 3889 |
| 294 | Ga0207661_10041082 | 3300025944 | Bacteria | 3639 |
| 295 | Ga0207661_10044358 | 3300025944 | Bacteria | 3514 |
| 296 | Ga0207661_10064962 | 3300025944 | Bacteria | 2960 |
| 297 | Ga0207661_10097305 | 3300025944 | Bacteria | 2464 |
| 298 | Ga0207661_10140032 | 3300025944 | Bacteria | 2081 |
| 299 | Ga0207661_10738946 | 3300025944 | Bacteria | 905 |
| 300 | Ga0207661_10892336 | 3300025944 | Bacteria | 819 |
| 301 | Ga0207679_10081212 | 3300025945 | Bacteria | 2478 |
| 302 | Ga0207679_10094241 | 3300025945 | Bacteria | 2324 |
| 303 | Ga0207679_10171342 | 3300025945 | Bacteria | 1787 |
| 304 | Ga0207679_10270967 | 3300025945 | Bacteria | 1452 |
| 305 | Ga0207679_10777112 | 3300025945 | Bacteria | 872 |
| 306 | Ga0207667_10155460 | 3300025949 | Bacteria | 2353 |
| 307 | Ga0207667_10249536 | 3300025949 | Bacteria | 1815 |
| 308 | Ga0207667_10304779 | 3300025949 | Bacteria | 1627 |
| 309 | Ga0207667_10945749 | 3300025949 | Bacteria | 851 |
| 310 | Ga0207651_10023558 | 3300025960 | Bacteria | 3791 |
| 311 | Ga0207651_10051552 | 3300025960 | Bacteria | 2801 |
| 312 | Ga0207712_10275685 | 3300025961 | Bacteria | 1370 |
| 313 | Ga0207640_10077392 | 3300025981 | Bacteria | 2261 |
| 314 | Ga0207658_10009016 | 3300025986 | Bacteria | 6766 |
| 315 | Ga0207658_10028588 | 3300025986 | Bacteria | 3927 |
| 316 | Ga0207658_10365979 | 3300025986 | Bacteria | 1259 |
| 317 | Ga0207658_10385369 | 3300025986 | Bacteria | 1229 |
| 318 | Ga0207677_10714709 | 3300026023 | Bacteria | 890 |
| 319 | Ga0207677_10764601 | 3300026023 | Bacteria | 862 |
| 320 | Ga0207703_10106370 | 3300026035 | Bacteria | 2386 |
| 321 | Ga0207639_10392818 | 3300026041 | Bacteria | 1248 |
| 322 | Ga0207678_10002842 | 3300026067 | Bacteria | 15701 |
| 323 | Ga0207678_10068635 | 3300026067 | Bacteria | 3041 |
| 324 | Ga0207708_10000786 | 3300026075 | Bacteria | 23943 |
| 325 | Ga0207708_10052761 | 3300026075 | Bacteria | 3097 |
| 326 | Ga0207702_10103325 | 3300026078 | Bacteria | 2520 |
| 327 | Ga0207702_10639022 | 3300026078 | Bacteria | 1046 |
| 328 | Ga0207702_11341243 | 3300026078 | Bacteria | 709 |
| 329 | Ga0207641_10222852 | 3300026088 | Bacteria | 1749 |
| 330 | Ga0207641_10557923 | 3300026088 | Bacteria | 1118 |
| 331 | Ga0207648_10123460 | 3300026089 | Bacteria | 2277 |
| 332 | Ga0207648_10462872 | 3300026089 | Bacteria | 1156 |
| 333 | Ga0207676_10067002 | 3300026095 | Bacteria | 2866 |
| 334 | Ga0207674_10038543 | 3300026116 | Bacteria | 4957 |
| 335 | Ga0207674_10260536 | 3300026116 | Bacteria | 1681 |
| 336 | Ga0207674_10282679 | 3300026116 | Bacteria | 1607 |
| 337 | Ga0207674_10862854 | 3300026116 | Bacteria | 873 |
| 338 | Ga0207675_100197651 | 3300026118 | Bacteria | 1931 |
| 339 | Ga0207675_100917568 | 3300026118 | Bacteria | 892 |
| 340 | Ga0207683_10000565 | 3300026121 | Bacteria | 34282 |
| 341 | Ga0207683_10094315 | 3300026121 | Bacteria | 2667 |
| 342 | Ga0207683_10172921 | 3300026121 | Bacteria | 1957 |
| 343 | Ga0207698_10054593 | 3300026142 | Bacteria | 3074 |
| 344 | Ga0207698_10058156 | 3300026142 | Bacteria | 2995 |
| 345 | Ga0207698_10182676 | 3300026142 | Bacteria | 1860 |
| 346 | Ga0207698_10222333 | 3300026142 | Bacteria | 1707 |
| 347 | Ga0207428_10053593 | 3300027907 | Bacteria | 3216 |
| 348 | Ga0268266_10004579 | 3300028379 | Bacteria | 13206 |
| 349 | Ga0268266_10058281 | 3300028379 | Bacteria | 3325 |
| 350 | Ga0268266_10276895 | 3300028379 | Bacteria | 1559 |
| 351 | Ga0268266_10885167 | 3300028379 | Bacteria | 863 |
| 352 | Ga0268264_10038630 | 3300028381 | Bacteria | 3940 |
| 353 | Ga0268264_10300168 | 3300028381 | Bacteria | 1512 |
| 354 | Ga0314311_1124506 | 3300030733 | Bacteria | 991 |
| 355 | Ga0307408_100393487 | 3300031548 | Bacteria | 1188 |
| 356 | Ga0307408_100503294 | 3300031548 | Bacteria | 1061 |
| 357 | Ga0307405_10096666 | 3300031731 | Bacteria | 1970 |
| 358 | Ga0307405_10379074 | 3300031731 | Bacteria | 1100 |
| 359 | Ga0307413_10040012 | 3300031824 | Bacteria | 2732 |
| 360 | Ga0307413_10295835 | 3300031824 | Bacteria | 1225 |
| 361 | Ga0307413_10408564 | 3300031824 | Bacteria | 1066 |
| 362 | Ga0307410_10039162 | 3300031852 | Bacteria | 3110 |
| 363 | Ga0307410_10299767 | 3300031852 | Bacteria | 1268 |
| 364 | Ga0307410_10308953 | 3300031852 | Bacteria | 1250 |
| 365 | Ga0307410_10481075 | 3300031852 | Bacteria | 1018 |
| 366 | Ga0307410_10525675 | 3300031852 | Bacteria | 977 |
| 367 | Ga0307406_10094187 | 3300031901 | Bacteria | 2024 |
| 368 | Ga0307406_10100755 | 3300031901 | Bacteria | 1967 |
| 369 | Ga0307407_10098732 | 3300031903 | Bacteria | 1807 |
| 370 | Ga0307407_10466002 | 3300031903 | Bacteria | 920 |
| 371 | Ga0307412_10206428 | 3300031911 | Bacteria | 1496 |
| 372 | Ga0307412_10343032 | 3300031911 | Bacteria | 1196 |
| 373 | Ga0307409_100071034 | 3300031995 | Bacteria | 2766 |
| 374 | Ga0307409_100128509 | 3300031995 | Bacteria | 2160 |
| 375 | Ga0307409_100257482 | 3300031995 | Bacteria | 1599 |
| 376 | Ga0307409_100339704 | 3300031995 | Bacteria | 1412 |
| 377 | Ga0307409_101194215 | 3300031995 | Bacteria | 784 |
| 378 | Ga0307416_100030850 | 3300032002 | Bacteria | 4028 |
| 379 | Ga0307416_100170926 | 3300032002 | Bacteria | 2023 |
| 380 | Ga0307416_100302006 | 3300032002 | Bacteria | 1592 |
| 381 | Ga0307416_100418949 | 3300032002 | Bacteria | 1382 |
| 382 | Ga0307416_100833295 | 3300032002 | Bacteria | 1020 |
| 383 | Ga0307416_101377175 | 3300032002 | Bacteria | 811 |
| 384 | Ga0307414_10571288 | 3300032004 | Bacteria | 1010 |
| 385 | Ga0307411_10086488 | 3300032005 | Bacteria | 2175 |
| 386 | Ga0307415_100030331 | 3300032126 | Bacteria | 3469 |
| 387 | Ga0307415_100031405 | 3300032126 | Bacteria | 3421 |
| 388 | Ga0307415_100213819 | 3300032126 | Bacteria | 1540 |
| 389 | Ga0316574_0352021 | 3300035398 | Bacteria | 932 |
| 390 | Ga0373947_0695791 | 3300035725 | Bacteria | 693 |
| 391 | Ga0395898_0172914 | 3300037466 | Bacteria | 2065 |
| 392 | Ga0395905_0021832 | 3300037471 | Bacteria | 6055 |
| 393 | Ga0395905_0405804 | 3300037471 | Bacteria | 1258 |
| 394 | Ga0436364_1506248 | 3300037853 | Bacteria | 3015 |
| 395 | Ga0395901_0084177 | 3300038443 | Bacteria | 3324 |
| 396 | Ga0395901_0320662 | 3300038443 | Bacteria | 1603 |
| 397 | Ga0395901_0808815 | 3300038443 | Bacteria | 926 |
| 398 | Ga0436365_0005613 | 3300039437 | Bacteria | 2285 |
| 399 | Ga0439438_020715 | 3300041405 | Bacteria | 1843 |
| 400 | Ga0451853_0740919 | 3300041512 | Bacteria | 1524 |
| 401 | Ga0451853_0786083 | 3300041512 | Bacteria | 972 |
| 402 | Ga0451853_4119957 | 3300041512 | Bacteria | 2352 |
| 403 | Ga0439445_0038825 | 3300042004 | Bacteria | 1260 |
| 404 | Ga0439448_0011570 | 3300042005 | Bacteria | 2631 |
| 405 | Ga0450914_007739 | 3300042118 | Bacteria | 978 |
| 406 | Ga0439458_0009932 | 3300042157 | Bacteria | 2119 |
| 407 | Ga0439434_0003200 | 3300042435 | Bacteria | 4809 |
| 408 | Ga0466972_0009367 | 3300044658 | Bacteria | 4923 |
| 409 | Ga0466972_0062815 | 3300044658 | Bacteria | 1779 |
| 410 | Ga0466972_0064381 | 3300044658 | Bacteria | 1755 |
| 411 | Ga0466972_0093198 | 3300044658 | Bacteria | 1428 |
| 412 | Ga0466965_0005158 | 3300044683 | Bacteria | 5864 |
| 413 | Ga0466965_0016158 | 3300044683 | Bacteria | 3548 |
| 414 | Ga0466965_0045897 | 3300044683 | Bacteria | 2162 |
| 415 | Ga0466965_0374484 | 3300044683 | Bacteria | 783 |
| 416 | Ga0466966_0008820 | 3300044684 | Bacteria | 6676 |
| 417 | Ga0466966_0009895 | 3300044684 | Bacteria | 6320 |
| 418 | Ga0466966_0016377 | 3300044684 | Bacteria | 4899 |
| 419 | Ga0466966_0019540 | 3300044684 | Bacteria | 4457 |
| 420 | Ga0466966_0027302 | 3300044684 | Bacteria | 3723 |
| 421 | Ga0466966_0082754 | 3300044684 | Bacteria | 1997 |
| 422 | Ga0466966_0121636 | 3300044684 | Bacteria | 1603 |
| 423 | Ga0466966_0466367 | 3300044684 | Bacteria | 759 |
| 424 | Ga0466961_0005682 | 3300044693 | Bacteria | 7887 |
| 425 | Ga0466961_0012524 | 3300044693 | Bacteria | 5427 |
| 426 | Ga0466961_0030207 | 3300044693 | Bacteria | 3483 |
| 427 | Ga0466961_0078603 | 3300044693 | Bacteria | 2089 |
| 428 | Ga0466961_0080179 | 3300044693 | Bacteria | 2066 |
| 429 | Ga0466961_0108550 | 3300044693 | Bacteria | 1747 |
| 430 | Ga0466961_0268145 | 3300044693 | Bacteria | 1046 |
| 431 | Ga0466961_0378045 | 3300044693 | Bacteria | 860 |
| 432 | Ga0466961_0424427 | 3300044693 | Bacteria | 806 |
| 433 | Ga0466963_0010373 | 3300044694 | Bacteria | 5639 |
| 434 | Ga0466963_0021922 | 3300044694 | Bacteria | 4038 |
| 435 | Ga0466963_0105852 | 3300044694 | Bacteria | 1928 |
| 436 | Ga0466963_0201424 | 3300044694 | Bacteria | 1392 |
| 437 | Ga0466963_0239434 | 3300044694 | Bacteria | 1272 |
| 438 | Ga0466964_0005603 | 3300044706 | Bacteria | 4666 |
| 439 | Ga0466964_0043570 | 3300044706 | Bacteria | 1821 |
| 440 | Ga0466964_0219482 | 3300044706 | Bacteria | 922 |
| 441 | Ga0466971_0019657 | 3300044719 | Bacteria | 3001 |
| 442 | Ga0466971_0139750 | 3300044719 | Bacteria | 1127 |
| 443 | Ga0466968_0020207 | 3300044735 | Bacteria | 2686 |
| 444 | Ga0466968_0082192 | 3300044735 | Bacteria | 1417 |
| 445 | Ga0466970_0007594 | 3300044765 | Bacteria | 5435 |
| 446 | Ga0466970_0009506 | 3300044765 | Bacteria | 4916 |
| 447 | Ga0466970_0027086 | 3300044765 | Bacteria | 3006 |
| 448 | Ga0466970_0039692 | 3300044765 | Bacteria | 2499 |
| 449 | Ga0466970_0048016 | 3300044765 | Bacteria | 2276 |
| 450 | Ga0466970_0054941 | 3300044765 | Bacteria | 2126 |
| 451 | Ga0466970_0191582 | 3300044765 | Bacteria | 1136 |
| 452 | Ga0466970_0324227 | 3300044765 | Bacteria | 871 |
| 453 | Ga0466957_0016712 | 3300044842 | Bacteria | 4292 |
| 454 | Ga0466957_0025147 | 3300044842 | Bacteria | 3528 |
| 455 | Ga0466957_0063950 | 3300044842 | Bacteria | 2263 |
| 456 | Ga0466957_0066993 | 3300044842 | Bacteria | 2215 |
| 457 | Ga0466957_0067043 | 3300044842 | Bacteria | 2214 |
| 458 | Ga0466960_0000389 | 3300044901 | Bacteria | 15045 |
| 459 | Ga0466960_0027309 | 3300044901 | Bacteria | 2602 |
| 460 | Ga0466960_0028802 | 3300044901 | Bacteria | 2544 |
| 461 | Ga0466960_0055071 | 3300044901 | Bacteria | 1933 |
| 462 | Ga0466960_0075534 | 3300044901 | Bacteria | 1686 |
| 463 | Ga0466960_0337797 | 3300044901 | Bacteria | 856 |
| 464 | Ga0466959_0009269 | 3300045049 | Bacteria | 6995 |
| 465 | Ga0466959_0010923 | 3300045049 | Bacteria | 6511 |
| 466 | Ga0466959_0033462 | 3300045049 | Bacteria | 3801 |
| 467 | Ga0466959_0052515 | 3300045049 | Bacteria | 2984 |
| 468 | Ga0466959_0167677 | 3300045049 | Bacteria | 1541 |
| 469 | Ga0466959_0286977 | 3300045049 | Bacteria | 1129 |
| 470 | Ga0466959_0288228 | 3300045049 | Bacteria | 1126 |
| 471 | Ga0466959_0324629 | 3300045049 | Bacteria | 1052 |
| 472 | Ga0466959_0469566 | 3300045049 | Bacteria | 852 |
| 473 | Ga0466958_0025759 | 3300045836 | Bacteria | 3470 |
| 474 | Ga0466958_0097642 | 3300045836 | Bacteria | 1823 |
| 475 | Ga0466958_0101486 | 3300045836 | Bacteria | 1789 |
| 476 | Ga0466958_0107958 | 3300045836 | Bacteria | 1736 |
| 477 | Ga0466958_0346969 | 3300045836 | Bacteria | 955 |
| 478 | Ga0466967_0000727 | 3300045976 | Bacteria | 16858 |
| 479 | Ga0466967_0006336 | 3300045976 | Bacteria | 8357 |
| 480 | Ga0466967_0006597 | 3300045976 | Bacteria | 8243 |
| 481 | Ga0466967_0026519 | 3300045976 | Bacteria | 4801 |
| 482 | Ga0466967_0048979 | 3300045976 | Bacteria | 3693 |
| 483 | Ga0466967_0082642 | 3300045976 | Bacteria | 2903 |
| 484 | Ga0466967_0115486 | 3300045976 | Bacteria | 2472 |
| 485 | Ga0466967_0152013 | 3300045976 | Bacteria | 2164 |
| 486 | Ga0466967_0182440 | 3300045976 | Bacteria | 1980 |
| 487 | Ga0466967_0219638 | 3300045976 | Bacteria | 1805 |
| 488 | Ga0466967_0276146 | 3300045976 | Bacteria | 1611 |
| 489 | Ga0466967_0385555 | 3300045976 | Bacteria | 1361 |
| 490 | Ga0466967_0434117 | 3300045976 | Bacteria | 1282 |
| 491 | Ga0466967_0671600 | 3300045976 | Bacteria | 1025 |
| 492 | Ga0466967_1169824 | 3300045976 | Bacteria | 766 |
| 493 | Ga0495603_0118031 | 3300046455 | Bacteria | 1547 |
| 494 | Ga0495582_0515591 | 3300046473 | Bacteria | 691 |
| 495 | Ga0495639_0181426 | 3300046475 | Bacteria | 1025 |
| 496 | Ga0495664_0018905 | 3300046477 | Bacteria | 3955 |
| 497 | Ga0495643_0093253 | 3300046522 | Bacteria | 1551 |
| 498 | Ga0495648_0021804 | 3300046524 | Bacteria | 4427 |
| 499 | Ga0495645_0278894 | 3300046543 | Bacteria | 1100 |
| 500 | Ga0495635_0348638 | 3300046663 | Bacteria | 988 |
| 501 | Ga0495635_0492966 | 3300046663 | Bacteria | 807 |
| 502 | Ga0495657_0107759 | 3300046675 | Bacteria | 1768 |
| 503 | Ga0495658_0514730 | 3300046683 | Bacteria | 766 |
| 504 | Ga0495680_0106793 | 3300047322 | Bacteria | 2080 |
| 505 | Ga0496100_0082924 | 3300048903 | Bacteria | 2169 |
| 506 | Ga0496100_0215927 | 3300048903 | Bacteria | 1405 |
| 507 | Ga0496100_0335432 | 3300048903 | Bacteria | 1139 |
| 508 | Ga0496102_0008533 | 3300048905 | Bacteria | 8785 |
| 509 | Ga0496102_0062971 | 3300048905 | Bacteria | 3396 |
| 510 | Ga0496102_0149808 | 3300048905 | Bacteria | 2191 |
| 511 | Ga0496102_0399641 | 3300048905 | Bacteria | 1292 |
| 512 | Ga0496102_0506586 | 3300048905 | Bacteria | 1129 |
| 513 | Ga0496102_0589081 | 3300048905 | Bacteria | 1035 |
| 514 | Ga0496102_0626871 | 3300048905 | Bacteria | 998 |
| 515 | Ga0496103_0070358 | 3300048906 | Bacteria | 2189 |
| 516 | Ga0496103_0417721 | 3300048906 | Bacteria | 861 |
| 517 | Ga0496104_0004891 | 3300048907 | Bacteria | 11682 |
| 518 | Ga0496104_0061498 | 3300048907 | Bacteria | 3560 |
| 519 | Ga0496104_0064806 | 3300048907 | Bacteria | 3466 |
| 520 | Ga0496104_0280978 | 3300048907 | Bacteria | 1578 |
| 521 | Ga0496104_0391999 | 3300048907 | Bacteria | 1301 |
| 522 | Ga0496105_0016582 | 3300048908 | Bacteria | 5882 |
| 523 | Ga0496105_0031900 | 3300048908 | Bacteria | 4321 |
| 524 | Ga0496105_0149894 | 3300048908 | Bacteria | 1917 |
| 525 | Ga0496106_0063822 | 3300048909 | Bacteria | 2800 |
| 526 | Ga0496106_0073228 | 3300048909 | Bacteria | 2620 |
| 527 | Ga0496106_0140054 | 3300048909 | Bacteria | 1902 |
| 528 | Ga0496106_0171225 | 3300048909 | Bacteria | 1721 |
| 529 | Ga0496106_0303692 | 3300048909 | Bacteria | 1280 |
| 530 | Ga0496107_0010995 | 3300048910 | Bacteria | 6296 |
| 531 | Ga0496107_0056858 | 3300048910 | Bacteria | 2827 |
| 532 | Ga0496107_0132739 | 3300048910 | Bacteria | 1839 |
| 533 | Ga0496107_0216495 | 3300048910 | Bacteria | 1424 |
| 534 | Ga0496107_0518866 | 3300048910 | Bacteria | 883 |
| 535 | Ga0496107_0610816 | 3300048910 | Bacteria | 805 |
| 536 | Ga0496108_0034934 | 3300048911 | Bacteria | 4177 |
| 537 | Ga0496108_0039949 | 3300048911 | Bacteria | 3910 |
| 538 | Ga0496108_0049105 | 3300048911 | Bacteria | 3529 |
| 539 | Ga0496108_0052559 | 3300048911 | Bacteria | 3415 |
| 540 | Ga0496108_0129466 | 3300048911 | Bacteria | 2169 |
| 541 | Ga0496109_0009876 | 3300048912 | Bacteria | 8148 |
| 542 | Ga0496109_0047925 | 3300048912 | Bacteria | 3887 |
| 543 | Ga0496109_0051661 | 3300048912 | Bacteria | 3744 |
| 544 | Ga0496109_0052834 | 3300048912 | Bacteria | 3705 |
| 545 | Ga0496109_0069632 | 3300048912 | Bacteria | 3227 |
| 546 | Ga0496109_0113315 | 3300048912 | Bacteria | 2522 |
| 547 | Ga0496109_0153136 | 3300048912 | Bacteria | 2159 |
| 548 | Ga0496109_0349155 | 3300048912 | Bacteria | 1397 |
| 549 | Ga0496109_0798912 | 3300048912 | Bacteria | 881 |
| 550 | Ga0496110_0018218 | 3300048913 | Bacteria | 5885 |
| 551 | Ga0496110_0118546 | 3300048913 | Bacteria | 2383 |
| 552 | Ga0496110_0177292 | 3300048913 | Bacteria | 1935 |
| 553 | Ga0496110_0404397 | 3300048913 | Bacteria | 1244 |
| 554 | Ga0496111_0005153 | 3300048914 | Bacteria | 8333 |
| 555 | Ga0496111_0027398 | 3300048914 | Bacteria | 4031 |
| 556 | Ga0496111_0031104 | 3300048914 | Bacteria | 3800 |
| 557 | Ga0496111_0088925 | 3300048914 | Bacteria | 2262 |
| 558 | Ga0496111_0211399 | 3300048914 | Bacteria | 1441 |
| 559 | Ga0496112_0468731 | 3300048915 | Bacteria | 1197 |
| 560 | Ga0496113_0062276 | 3300048916 | Bacteria | 2817 |
| 561 | Ga0496113_0077007 | 3300048916 | Bacteria | 2549 |
| 562 | Ga0496113_0091951 | 3300048916 | Bacteria | 2339 |
| 563 | Ga0496113_0168130 | 3300048916 | Bacteria | 1736 |
| 564 | Ga0496113_0248578 | 3300048916 | Bacteria | 1420 |
| 565 | Ga0496114_0018030 | 3300048917 | Bacteria | 5703 |
| 566 | Ga0496114_0020867 | 3300048917 | Bacteria | 5320 |
| 567 | Ga0496114_0023003 | 3300048917 | Bacteria | 5080 |
| 568 | Ga0496114_0027407 | 3300048917 | Bacteria | 4666 |
| 569 | Ga0496114_0029410 | 3300048917 | Bacteria | 4516 |
| 570 | Ga0496114_0052772 | 3300048917 | Bacteria | 3387 |
| 571 | Ga0496114_0148944 | 3300048917 | Bacteria | 2030 |
| 572 | Ga0496114_0290411 | 3300048917 | Bacteria | 1443 |
| 573 | Ga0496114_0291482 | 3300048917 | Bacteria | 1440 |
| 574 | Ga0496114_0350137 | 3300048917 | Bacteria | 1306 |
| 575 | Ga0496114_0376250 | 3300048917 | Bacteria | 1257 |
| 576 | Ga0496114_0453728 | 3300048917 | Bacteria | 1135 |
| 577 | Ga0496115_0001170 | 3300048918 | Bacteria | 18807 |
| 578 | Ga0496115_0018278 | 3300048918 | Bacteria | 5379 |
| 579 | Ga0496115_0264211 | 3300048918 | Bacteria | 1415 |
| 580 | Ga0496115_0275362 | 3300048918 | Bacteria | 1382 |
| 581 | Ga0496119_0000104 | 3300048922 | Bacteria | 121325 |
| 582 | Ga0496120_0005467 | 3300048923 | Bacteria | 10127 |
| 583 | Ga0501031_0015220 | 3300049568 | Bacteria | 4995 |
| 584 | Ga0501031_0062971 | 3300049568 | Bacteria | 2417 |
| 585 | Ga0501031_0392452 | 3300049568 | Bacteria | 898 |
| 586 | Ga0501032_0075124 | 3300049569 | Bacteria | 2251 |
| 587 | Ga0501033_0001922 | 3300049570 | Bacteria | 18091 |
| 588 | Ga0501034_0018756 | 3300049571 | Bacteria | 7090 |
| 589 | Ga0501034_0085044 | 3300049571 | Bacteria | 3165 |
| 590 | Ga0501034_0180748 | 3300049571 | Bacteria | 2074 |
| 591 | Ga0501036_0015244 | 3300049572 | Bacteria | 6418 |
| 592 | Ga0501036_0132273 | 3300049572 | Bacteria | 2106 |
| 593 | Ga0501036_0480201 | 3300049572 | Bacteria | 1035 |
| 594 | Ga0501038_0005918 | 3300049574 | Bacteria | 11303 |
| 595 | Ga0501038_0268816 | 3300049574 | Bacteria | 1345 |
| 596 | Ga0501038_0562591 | 3300049574 | Bacteria | 866 |
| 597 | Ga0501039_0040907 | 3300049575 | Bacteria | 3578 |
| 598 | Ga0501039_0121897 | 3300049575 | Bacteria | 2044 |
| 599 | Ga0501039_0138563 | 3300049575 | Bacteria | 1911 |
| 600 | Ga0501039_0170345 | 3300049575 | Bacteria | 1712 |
| 601 | Ga0501039_0212082 | 3300049575 | Bacteria | 1523 |
| 602 | Ga0501039_0252390 | 3300049575 | Bacteria | 1387 |
| 603 | Ga0501040_0079656 | 3300049576 | Bacteria | 2268 |
| 604 | Ga0501040_0098835 | 3300049576 | Bacteria | 2034 |
| 605 | Ga0501042_0018167 | 3300049578 | Bacteria | 4866 |
| 606 | Ga0501042_0057247 | 3300049578 | Bacteria | 2782 |
| 607 | Ga0501042_0095761 | 3300049578 | Bacteria | 2133 |
| 608 | Ga0501043_0006006 | 3300049579 | Bacteria | 9764 |
| 609 | Ga0501043_0045801 | 3300049579 | Bacteria | 3439 |
| 610 | Ga0501043_0251777 | 3300049579 | Bacteria | 1360 |
| 611 | Ga0501043_0484381 | 3300049579 | Bacteria | 926 |
| 612 | Ga0501046_0000633 | 3300049580 | Bacteria | 34519 |
| 613 | Ga0501046_0020040 | 3300049580 | Bacteria | 5537 |
| 614 | Ga0501047_0234615 | 3300049581 | Bacteria | 1686 |
| 615 | Ga0501047_0629933 | 3300049581 | Bacteria | 893 |
| 616 | Ga0501048_0021335 | 3300049582 | Bacteria | 4741 |
| 617 | Ga0501048_0063280 | 3300049582 | Bacteria | 2617 |
| 618 | Ga0501048_0349230 | 3300049582 | Bacteria | 1055 |
| 619 | Ga0501048_0375680 | 3300049582 | Bacteria | 1015 |
| 620 | Ga0501048_0576193 | 3300049582 | Bacteria | 808 |
| 621 | Ga0501067_0012114 | 3300049583 | Bacteria | 4781 |
| 622 | Ga0501067_0117417 | 3300049583 | Bacteria | 1479 |
| 623 | Ga0501068_0051744 | 3300049584 | Bacteria | 2485 |
| 624 | Ga0501068_0141420 | 3300049584 | Bacteria | 1509 |
| 625 | Ga0501069_0005208 | 3300049585 | Bacteria | 6761 |
| 626 | Ga0501069_0043323 | 3300049585 | Bacteria | 2491 |
| 627 | Ga0501069_0106759 | 3300049585 | Bacteria | 1592 |
| 628 | Ga0501069_0265888 | 3300049585 | Bacteria | 1002 |
| 629 | Ga0501070_0030673 | 3300049586 | Bacteria | 4504 |
| 630 | Ga0501070_0046658 | 3300049586 | Bacteria | 3602 |
| 631 | Ga0501070_0063609 | 3300049586 | Bacteria | 3056 |
| 632 | Ga0501070_0074887 | 3300049586 | Bacteria | 2802 |
| 633 | Ga0501070_0075161 | 3300049586 | Bacteria | 2796 |
| 634 | Ga0501070_0248511 | 3300049586 | Bacteria | 1455 |
| 635 | Ga0501070_0328614 | 3300049586 | Bacteria | 1243 |
| 636 | Ga0501070_0339743 | 3300049586 | Bacteria | 1220 |
| 637 | Ga0501070_0525340 | 3300049586 | Bacteria | 949 |
| 638 | Ga0501070_0909123 | 3300049586 | Bacteria | 686 |
| 639 | Ga0501071_0005496 | 3300049587 | Bacteria | 8154 |
| 640 | Ga0501071_0030203 | 3300049587 | Bacteria | 3832 |
| 641 | Ga0501071_0060675 | 3300049587 | Bacteria | 2738 |
| 642 | Ga0501071_0265008 | 3300049587 | Bacteria | 1298 |
| 643 | Ga0501071_0310804 | 3300049587 | Bacteria | 1196 |
| 644 | Ga0501072_0011083 | 3300049588 | Bacteria | 6879 |
| 645 | Ga0501073_0032743 | 3300049589 | Bacteria | 3705 |
| 646 | Ga0501073_0113022 | 3300049589 | Bacteria | 1883 |
| 647 | Ga0501073_0210246 | 3300049589 | Bacteria | 1344 |
| 648 | Ga0501074_0073098 | 3300049590 | Bacteria | 2463 |
| 649 | Ga0501074_0125153 | 3300049590 | Bacteria | 1838 |
| 650 | Ga0501074_0293894 | 3300049590 | Bacteria | 1154 |
| 651 | Ga0501074_0430433 | 3300049590 | Bacteria | 936 |
| 652 | Ga0501075_0247680 | 3300049591 | Bacteria | 1358 |
| 653 | Ga0501079_0076481 | 3300049741 | Bacteria | 2589 |
| 654 | Ga0501079_0308937 | 3300049741 | Bacteria | 1237 |
| 655 | Ga0501079_0398283 | 3300049741 | Bacteria | 1080 |
| 656 | Ga0501080_0006057 | 3300049742 | Bacteria | 10841 |
| 657 | Ga0501080_0070239 | 3300049742 | Bacteria | 3257 |
| 658 | Ga0501080_0182781 | 3300049742 | Bacteria | 1929 |
| 659 | Ga0501080_0335595 | 3300049742 | Bacteria | 1366 |
| 660 | Ga0501081_0310541 | 3300049743 | Bacteria | 1158 |
| 661 | Ga0501083_0252621 | 3300049744 | Bacteria | 1147 |
| 662 | Ga0501083_0370333 | 3300049744 | Bacteria | 932 |
| 663 | Ga0501044_0011939 | 3300049823 | Bacteria | 9414 |
| 664 | Ga0501044_0187060 | 3300049823 | Bacteria | 2035 |
| 665 | Ga0501045_0117317 | 3300049824 | Bacteria | 1976 |
| 666 | Ga0501045_0449536 | 3300049824 | Bacteria | 958 |
| 667 | nmdc:mga03683_179737_c1 | 3300050489 | Bacteria | 965 |
| 668 | nmdc:mga03n38_1274_c1 | 3300050490 | Bacteria | 7089 |
| 669 | nmdc:mga00v17_19640_c1 | 3300050491 | Bacteria | 3862 |
| 670 | nmdc:mga00v17_243217_c1 | 3300050491 | Bacteria | 1167 |
| 671 | nmdc:mga00v17_2605_c1 | 3300050491 | Bacteria | 9247 |
| 672 | nmdc:mga00v17_393393_c1 | 3300050491 | Bacteria | 901 |
| 673 | nmdc:mga00v17_60527_c1 | 3300050491 | Bacteria | 2326 |
| 674 | nmdc:mga00v17_65549_c1 | 3300050491 | Bacteria | 1689 |
| 675 | nmdc:mga0yw44_119577_c1 | 3300050492 | Bacteria | 1696 |
| 676 | nmdc:mga0yw44_167598_c1 | 3300050492 | Bacteria | 1441 |
| 677 | nmdc:mga0yw44_1903_c1 | 3300050492 | Bacteria | 8611 |
| 678 | nmdc:mga0yw44_20892_c1 | 3300050492 | Bacteria | 3643 |
| 679 | nmdc:mga0yw44_228022_c1 | 3300050492 | Bacteria | 1236 |
| 680 | nmdc:mga0yw44_230278_c2 | 3300050492 | Bacteria | 768 |
| 681 | nmdc:mga0yw44_29800_c1 | 3300050492 | Bacteria | 3155 |
| 682 | nmdc:mga0yw44_417933_c1 | 3300050492 | Bacteria | 908 |
| 683 | nmdc:mga0yw44_50103_c1 | 3300050492 | Bacteria | 2524 |
| 684 | nmdc:mga0yw44_65071_c1 | 3300050492 | Bacteria | 2246 |
| 685 | nmdc:mga06z11_13579_c1 | 3300050494 | Bacteria | 3582 |
| 686 | nmdc:mga06z11_265827_c1 | 3300050494 | Bacteria | 1013 |
| 687 | nmdc:mga06z11_371447_c1 | 3300050494 | Bacteria | 858 |
| 688 | nmdc:mga06z11_523129_c1 | 3300050494 | Bacteria | 719 |
| 689 | nmdc:mga06z11_70175_c1 | 3300050494 | Bacteria | 1852 |
| 690 | nmdc:mga04h51_11830_c1 | 3300050495 | Bacteria | 2433 |
| 691 | nmdc:mga04h51_39291_c1 | 3300050495 | Bacteria | 1537 |
| 692 | nmdc:mga07m45_73681_c1 | 3300050496 | Bacteria | 1944 |
| 693 | nmdc:mga07m45_85565_c1 | 3300050496 | Bacteria | 1803 |
| 694 | nmdc:mga07m45_9631_c1 | 3300050496 | Bacteria | 5021 |
| 695 | nmdc:mga05p37_220164_c1 | 3300050507 | Bacteria | 2291 |
| 696 | nmdc:mga08y16_29745_c1 | 3300050511 | Bacteria | 5751 |
| 697 | nmdc:mga08y16_496685_c1 | 3300050511 | Bacteria | 1240 |
| 698 | nmdc:mga08x19_117537_c1 | 3300050514 | Bacteria | 1779 |
| 699 | nmdc:mga0a205_83665_c1 | 3300050515 | Bacteria | 2035 |
| 700 | Ga0495601_0317901 | 3300053077 | Bacteria | 1014 |
| 701 | Ga0495595_0078290 | 3300053084 | Bacteria | 1572 |
| 702 | Ga0495595_0112457 | 3300053084 | Bacteria | 1321 |
| 703 | Ga0495619_0005036 | 3300053085 | Bacteria | 8391 |
| 704 | Ga0495619_0415006 | 3300053085 | Bacteria | 929 |
| 705 | Ga0500644_0000678 | 3300053088 | Bacteria | 12375 |
| 706 | Ga0500573_0101552 | 3300053140 | Bacteria | 1618 |
| 707 | Ga0500573_0173864 | 3300053140 | Bacteria | 1162 |
| 708 | Ga0500620_041692 | 3300053155 | Bacteria | 1509 |
| 709 | Ga0501084_0075926 | 3300054114 | Bacteria | 2816 |
| 710 | Ga0501084_0253839 | 3300054114 | Bacteria | 1484 |
| 711 | Ga0501084_0530923 | 3300054114 | Bacteria | 995 |
| 712 | Ga0590075_109851 | 3300059424 | Bacteria | 720 |
| 713 | Ga0590077_026068 | 3300059426 | Bacteria | 1262 |
| 714 | Ga0501082_0009085 | 3300060353 | Bacteria | 8574 |
| 715 | Ga0501082_0435360 | 3300060353 | Bacteria | 1145 |
| 716 | Ga0501082_0863155 | 3300060353 | Bacteria | 792 |
| 717 | Ga0466962_0139255 | 3300061719 | Bacteria | 1175 |
| 718 | Ga0530510_0145546 | 3300061734 | Bacteria | 1748 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300038443 | Ga0395901_0084177 | Ga0395901_0084177_2310_2951 | 187 |
| 2 | 3300009177 | Ga0105248_10227251 | Ga0105248_102272512 | 188 |
| 3 | 3300025904 | Ga0207647_10202195 | Ga0207647_102021952 | 189 |
| 4 | 3300049590 | Ga0501074_0430433 | Ga0501074_0430433_14_595 | 189 |
| 5 | 3300006038 | Ga0075365_10025922 | Ga0075365_100259224 | 191 |
| 6 | 3300050492 | nmdc:mga0yw44_20892_c1 | nmdc:mga0yw44_20892_c1_2433_3128 | 191 |
| 7 | 3300045976 | Ga0466967_0434117 | Ga0466967_0434117_607_1245 | 193 |
| 8 | 3300048917 | Ga0496114_0018030 | Ga0496114_0018030_2621_3274 | 193 |
| 9 | 3300035398 | Ga0316574_0352021 | Ga0316574_0352021_215_859 | 195 |
| 10 | 3300045976 | Ga0466967_0026519 | Ga0466967_0026519_803_1456 | 196 |
| 11 | 3300044694 | Ga0466963_0201424 | Ga0466963_0201424_315_1004 | 197 |
| 12 | 3300053088 | Ga0500644_0000678 | Ga0500644_0000678_24_632 | 197 |
| 13 | 3300048909 | Ga0496106_0171225 | Ga0496106_0171225_14_625 | 198 |
| 14 | 3300050494 | nmdc:mga06z11_265827_c1 | nmdc:mga06z11_265827_c1_291_926 | 198 |
| 15 | 3300054114 | Ga0501084_0530923 | Ga0501084_0530923_13_627 | 198 |
| 16 | 3300005471 | Ga0070698_100000363 | Ga0070698_10000036316 | 200 |
| 17 | 3300041405 | Ga0439438_020715 | Ga0439438_020715_981_1610 | 200 |
| 18 | 3300042004 | Ga0439445_0038825 | Ga0439445_0038825_195_824 | 200 |
| 19 | 3300042435 | Ga0439434_0003200 | Ga0439434_0003200_2462_3091 | 200 |
| 20 | 3300048911 | Ga0496108_0129466 | Ga0496108_0129466_1156_1806 | 200 |
| 21 | 3300049582 | Ga0501048_0576193 | Ga0501048_0576193_60_689 | 200 |
| 22 | 3300049587 | Ga0501071_0030203 | Ga0501071_0030203_3090_3719 | 200 |
| 23 | 3300049824 | Ga0501045_0117317 | Ga0501045_0117317_347_976 | 200 |
| 24 | 3300060353 | Ga0501082_0435360 | Ga0501082_0435360_96_725 | 200 |
| 25 | iso_pu_bacteria | 2643221561 | 2643824120 | 202 |
| 26 | iso_pu_bacteria | 2643221696 | 2644533426 | 202 |
| 27 | 3300005329 | Ga0070683_100096868 | Ga0070683_1000968682 | 203 |
| 28 | 3300009545 | Ga0105237_10193530 | Ga0105237_101935303 | 203 |
| 29 | 3300020082 | Ga0206353_11521123 | Ga0206353_115211235 | 203 |
| 30 | 3300025914 | Ga0207671_10128858 | Ga0207671_101288581 | 203 |
| 31 | 3300025944 | Ga0207661_10097305 | Ga0207661_100973052 | 203 |
| 32 | 3300049586 | Ga0501070_0030673 | Ga0501070_0030673_718_1359 | 203 |
| 33 | 3300049586 | Ga0501070_0063609 | Ga0501070_0063609_26_667 | 203 |
| 34 | 3300049586 | Ga0501070_0328614 | Ga0501070_0328614_202_843 | 203 |
| 35 | iso_pu_bacteria | 2773857762 | 2774394499 | 203 |
| 36 | iso_pu_bacteria | 2808606439 | 2809194647 | 203 |
| 37 | iso_pu_bacteria | 2811994878 | 2812349388 | 203 |
| 38 | iso_pu_bacteria | 2891968417 | 2891972900 | 203 |
| 39 | 3300025904 | Ga0207647_10067410 | Ga0207647_100674103 | 204 |
| 40 | 3300049568 | Ga0501031_0015220 | Ga0501031_0015220_3485_4117 | 204 |
| 41 | 3300049570 | Ga0501033_0001922 | Ga0501033_0001922_10417_11052 | 204 |
| 42 | 3300049571 | Ga0501034_0180748 | Ga0501034_0180748_516_1148 | 204 |
| 43 | 3300049572 | Ga0501036_0015244 | Ga0501036_0015244_2147_2779 | 204 |
| 44 | 3300049575 | Ga0501039_0040907 | Ga0501039_0040907_1110_1742 | 204 |
| 45 | 3300049578 | Ga0501042_0018167 | Ga0501042_0018167_2688_3320 | 204 |
| 46 | 3300049579 | Ga0501043_0006006 | Ga0501043_0006006_3375_4007 | 204 |
| 47 | 3300049579 | Ga0501043_0045801 | Ga0501043_0045801_1933_2568 | 204 |
| 48 | 3300049580 | Ga0501046_0000633 | Ga0501046_0000633_14206_14841 | 204 |
| 49 | 3300049580 | Ga0501046_0020040 | Ga0501046_0020040_4063_4695 | 204 |
| 50 | 3300049581 | Ga0501047_0629933 | Ga0501047_0629933_43_678 | 204 |
| 51 | 3300049582 | Ga0501048_0021335 | Ga0501048_0021335_3035_3667 | 204 |
| 52 | 3300049586 | Ga0501070_0248511 | Ga0501070_0248511_745_1377 | 204 |
| 53 | 3300049586 | Ga0501070_0909123 | Ga0501070_0909123_23_664 | 204 |
| 54 | 3300049589 | Ga0501073_0032743 | Ga0501073_0032743_2692_3324 | 204 |
| 55 | 3300049742 | Ga0501080_0006057 | Ga0501080_0006057_6343_6975 | 204 |
| 56 | 3300050492 | nmdc:mga0yw44_65071_c1 | nmdc:mga0yw44_65071_c1_1312_1950 | 204 |
| 57 | 3300005337 | Ga0070682_100293176 | Ga0070682_1002931761 | 205 |
| 58 | 3300005354 | Ga0070675_100263189 | Ga0070675_1002631892 | 205 |
| 59 | 3300005366 | Ga0070659_100338641 | Ga0070659_1003386412 | 205 |
| 60 | 3300005438 | Ga0070701_10185773 | Ga0070701_101857732 | 205 |
| 61 | 3300005548 | Ga0070665_100366668 | Ga0070665_1003666681 | 205 |
| 62 | 3300005719 | Ga0068861_100561646 | Ga0068861_1005616462 | 205 |
| 63 | 3300005840 | Ga0068870_10239403 | Ga0068870_102394032 | 205 |
| 64 | 3300009551 | Ga0105238_10104253 | Ga0105238_101042533 | 205 |
| 65 | 3300013308 | Ga0157375_10008143 | Ga0157375_100081433 | 205 |
| 66 | 3300014326 | Ga0157380_10257426 | Ga0157380_102574263 | 205 |
| 67 | 3300017792 | Ga0163161_10009496 | Ga0163161_100094963 | 205 |
| 68 | 3300025901 | Ga0207688_10123391 | Ga0207688_101233912 | 205 |
| 69 | 3300025945 | Ga0207679_10094241 | Ga0207679_100942411 | 205 |
| 70 | 3300026118 | Ga0207675_100197651 | Ga0207675_1001976513 | 205 |
| 71 | 3300026142 | Ga0207698_10182676 | Ga0207698_101826762 | 205 |
| 72 | 3300030733 | Ga0314311_1124506 | Ga0314311_11245062 | 205 |
| 73 | 3300031548 | Ga0307408_100503294 | Ga0307408_1005032942 | 205 |
| 74 | 3300031852 | Ga0307410_10299767 | Ga0307410_102997672 | 205 |
| 75 | 3300031995 | Ga0307409_100071034 | Ga0307409_1000710343 | 205 |
| 76 | 3300032002 | Ga0307416_100302006 | Ga0307416_1003020062 | 205 |
| 77 | 3300032002 | Ga0307416_100833295 | Ga0307416_1008332952 | 205 |
| 78 | 3300037471 | Ga0395905_0021832 | Ga0395905_0021832_5224_5868 | 205 |
| 79 | 3300041512 | Ga0451853_4119957 | Ga0451853_4119957_550_1212 | 205 |
| 80 | 3300044658 | Ga0466972_0062815 | Ga0466972_0062815_859_1497 | 205 |
| 81 | 3300044693 | Ga0466961_0108550 | Ga0466961_0108550_1086_1724 | 205 |
| 82 | 3300044765 | Ga0466970_0027086 | Ga0466970_0027086_441_1079 | 205 |
| 83 | 3300044765 | Ga0466970_0039692 | Ga0466970_0039692_379_1017 | 205 |
| 84 | 3300044901 | Ga0466960_0075534 | Ga0466960_0075534_285_923 | 205 |
| 85 | 3300045976 | Ga0466967_0385555 | Ga0466967_0385555_592_1230 | 205 |
| 86 | 3300048917 | Ga0496114_0350137 | Ga0496114_0350137_166_828 | 205 |
| 87 | 3300049569 | Ga0501032_0075124 | Ga0501032_0075124_1539_2183 | 205 |
| 88 | 3300049571 | Ga0501034_0018756 | Ga0501034_0018756_187_831 | 205 |
| 89 | 3300049574 | Ga0501038_0005918 | Ga0501038_0005918_5053_5697 | 205 |
| 90 | 3300049578 | Ga0501042_0057247 | Ga0501042_0057247_76_720 | 205 |
| 91 | 3300049579 | Ga0501043_0251777 | Ga0501043_0251777_644_1288 | 205 |
| 92 | 3300049581 | Ga0501047_0234615 | Ga0501047_0234615_660_1304 | 205 |
| 93 | 3300049584 | Ga0501068_0051744 | Ga0501068_0051744_1303_1965 | 205 |
| 94 | 3300049823 | Ga0501044_0011939 | Ga0501044_0011939_2670_3314 | 205 |
| 95 | 3300049824 | Ga0501045_0449536 | Ga0501045_0449536_229_873 | 205 |
| 96 | 3300005337 | Ga0070682_100398046 | Ga0070682_1003980462 | 206 |
| 97 | 3300005367 | Ga0070667_100007583 | Ga0070667_1000075836 | 206 |
| 98 | 3300005563 | Ga0068855_100113651 | Ga0068855_1001136512 | 206 |
| 99 | 3300005563 | Ga0068855_100276624 | Ga0068855_1002766243 | 206 |
| 100 | 3300005614 | Ga0068856_100841420 | Ga0068856_1008414202 | 206 |
| 101 | 3300005616 | Ga0068852_101138780 | Ga0068852_1011387801 | 206 |
| 102 | 3300006038 | Ga0075365_10275209 | Ga0075365_102752092 | 206 |
| 103 | 3300006051 | Ga0075364_10089036 | Ga0075364_100890362 | 206 |
| 104 | 3300006844 | Ga0075428_100965489 | Ga0075428_1009654891 | 206 |
| 105 | 3300006881 | Ga0068865_100856564 | Ga0068865_1008565642 | 206 |
| 106 | 3300009093 | Ga0105240_10010898 | Ga0105240_1001089812 | 206 |
| 107 | 3300009148 | Ga0105243_10439882 | Ga0105243_104398822 | 206 |
| 108 | 3300009545 | Ga0105237_10015753 | Ga0105237_100157536 | 206 |
| 109 | 3300009545 | Ga0105237_11041106 | Ga0105237_110411061 | 206 |
| 110 | 3300010375 | Ga0105239_10026655 | Ga0105239_100266553 | 206 |
| 111 | 3300010375 | Ga0105239_10728758 | Ga0105239_107287582 | 206 |
| 112 | 3300012510 | Ga0157316_1017087 | Ga0157316_10170871 | 206 |
| 113 | 3300013105 | Ga0157369_10661706 | Ga0157369_106617062 | 206 |
| 114 | 3300013307 | Ga0157372_10752040 | Ga0157372_107520402 | 206 |
| 115 | 3300013308 | Ga0157375_10154397 | Ga0157375_101543972 | 206 |
| 116 | 3300014969 | Ga0157376_10349216 | Ga0157376_103492163 | 206 |
| 117 | 3300021384 | Ga0213876_10081593 | Ga0213876_100815932 | 206 |
| 118 | 3300025904 | Ga0207647_10063353 | Ga0207647_100633532 | 206 |
| 119 | 3300025913 | Ga0207695_10025646 | Ga0207695_100256464 | 206 |
| 120 | 3300025913 | Ga0207695_10341210 | Ga0207695_103412102 | 206 |
| 121 | 3300025914 | Ga0207671_10025439 | Ga0207671_100254392 | 206 |
| 122 | 3300025917 | Ga0207660_10653575 | Ga0207660_106535751 | 206 |
| 123 | 3300025918 | Ga0207662_10144930 | Ga0207662_101449301 | 206 |
| 124 | 3300025949 | Ga0207667_10249536 | Ga0207667_102495362 | 206 |
| 125 | 3300025949 | Ga0207667_10304779 | Ga0207667_103047791 | 206 |
| 126 | 3300025986 | Ga0207658_10009016 | Ga0207658_100090163 | 206 |
| 127 | 3300026121 | Ga0207683_10094315 | Ga0207683_100943152 | 206 |
| 128 | 3300028379 | Ga0268266_10276895 | Ga0268266_102768951 | 206 |
| 129 | 3300031824 | Ga0307413_10295835 | Ga0307413_102958352 | 206 |
| 130 | 3300031852 | Ga0307410_10525675 | Ga0307410_105256752 | 206 |
| 131 | 3300031995 | Ga0307409_100257482 | Ga0307409_1002574822 | 206 |
| 132 | 3300031995 | Ga0307409_101194215 | Ga0307409_1011942151 | 206 |
| 133 | 3300037471 | Ga0395905_0405804 | Ga0395905_0405804_313_963 | 206 |
| 134 | 3300039437 | Ga0436365_0005613 | Ga0436365_0005613_618_1262 | 206 |
| 135 | 3300044658 | Ga0466972_0009367 | Ga0466972_0009367_54_689 | 206 |
| 136 | 3300044658 | Ga0466972_0064381 | Ga0466972_0064381_194_838 | 206 |
| 137 | 3300044683 | Ga0466965_0374484 | Ga0466965_0374484_28_672 | 206 |
| 138 | 3300044684 | Ga0466966_0008820 | Ga0466966_0008820_4618_5253 | 206 |
| 139 | 3300044684 | Ga0466966_0009895 | Ga0466966_0009895_3196_3831 | 206 |
| 140 | 3300044684 | Ga0466966_0027302 | Ga0466966_0027302_610_1245 | 206 |
| 141 | 3300044684 | Ga0466966_0121636 | Ga0466966_0121636_588_1226 | 206 |
| 142 | 3300044684 | Ga0466966_0466367 | Ga0466966_0466367_110_745 | 206 |
| 143 | 3300044693 | Ga0466961_0005682 | Ga0466961_0005682_3976_4611 | 206 |
| 144 | 3300044693 | Ga0466961_0012524 | Ga0466961_0012524_3812_4447 | 206 |
| 145 | 3300044693 | Ga0466961_0078603 | Ga0466961_0078603_706_1341 | 206 |
| 146 | 3300044693 | Ga0466961_0080179 | Ga0466961_0080179_1033_1668 | 206 |
| 147 | 3300044693 | Ga0466961_0378045 | Ga0466961_0378045_128_769 | 206 |
| 148 | 3300044694 | Ga0466963_0021922 | Ga0466963_0021922_3224_3859 | 206 |
| 149 | 3300044694 | Ga0466963_0239434 | Ga0466963_0239434_600_1247 | 206 |
| 150 | 3300044706 | Ga0466964_0043570 | Ga0466964_0043570_509_1144 | 206 |
| 151 | 3300044719 | Ga0466971_0139750 | Ga0466971_0139750_180_815 | 206 |
| 152 | 3300044735 | Ga0466968_0020207 | Ga0466968_0020207_700_1335 | 206 |
| 153 | 3300044765 | Ga0466970_0007594 | Ga0466970_0007594_3681_4319 | 206 |
| 154 | 3300044765 | Ga0466970_0191582 | Ga0466970_0191582_471_1109 | 206 |
| 155 | 3300044765 | Ga0466970_0324227 | Ga0466970_0324227_49_684 | 206 |
| 156 | 3300044842 | Ga0466957_0067043 | Ga0466957_0067043_666_1298 | 206 |
| 157 | 3300044901 | Ga0466960_0055071 | Ga0466960_0055071_233_868 | 206 |
| 158 | 3300045049 | Ga0466959_0009269 | Ga0466959_0009269_2898_3533 | 206 |
| 159 | 3300045049 | Ga0466959_0010923 | Ga0466959_0010923_3764_4399 | 206 |
| 160 | 3300045049 | Ga0466959_0052515 | Ga0466959_0052515_1850_2485 | 206 |
| 161 | 3300045049 | Ga0466959_0286977 | Ga0466959_0286977_355_993 | 206 |
| 162 | 3300045049 | Ga0466959_0288228 | Ga0466959_0288228_394_1032 | 206 |
| 163 | 3300045049 | Ga0466959_0324629 | Ga0466959_0324629_308_943 | 206 |
| 164 | 3300045049 | Ga0466959_0469566 | Ga0466959_0469566_143_784 | 206 |
| 165 | 3300045836 | Ga0466958_0025759 | Ga0466958_0025759_2656_3291 | 206 |
| 166 | 3300045836 | Ga0466958_0346969 | Ga0466958_0346969_284_919 | 206 |
| 167 | 3300045976 | Ga0466967_0006336 | Ga0466967_0006336_7284_7919 | 206 |
| 168 | 3300045976 | Ga0466967_0082642 | Ga0466967_0082642_2042_2674 | 206 |
| 169 | 3300045976 | Ga0466967_0219638 | Ga0466967_0219638_412_1044 | 206 |
| 170 | 3300045976 | Ga0466967_0276146 | Ga0466967_0276146_228_863 | 206 |
| 171 | 3300046524 | Ga0495648_0021804 | Ga0495648_0021804_723_1361 | 206 |
| 172 | 3300046663 | Ga0495635_0348638 | Ga0495635_0348638_303_938 | 206 |
| 173 | 3300046663 | Ga0495635_0492966 | Ga0495635_0492966_75_722 | 206 |
| 174 | 3300046675 | Ga0495657_0107759 | Ga0495657_0107759_131_778 | 206 |
| 175 | 3300047322 | Ga0495680_0106793 | Ga0495680_0106793_1114_1761 | 206 |
| 176 | 3300048903 | Ga0496100_0215927 | Ga0496100_0215927_714_1352 | 206 |
| 177 | 3300048905 | Ga0496102_0149808 | Ga0496102_0149808_918_1565 | 206 |
| 178 | 3300048905 | Ga0496102_0506586 | Ga0496102_0506586_354_998 | 206 |
| 179 | 3300048905 | Ga0496102_0626871 | Ga0496102_0626871_339_977 | 206 |
| 180 | 3300048907 | Ga0496104_0004891 | Ga0496104_0004891_9094_9741 | 206 |
| 181 | 3300048907 | Ga0496104_0280978 | Ga0496104_0280978_365_1003 | 206 |
| 182 | 3300048908 | Ga0496105_0016582 | Ga0496105_0016582_1475_2122 | 206 |
| 183 | 3300048908 | Ga0496105_0149894 | Ga0496105_0149894_516_1154 | 206 |
| 184 | 3300048909 | Ga0496106_0063822 | Ga0496106_0063822_965_1612 | 206 |
| 185 | 3300048910 | Ga0496107_0010995 | Ga0496107_0010995_5171_5818 | 206 |
| 186 | 3300048910 | Ga0496107_0216495 | Ga0496107_0216495_502_1149 | 206 |
| 187 | 3300048911 | Ga0496108_0034934 | Ga0496108_0034934_19_666 | 206 |
| 188 | 3300048912 | Ga0496109_0009876 | Ga0496109_0009876_3921_4568 | 206 |
| 189 | 3300048912 | Ga0496109_0051661 | Ga0496109_0051661_2699_3346 | 206 |
| 190 | 3300048912 | Ga0496109_0069632 | Ga0496109_0069632_1338_1976 | 206 |
| 191 | 3300048912 | Ga0496109_0153136 | Ga0496109_0153136_550_1197 | 206 |
| 192 | 3300048913 | Ga0496110_0177292 | Ga0496110_0177292_728_1375 | 206 |
| 193 | 3300048914 | Ga0496111_0088925 | Ga0496111_0088925_216_863 | 206 |
| 194 | 3300048916 | Ga0496113_0062276 | Ga0496113_0062276_1746_2393 | 206 |
| 195 | 3300048916 | Ga0496113_0077007 | Ga0496113_0077007_1817_2464 | 206 |
| 196 | 3300048916 | Ga0496113_0168130 | Ga0496113_0168130_1071_1718 | 206 |
| 197 | 3300048917 | Ga0496114_0020867 | Ga0496114_0020867_327_971 | 206 |
| 198 | 3300048917 | Ga0496114_0027407 | Ga0496114_0027407_2635_3279 | 206 |
| 199 | 3300048917 | Ga0496114_0052772 | Ga0496114_0052772_656_1303 | 206 |
| 200 | 3300048917 | Ga0496114_0376250 | Ga0496114_0376250_251_889 | 206 |
| 201 | 3300048917 | Ga0496114_0453728 | Ga0496114_0453728_344_988 | 206 |
| 202 | 3300048918 | Ga0496115_0001170 | Ga0496115_0001170_3309_3956 | 206 |
| 203 | 3300048918 | Ga0496115_0018278 | Ga0496115_0018278_2188_2832 | 206 |
| 204 | 3300049571 | Ga0501034_0085044 | Ga0501034_0085044_601_1251 | 206 |
| 205 | 3300049574 | Ga0501038_0268816 | Ga0501038_0268816_42_680 | 206 |
| 206 | 3300049582 | Ga0501048_0375680 | Ga0501048_0375680_18_656 | 206 |
| 207 | 3300049585 | Ga0501069_0265888 | Ga0501069_0265888_299_949 | 206 |
| 208 | 3300049586 | Ga0501070_0074887 | Ga0501070_0074887_1153_1803 | 206 |
| 209 | 3300049586 | Ga0501070_0339743 | Ga0501070_0339743_94_732 | 206 |
| 210 | 3300049742 | Ga0501080_0070239 | Ga0501080_0070239_628_1278 | 206 |
| 211 | 3300049742 | Ga0501080_0182781 | Ga0501080_0182781_1272_1910 | 206 |
| 212 | 3300049744 | Ga0501083_0370333 | Ga0501083_0370333_267_917 | 206 |
| 213 | 3300049823 | Ga0501044_0187060 | Ga0501044_0187060_1016_1654 | 206 |
| 214 | 3300050491 | nmdc:mga00v17_243217_c1 | nmdc:mga00v17_243217_c1_33_683 | 206 |
| 215 | 3300050492 | nmdc:mga0yw44_119577_c1 | nmdc:mga0yw44_119577_c1_948_1586 | 206 |
| 216 | 3300050492 | nmdc:mga0yw44_1903_c1 | nmdc:mga0yw44_1903_c1_4118_4768 | 206 |
| 217 | 3300053077 | Ga0495601_0317901 | Ga0495601_0317901_135_782 | 206 |
| 218 | 3300053084 | Ga0495595_0078290 | Ga0495595_0078290_128_763 | 206 |
| 219 | 3300053084 | Ga0495595_0112457 | Ga0495595_0112457_271_918 | 206 |
| 220 | 3300053085 | Ga0495619_0005036 | Ga0495619_0005036_7300_7947 | 206 |
| 221 | 3300053085 | Ga0495619_0415006 | Ga0495619_0415006_192_827 | 206 |
| 222 | iso_pu_bacteria | 2675903058 | 2676473601 | 206 |
| 223 | iso_pu_bacteria | 2827628540 | 2827632114 | 206 |
| 224 | 3300005455 | Ga0070663_100575854 | Ga0070663_1005758541 | 207 |
| 225 | 3300005458 | Ga0070681_10656618 | Ga0070681_106566182 | 207 |
| 226 | 3300005530 | Ga0070679_100987741 | Ga0070679_1009877411 | 207 |
| 227 | 3300006051 | Ga0075364_10477882 | Ga0075364_104778822 | 207 |
| 228 | 3300025912 | Ga0207707_10278319 | Ga0207707_102783192 | 207 |
| 229 | 3300025944 | Ga0207661_10035436 | Ga0207661_100354362 | 207 |
| 230 | 3300026116 | Ga0207674_10282679 | Ga0207674_102826792 | 207 |
| 231 | 3300041512 | Ga0451853_0786083 | Ga0451853_0786083_201_851 | 207 |
| 232 | 3300044684 | Ga0466966_0082754 | Ga0466966_0082754_67_717 | 207 |
| 233 | 3300044693 | Ga0466961_0030207 | Ga0466961_0030207_21_662 | 207 |
| 234 | 3300044765 | Ga0466970_0009506 | Ga0466970_0009506_220_861 | 207 |
| 235 | 3300044901 | Ga0466960_0337797 | Ga0466960_0337797_159_806 | 207 |
| 236 | 3300045976 | Ga0466967_0000727 | Ga0466967_0000727_5653_6300 | 207 |
| 237 | 3300048917 | Ga0496114_0023003 | Ga0496114_0023003_646_1302 | 207 |
| 238 | 3300049575 | Ga0501039_0138563 | Ga0501039_0138563_894_1550 | 207 |
| 239 | 3300049591 | Ga0501075_0247680 | Ga0501075_0247680_194_850 | 207 |
| 240 | 3300049741 | Ga0501079_0308937 | Ga0501079_0308937_200_856 | 207 |
| 241 | 3300053140 | Ga0500573_0173864 | Ga0500573_0173864_350_1009 | 207 |
| 242 | 3300005329 | Ga0070683_100376421 | Ga0070683_1003764212 | 208 |
| 243 | 3300005548 | Ga0070665_100212342 | Ga0070665_1002123423 | 208 |
| 244 | 3300005983 | Ga0081540_1050807 | Ga0081540_10508074 | 208 |
| 245 | 3300006038 | Ga0075365_10192855 | Ga0075365_101928552 | 208 |
| 246 | 3300006042 | Ga0075368_10018608 | Ga0075368_100186081 | 208 |
| 247 | 3300006048 | Ga0075363_100002765 | Ga0075363_1000027654 | 208 |
| 248 | 3300006051 | Ga0075364_10142496 | Ga0075364_101424962 | 208 |
| 249 | 3300006178 | Ga0075367_10009420 | Ga0075367_100094206 | 208 |
| 250 | 3300009093 | Ga0105240_10103159 | Ga0105240_101031591 | 208 |
| 251 | 3300009553 | Ga0105249_10759378 | Ga0105249_107593782 | 208 |
| 252 | 3300014326 | Ga0157380_11590112 | Ga0157380_115901121 | 208 |
| 253 | 3300020082 | Ga0206353_11743485 | Ga0206353_117434852 | 208 |
| 254 | 3300026116 | Ga0207674_10862854 | Ga0207674_108628542 | 208 |
| 255 | 3300028379 | Ga0268266_10885167 | Ga0268266_108851672 | 208 |
| 256 | 3300031731 | Ga0307405_10379074 | Ga0307405_103790742 | 208 |
| 257 | 3300031824 | Ga0307413_10408564 | Ga0307413_104085642 | 208 |
| 258 | 3300031852 | Ga0307410_10039162 | Ga0307410_100391622 | 208 |
| 259 | 3300031852 | Ga0307410_10308953 | Ga0307410_103089532 | 208 |
| 260 | 3300031901 | Ga0307406_10100755 | Ga0307406_101007553 | 208 |
| 261 | 3300031911 | Ga0307412_10206428 | Ga0307412_102064282 | 208 |
| 262 | 3300031995 | Ga0307409_100339704 | Ga0307409_1003397042 | 208 |
| 263 | 3300032002 | Ga0307416_100030850 | Ga0307416_1000308503 | 208 |
| 264 | 3300032002 | Ga0307416_100418949 | Ga0307416_1004189492 | 208 |
| 265 | 3300032005 | Ga0307411_10086488 | Ga0307411_100864883 | 208 |
| 266 | 3300032126 | Ga0307415_100030331 | Ga0307415_1000303312 | 208 |
| 267 | 3300032126 | Ga0307415_100031405 | Ga0307415_1000314052 | 208 |
| 268 | 3300041512 | Ga0451853_0740919 | Ga0451853_0740919_356_1021 | 208 |
| 269 | 3300044683 | Ga0466965_0005158 | Ga0466965_0005158_1130_1783 | 208 |
| 270 | 3300044683 | Ga0466965_0045897 | Ga0466965_0045897_853_1533 | 208 |
| 271 | 3300044684 | Ga0466966_0016377 | Ga0466966_0016377_4092_4772 | 208 |
| 272 | 3300044694 | Ga0466963_0105852 | Ga0466963_0105852_929_1579 | 208 |
| 273 | 3300044706 | Ga0466964_0005603 | Ga0466964_0005603_3076_3729 | 208 |
| 274 | 3300045976 | Ga0466967_0006597 | Ga0466967_0006597_3055_3705 | 208 |
| 275 | 3300045976 | Ga0466967_0115486 | Ga0466967_0115486_1484_2134 | 208 |
| 276 | 3300045976 | Ga0466967_0671600 | Ga0466967_0671600_77_733 | 208 |
| 277 | 3300048912 | Ga0496109_0052834 | Ga0496109_0052834_535_1179 | 208 |
| 278 | 3300049568 | Ga0501031_0392452 | Ga0501031_0392452_233_883 | 208 |
| 279 | 3300049572 | Ga0501036_0480201 | Ga0501036_0480201_154_852 | 208 |
| 280 | 3300049574 | Ga0501038_0562591 | Ga0501038_0562591_157_822 | 208 |
| 281 | 3300050491 | nmdc:mga00v17_393393_c1 | nmdc:mga00v17_393393_c1_28_696 | 208 |
| 282 | 3300050492 | nmdc:mga0yw44_228022_c1 | nmdc:mga0yw44_228022_c1_555_1214 | 208 |
| 283 | 3300050492 | nmdc:mga0yw44_50103_c1 | nmdc:mga0yw44_50103_c1_18_686 | 208 |
| 284 | 3300050495 | nmdc:mga04h51_11830_c1 | nmdc:mga04h51_11830_c1_99_767 | 208 |
| 285 | 3300050496 | nmdc:mga07m45_73681_c1 | nmdc:mga07m45_73681_c1_274_942 | 208 |
| 286 | 3300061719 | Ga0466962_0139255 | Ga0466962_0139255_150_830 | 208 |
| 287 | iso_pu_bacteria | 2739367898 | 2740167227 | 208 |
| 288 | iso_pu_bacteria | 2857481737 | 2857485783 | 208 |
| 289 | iso_pu_bacteria | 8054609563 | 8054613898 | 208 |
| 290 | 3300005367 | Ga0070667_100065010 | Ga0070667_1000650104 | 209 |
| 291 | 3300005458 | Ga0070681_10260928 | Ga0070681_102609282 | 209 |
| 292 | 3300005530 | Ga0070679_100112171 | Ga0070679_1001121712 | 209 |
| 293 | 3300005577 | Ga0068857_100537716 | Ga0068857_1005377161 | 209 |
| 294 | 3300005843 | Ga0068860_100000304 | Ga0068860_10000030410 | 209 |
| 295 | 3300005985 | Ga0081539_10036418 | Ga0081539_100364183 | 209 |
| 296 | 3300006038 | Ga0075365_10027382 | Ga0075365_100273822 | 209 |
| 297 | 3300006042 | Ga0075368_10019857 | Ga0075368_100198572 | 209 |
| 298 | 3300006048 | Ga0075363_100099949 | Ga0075363_1000999492 | 209 |
| 299 | 3300006051 | Ga0075364_10039261 | Ga0075364_100392612 | 209 |
| 300 | 3300006051 | Ga0075364_10065390 | Ga0075364_100653901 | 209 |
| 301 | 3300006175 | Ga0070712_100568552 | Ga0070712_1005685521 | 209 |
| 302 | 3300006178 | Ga0075367_10030512 | Ga0075367_100305123 | 209 |
| 303 | 3300006353 | Ga0075370_10006935 | Ga0075370_100069354 | 209 |
| 304 | 3300009148 | Ga0105243_10097702 | Ga0105243_100977022 | 209 |
| 305 | 3300009553 | Ga0105249_11689487 | Ga0105249_116894871 | 209 |
| 306 | 3300013297 | Ga0157378_10339060 | Ga0157378_103390602 | 209 |
| 307 | 3300020081 | Ga0206354_10301906 | Ga0206354_103019061 | 209 |
| 308 | 3300020082 | Ga0206353_10122393 | Ga0206353_101223933 | 209 |
| 309 | 3300025898 | Ga0207692_10085843 | Ga0207692_100858432 | 209 |
| 310 | 3300025904 | Ga0207647_10100243 | Ga0207647_101002431 | 209 |
| 311 | 3300025912 | Ga0207707_10261355 | Ga0207707_102613552 | 209 |
| 312 | 3300025942 | Ga0207689_10117355 | Ga0207689_101173553 | 209 |
| 313 | 3300025986 | Ga0207658_10028588 | Ga0207658_100285884 | 209 |
| 314 | 3300026088 | Ga0207641_10557923 | Ga0207641_105579231 | 209 |
| 315 | 3300026116 | Ga0207674_10260536 | Ga0207674_102605362 | 209 |
| 316 | 3300028381 | Ga0268264_10038630 | Ga0268264_100386301 | 209 |
| 317 | 3300037466 | Ga0395898_0172914 | Ga0395898_0172914_711_1379 | 209 |
| 318 | 3300044658 | Ga0466972_0093198 | Ga0466972_0093198_186_863 | 209 |
| 319 | 3300044684 | Ga0466966_0019540 | Ga0466966_0019540_1660_2337 | 209 |
| 320 | 3300044693 | Ga0466961_0268145 | Ga0466961_0268145_197_874 | 209 |
| 321 | 3300044694 | Ga0466963_0010373 | Ga0466963_0010373_1251_1928 | 209 |
| 322 | 3300044706 | Ga0466964_0219482 | Ga0466964_0219482_216_893 | 209 |
| 323 | 3300044719 | Ga0466971_0019657 | Ga0466971_0019657_1291_1968 | 209 |
| 324 | 3300044735 | Ga0466968_0082192 | Ga0466968_0082192_664_1341 | 209 |
| 325 | 3300044842 | Ga0466957_0016712 | Ga0466957_0016712_3074_3751 | 209 |
| 326 | 3300044842 | Ga0466957_0066993 | Ga0466957_0066993_1527_2204 | 209 |
| 327 | 3300044901 | Ga0466960_0000389 | Ga0466960_0000389_7711_8373 | 209 |
| 328 | 3300045049 | Ga0466959_0167677 | Ga0466959_0167677_515_1192 | 209 |
| 329 | 3300045836 | Ga0466958_0097642 | Ga0466958_0097642_934_1611 | 209 |
| 330 | 3300048905 | Ga0496102_0062971 | Ga0496102_0062971_1778_2437 | 209 |
| 331 | 3300048905 | Ga0496102_0399641 | Ga0496102_0399641_265_921 | 209 |
| 332 | 3300048910 | Ga0496107_0518866 | Ga0496107_0518866_43_699 | 209 |
| 333 | 3300048922 | Ga0496119_0000104 | Ga0496119_0000104_98231_98890 | 209 |
| 334 | 3300048923 | Ga0496120_0005467 | Ga0496120_0005467_3640_4299 | 209 |
| 335 | 3300049575 | Ga0501039_0170345 | Ga0501039_0170345_773_1435 | 209 |
| 336 | 3300049578 | Ga0501042_0095761 | Ga0501042_0095761_198_860 | 209 |
| 337 | 3300049582 | Ga0501048_0063280 | Ga0501048_0063280_958_1620 | 209 |
| 338 | 3300049587 | Ga0501071_0060675 | Ga0501071_0060675_930_1592 | 209 |
| 339 | 3300049590 | Ga0501074_0073098 | Ga0501074_0073098_1201_1872 | 209 |
| 340 | 3300049741 | Ga0501079_0398283 | Ga0501079_0398283_263_925 | 209 |
| 341 | 3300050491 | nmdc:mga00v17_60527_c1 | nmdc:mga00v17_60527_c1_1315_1977 | 209 |
| 342 | 3300050492 | nmdc:mga0yw44_167598_c1 | nmdc:mga0yw44_167598_c1_544_1233 | 209 |
| 343 | 3300050492 | nmdc:mga0yw44_29800_c1 | nmdc:mga0yw44_29800_c1_322_990 | 209 |
| 344 | 3300050494 | nmdc:mga06z11_13579_c1 | nmdc:mga06z11_13579_c1_203_871 | 209 |
| 345 | 3300053140 | Ga0500573_0101552 | Ga0500573_0101552_916_1584 | 209 |
| 346 | 3300059424 | Ga0590075_109851 | Ga0590075_109851_68_709 | 209 |
| 347 | 3300061734 | Ga0530510_0145546 | Ga0530510_0145546_379_1041 | 209 |
| 348 | 3300005327 | Ga0070658_10474628 | Ga0070658_104746281 | 210 |
| 349 | 3300005329 | Ga0070683_100009817 | Ga0070683_1000098176 | 210 |
| 350 | 3300005334 | Ga0068869_100176885 | Ga0068869_1001768852 | 210 |
| 351 | 3300005337 | Ga0070682_100002682 | Ga0070682_1000026822 | 210 |
| 352 | 3300005339 | Ga0070660_100161448 | Ga0070660_1001614482 | 210 |
| 353 | 3300005345 | Ga0070692_10025132 | Ga0070692_100251323 | 210 |
| 354 | 3300005366 | Ga0070659_100093200 | Ga0070659_1000932002 | 210 |
| 355 | 3300005367 | Ga0070667_100405868 | Ga0070667_1004058681 | 210 |
| 356 | 3300005456 | Ga0070678_100341965 | Ga0070678_1003419651 | 210 |
| 357 | 3300005530 | Ga0070679_100436345 | Ga0070679_1004363452 | 210 |
| 358 | 3300005548 | Ga0070665_100000450 | Ga0070665_10000045046 | 210 |
| 359 | 3300005563 | Ga0068855_100233922 | Ga0068855_1002339222 | 210 |
| 360 | 3300005564 | Ga0070664_100158709 | Ga0070664_1001587092 | 210 |
| 361 | 3300005577 | Ga0068857_100009886 | Ga0068857_1000098863 | 210 |
| 362 | 3300005614 | Ga0068856_100028796 | Ga0068856_1000287967 | 210 |
| 363 | 3300005842 | Ga0068858_100120615 | Ga0068858_1001206152 | 210 |
| 364 | 3300005843 | Ga0068860_100100284 | Ga0068860_1001002842 | 210 |
| 365 | 3300006038 | Ga0075365_10043487 | Ga0075365_100434872 | 210 |
| 366 | 3300006038 | Ga0075365_10215429 | Ga0075365_102154292 | 210 |
| 367 | 3300006042 | Ga0075368_10003543 | Ga0075368_100035433 | 210 |
| 368 | 3300006048 | Ga0075363_100007893 | Ga0075363_1000078933 | 210 |
| 369 | 3300006177 | Ga0075362_10058501 | Ga0075362_100585012 | 210 |
| 370 | 3300006353 | Ga0075370_10015383 | Ga0075370_100153832 | 210 |
| 371 | 3300006358 | Ga0068871_100072529 | Ga0068871_1000725292 | 210 |
| 372 | 3300006881 | Ga0068865_100464631 | Ga0068865_1004646312 | 210 |
| 373 | 3300009098 | Ga0105245_10000359 | Ga0105245_1000035930 | 210 |
| 374 | 3300009098 | Ga0105245_10623655 | Ga0105245_106236552 | 210 |
| 375 | 3300009545 | Ga0105237_10074076 | Ga0105237_100740762 | 210 |
| 376 | 3300009984 | Ga0105029_103857 | Ga0105029_1038571 | 210 |
| 377 | 3300010375 | Ga0105239_10012785 | Ga0105239_100127853 | 210 |
| 378 | 3300011119 | Ga0105246_10003745 | Ga0105246_100037452 | 210 |
| 379 | 3300013102 | Ga0157371_10121099 | Ga0157371_101210992 | 210 |
| 380 | 3300013105 | Ga0157369_10339687 | Ga0157369_103396872 | 210 |
| 381 | 3300013306 | Ga0163162_10002746 | Ga0163162_100027463 | 210 |
| 382 | 3300013307 | Ga0157372_10035893 | Ga0157372_100358936 | 210 |
| 383 | 3300014968 | Ga0157379_10039351 | Ga0157379_100393513 | 210 |
| 384 | 3300025901 | Ga0207688_10197705 | Ga0207688_101977052 | 210 |
| 385 | 3300025904 | Ga0207647_10041476 | Ga0207647_100414762 | 210 |
| 386 | 3300025909 | Ga0207705_10048003 | Ga0207705_100480031 | 210 |
| 387 | 3300025918 | Ga0207662_10332443 | Ga0207662_103324431 | 210 |
| 388 | 3300025919 | Ga0207657_10010726 | Ga0207657_100107267 | 210 |
| 389 | 3300025921 | Ga0207652_10313789 | Ga0207652_103137892 | 210 |
| 390 | 3300025926 | Ga0207659_10293625 | Ga0207659_102936251 | 210 |
| 391 | 3300025927 | Ga0207687_10398679 | Ga0207687_103986792 | 210 |
| 392 | 3300025927 | Ga0207687_10754813 | Ga0207687_107548131 | 210 |
| 393 | 3300025929 | Ga0207664_10298077 | Ga0207664_102980772 | 210 |
| 394 | 3300025932 | Ga0207690_10010372 | Ga0207690_100103722 | 210 |
| 395 | 3300025933 | Ga0207706_10272717 | Ga0207706_102727171 | 210 |
| 396 | 3300025934 | Ga0207686_10033772 | Ga0207686_100337722 | 210 |
| 397 | 3300025937 | Ga0207669_10448619 | Ga0207669_104486192 | 210 |
| 398 | 3300025938 | Ga0207704_10348033 | Ga0207704_103480331 | 210 |
| 399 | 3300025942 | Ga0207689_10332680 | Ga0207689_103326802 | 210 |
| 400 | 3300025944 | Ga0207661_10031047 | Ga0207661_100310473 | 210 |
| 401 | 3300025944 | Ga0207661_10892336 | Ga0207661_108923362 | 210 |
| 402 | 3300025945 | Ga0207679_10171342 | Ga0207679_101713422 | 210 |
| 403 | 3300025949 | Ga0207667_10945749 | Ga0207667_109457491 | 210 |
| 404 | 3300025986 | Ga0207658_10365979 | Ga0207658_103659791 | 210 |
| 405 | 3300026041 | Ga0207639_10392818 | Ga0207639_103928181 | 210 |
| 406 | 3300026089 | Ga0207648_10462872 | Ga0207648_104628721 | 210 |
| 407 | 3300026116 | Ga0207674_10038543 | Ga0207674_100385433 | 210 |
| 408 | 3300026121 | Ga0207683_10172921 | Ga0207683_101729212 | 210 |
| 409 | 3300028379 | Ga0268266_10004579 | Ga0268266_100045799 | 210 |
| 410 | 3300031731 | Ga0307405_10096666 | Ga0307405_100966662 | 210 |
| 411 | 3300045049 | Ga0466959_0033462 | Ga0466959_0033462_2486_3145 | 210 |
| 412 | 3300045836 | Ga0466958_0107958 | Ga0466958_0107958_51_710 | 210 |
| 413 | 3300046455 | Ga0495603_0118031 | Ga0495603_0118031_20_688 | 210 |
| 414 | 3300048905 | Ga0496102_0008533 | Ga0496102_0008533_6350_7000 | 210 |
| 415 | 3300048905 | Ga0496102_0589081 | Ga0496102_0589081_16_672 | 210 |
| 416 | 3300048906 | Ga0496103_0070358 | Ga0496103_0070358_324_974 | 210 |
| 417 | 3300048912 | Ga0496109_0047925 | Ga0496109_0047925_149_799 | 210 |
| 418 | 3300048914 | Ga0496111_0005153 | Ga0496111_0005153_529_1179 | 210 |
| 419 | 3300048915 | Ga0496112_0468731 | Ga0496112_0468731_38_727 | 210 |
| 420 | 3300048916 | Ga0496113_0248578 | Ga0496113_0248578_694_1344 | 210 |
| 421 | 3300048917 | Ga0496114_0148944 | Ga0496114_0148944_968_1636 | 210 |
| 422 | 3300048917 | Ga0496114_0291482 | Ga0496114_0291482_388_1038 | 210 |
| 423 | 3300049586 | Ga0501070_0525340 | Ga0501070_0525340_209_922 | 210 |
| 424 | 3300050492 | nmdc:mga0yw44_230278_c2 | nmdc:mga0yw44_230278_c2_22_690 | 210 |
| 425 | 3300050492 | nmdc:mga0yw44_417933_c1 | nmdc:mga0yw44_417933_c1_38_715 | 210 |
| 426 | 3300050494 | nmdc:mga06z11_70175_c1 | nmdc:mga06z11_70175_c1_327_1004 | 210 |
| 427 | 3300050495 | nmdc:mga04h51_39291_c1 | nmdc:mga04h51_39291_c1_557_1234 | 210 |
| 428 | 3300050496 | nmdc:mga07m45_85565_c1 | nmdc:mga07m45_85565_c1_194_871 | 210 |
| 429 | 3300059426 | Ga0590077_026068 | Ga0590077_026068_460_1104 | 210 |
| 430 | iso_pu_bacteria | 2984576629 | 2984579769 | 210 |
| 431 | iso_pu_bacteria | 2990256926 | 2990257375 | 210 |
| 432 | 3300006051 | Ga0075364_10039542 | Ga0075364_100395422 | 211 |
| 433 | 3300006177 | Ga0075362_10059421 | Ga0075362_100594213 | 211 |
| 434 | 3300009094 | Ga0111539_10637774 | Ga0111539_106377742 | 211 |
| 435 | 3300009098 | Ga0105245_10953672 | Ga0105245_109536722 | 211 |
| 436 | 3300025927 | Ga0207687_10002966 | Ga0207687_100029669 | 211 |
| 437 | 3300026078 | Ga0207702_10639022 | Ga0207702_106390222 | 211 |
| 438 | 3300026142 | Ga0207698_10058156 | Ga0207698_100581562 | 211 |
| 439 | 3300049572 | Ga0501036_0132273 | Ga0501036_0132273_109_777 | 211 |
| 440 | 3300049575 | Ga0501039_0121897 | Ga0501039_0121897_244_912 | 211 |
| 441 | 3300049583 | Ga0501067_0012114 | Ga0501067_0012114_79_747 | 211 |
| 442 | 3300049583 | Ga0501067_0117417 | Ga0501067_0117417_497_1165 | 211 |
| 443 | 3300049585 | Ga0501069_0005208 | Ga0501069_0005208_2665_3333 | 211 |
| 444 | 3300049586 | Ga0501070_0046658 | Ga0501070_0046658_107_775 | 211 |
| 445 | 3300049586 | Ga0501070_0075161 | Ga0501070_0075161_107_775 | 211 |
| 446 | 3300049587 | Ga0501071_0005496 | Ga0501071_0005496_6379_7047 | 211 |
| 447 | 3300049587 | Ga0501071_0265008 | Ga0501071_0265008_580_1248 | 211 |
| 448 | 3300049587 | Ga0501071_0310804 | Ga0501071_0310804_544_1179 | 211 |
| 449 | 3300049588 | Ga0501072_0011083 | Ga0501072_0011083_2836_3504 | 211 |
| 450 | 3300049589 | Ga0501073_0113022 | Ga0501073_0113022_1109_1777 | 211 |
| 451 | 3300049589 | Ga0501073_0210246 | Ga0501073_0210246_107_775 | 211 |
| 452 | 3300049590 | Ga0501074_0125153 | Ga0501074_0125153_443_1111 | 211 |
| 453 | 3300049741 | Ga0501079_0076481 | Ga0501079_0076481_247_915 | 211 |
| 454 | 3300049742 | Ga0501080_0335595 | Ga0501080_0335595_384_1052 | 211 |
| 455 | 3300049744 | Ga0501083_0252621 | Ga0501083_0252621_401_1069 | 211 |
| 456 | 3300050489 | nmdc:mga03683_179737_c1 | nmdc:mga03683_179737_c1_251_886 | 211 |
| 457 | 3300050491 | nmdc:mga00v17_65549_c1 | nmdc:mga00v17_65549_c1_213_848 | 211 |
| 458 | 3300050511 | nmdc:mga08y16_496685_c1 | nmdc:mga08y16_496685_c1_149_817 | 211 |
| 459 | 3300054114 | Ga0501084_0075926 | Ga0501084_0075926_1431_2099 | 211 |
| 460 | 3300054114 | Ga0501084_0253839 | Ga0501084_0253839_742_1410 | 211 |
| 461 | 3300060353 | Ga0501082_0009085 | Ga0501082_0009085_6586_7254 | 211 |
| 462 | 3300005329 | Ga0070683_100023908 | Ga0070683_1000239082 | 212 |
| 463 | 3300005331 | Ga0070670_100111300 | Ga0070670_1001113003 | 212 |
| 464 | 3300005336 | Ga0070680_100073191 | Ga0070680_1000731914 | 212 |
| 465 | 3300005337 | Ga0070682_100013692 | Ga0070682_1000136926 | 212 |
| 466 | 3300005338 | Ga0068868_100065622 | Ga0068868_1000656224 | 212 |
| 467 | 3300005339 | Ga0070660_100048141 | Ga0070660_1000481415 | 212 |
| 468 | 3300005341 | Ga0070691_10026426 | Ga0070691_100264262 | 212 |
| 469 | 3300005344 | Ga0070661_100092126 | Ga0070661_1000921263 | 212 |
| 470 | 3300005345 | Ga0070692_10097940 | Ga0070692_100979402 | 212 |
| 471 | 3300005354 | Ga0070675_100147591 | Ga0070675_1001475913 | 212 |
| 472 | 3300005355 | Ga0070671_100045236 | Ga0070671_1000452364 | 212 |
| 473 | 3300005366 | Ga0070659_100166232 | Ga0070659_1001662322 | 212 |
| 474 | 3300005435 | Ga0070714_100001446 | Ga0070714_10000144610 | 212 |
| 475 | 3300005441 | Ga0070700_100137214 | Ga0070700_1001372141 | 212 |
| 476 | 3300005455 | Ga0070663_100049350 | Ga0070663_1000493504 | 212 |
| 477 | 3300005456 | Ga0070678_100155551 | Ga0070678_1001555512 | 212 |
| 478 | 3300005458 | Ga0070681_10114956 | Ga0070681_101149562 | 212 |
| 479 | 3300005466 | Ga0070685_10064620 | Ga0070685_100646202 | 212 |
| 480 | 3300005530 | Ga0070679_100160437 | Ga0070679_1001604373 | 212 |
| 481 | 3300005547 | Ga0070693_100018875 | Ga0070693_1000188753 | 212 |
| 482 | 3300005563 | Ga0068855_100206224 | Ga0068855_1002062242 | 212 |
| 483 | 3300005578 | Ga0068854_100206351 | Ga0068854_1002063512 | 212 |
| 484 | 3300005615 | Ga0070702_100011043 | Ga0070702_1000110434 | 212 |
| 485 | 3300005617 | Ga0068859_100054057 | Ga0068859_1000540574 | 212 |
| 486 | 3300005840 | Ga0068870_10011892 | Ga0068870_100118922 | 212 |
| 487 | 3300005841 | Ga0068863_100076596 | Ga0068863_1000765963 | 212 |
| 488 | 3300005842 | Ga0068858_100077027 | Ga0068858_1000770272 | 212 |
| 489 | 3300006038 | Ga0075365_10063640 | Ga0075365_100636402 | 212 |
| 490 | 3300006038 | Ga0075365_10262099 | Ga0075365_102620992 | 212 |
| 491 | 3300006042 | Ga0075368_10280626 | Ga0075368_102806261 | 212 |
| 492 | 3300006051 | Ga0075364_10009391 | Ga0075364_100093912 | 212 |
| 493 | 3300006051 | Ga0075364_10066532 | Ga0075364_100665321 | 212 |
| 494 | 3300006358 | Ga0068871_100084567 | Ga0068871_1000845672 | 212 |
| 495 | 3300006847 | Ga0075431_100111265 | Ga0075431_1001112653 | 212 |
| 496 | 3300006871 | Ga0075434_100067274 | Ga0075434_1000672742 | 212 |
| 497 | 3300006914 | Ga0075436_100066751 | Ga0075436_1000667512 | 212 |
| 498 | 3300006931 | Ga0097620_100054056 | Ga0097620_1000540562 | 212 |
| 499 | 3300007076 | Ga0075435_100037138 | Ga0075435_1000371384 | 212 |
| 500 | 3300009011 | Ga0105251_10110283 | Ga0105251_101102832 | 212 |
| 501 | 3300009093 | Ga0105240_10698213 | Ga0105240_106982132 | 212 |
| 502 | 3300009094 | Ga0111539_10057392 | Ga0111539_100573922 | 212 |
| 503 | 3300009101 | Ga0105247_10046783 | Ga0105247_100467834 | 212 |
| 504 | 3300009147 | Ga0114129_10076786 | Ga0114129_100767863 | 212 |
| 505 | 3300009174 | Ga0105241_10034837 | Ga0105241_100348374 | 212 |
| 506 | 3300009177 | Ga0105248_10061101 | Ga0105248_100611012 | 212 |
| 507 | 3300009551 | Ga0105238_10217634 | Ga0105238_102176342 | 212 |
| 508 | 3300010375 | Ga0105239_10174678 | Ga0105239_101746784 | 212 |
| 509 | 3300013100 | Ga0157373_10085704 | Ga0157373_100857042 | 212 |
| 510 | 3300013102 | Ga0157371_10079734 | Ga0157371_100797343 | 212 |
| 511 | 3300013104 | Ga0157370_10063407 | Ga0157370_100634072 | 212 |
| 512 | 3300013104 | Ga0157370_10282298 | Ga0157370_102822982 | 212 |
| 513 | 3300013296 | Ga0157374_10065627 | Ga0157374_100656275 | 212 |
| 514 | 3300013307 | Ga0157372_10205672 | Ga0157372_102056723 | 212 |
| 515 | 3300014326 | Ga0157380_10882182 | Ga0157380_108821822 | 212 |
| 516 | 3300014745 | Ga0157377_10087620 | Ga0157377_100876203 | 212 |
| 517 | 3300020082 | Ga0206353_11030654 | Ga0206353_110306542 | 212 |
| 518 | 3300021388 | Ga0213875_10049861 | Ga0213875_100498612 | 212 |
| 519 | 3300025321 | Ga0207656_10055751 | Ga0207656_100557512 | 212 |
| 520 | 3300025900 | Ga0207710_10081738 | Ga0207710_100817382 | 212 |
| 521 | 3300025901 | Ga0207688_10015922 | Ga0207688_100159222 | 212 |
| 522 | 3300025907 | Ga0207645_10018549 | Ga0207645_100185492 | 212 |
| 523 | 3300025908 | Ga0207643_10000100 | Ga0207643_1000010013 | 212 |
| 524 | 3300025909 | Ga0207705_10048274 | Ga0207705_100482744 | 212 |
| 525 | 3300025911 | Ga0207654_10184265 | Ga0207654_101842652 | 212 |
| 526 | 3300025912 | Ga0207707_10120932 | Ga0207707_101209323 | 212 |
| 527 | 3300025913 | Ga0207695_10206410 | Ga0207695_102064103 | 212 |
| 528 | 3300025918 | Ga0207662_10039986 | Ga0207662_100399861 | 212 |
| 529 | 3300025919 | Ga0207657_10060396 | Ga0207657_100603962 | 212 |
| 530 | 3300025920 | Ga0207649_10058045 | Ga0207649_100580452 | 212 |
| 531 | 3300025924 | Ga0207694_10089127 | Ga0207694_100891273 | 212 |
| 532 | 3300025925 | Ga0207650_10282776 | Ga0207650_102827763 | 212 |
| 533 | 3300025926 | Ga0207659_10100631 | Ga0207659_101006313 | 212 |
| 534 | 3300025927 | Ga0207687_10058267 | Ga0207687_100582671 | 212 |
| 535 | 3300025935 | Ga0207709_10670833 | Ga0207709_106708331 | 212 |
| 536 | 3300025940 | Ga0207691_10009704 | Ga0207691_1000970410 | 212 |
| 537 | 3300025942 | Ga0207689_10045864 | Ga0207689_100458642 | 212 |
| 538 | 3300025944 | Ga0207661_10012431 | Ga0207661_100124316 | 212 |
| 539 | 3300025944 | Ga0207661_10041082 | Ga0207661_100410823 | 212 |
| 540 | 3300025944 | Ga0207661_10064962 | Ga0207661_100649622 | 212 |
| 541 | 3300025945 | Ga0207679_10081212 | Ga0207679_100812124 | 212 |
| 542 | 3300025945 | Ga0207679_10777112 | Ga0207679_107771122 | 212 |
| 543 | 3300025949 | Ga0207667_10155460 | Ga0207667_101554603 | 212 |
| 544 | 3300025960 | Ga0207651_10051552 | Ga0207651_100515522 | 212 |
| 545 | 3300026023 | Ga0207677_10714709 | Ga0207677_107147092 | 212 |
| 546 | 3300026035 | Ga0207703_10106370 | Ga0207703_101063703 | 212 |
| 547 | 3300026067 | Ga0207678_10002842 | Ga0207678_100028424 | 212 |
| 548 | 3300026075 | Ga0207708_10052761 | Ga0207708_100527612 | 212 |
| 549 | 3300026078 | Ga0207702_10103325 | Ga0207702_101033252 | 212 |
| 550 | 3300026088 | Ga0207641_10222852 | Ga0207641_102228522 | 212 |
| 551 | 3300026095 | Ga0207676_10067002 | Ga0207676_100670024 | 212 |
| 552 | 3300026121 | Ga0207683_10000565 | Ga0207683_100005652 | 212 |
| 553 | 3300026142 | Ga0207698_10222333 | Ga0207698_102223332 | 212 |
| 554 | 3300027907 | Ga0207428_10053593 | Ga0207428_100535934 | 212 |
| 555 | 3300028379 | Ga0268266_10058281 | Ga0268266_100582813 | 212 |
| 556 | 3300028381 | Ga0268264_10300168 | Ga0268264_103001682 | 212 |
| 557 | 3300037853 | Ga0436364_1506248 | Ga0436364_1506248_249_887 | 212 |
| 558 | 3300042005 | Ga0439448_0011570 | Ga0439448_0011570_1599_2264 | 212 |
| 559 | 3300042118 | Ga0450914_007739 | Ga0450914_007739_302_967 | 212 |
| 560 | 3300042157 | Ga0439458_0009932 | Ga0439458_0009932_879_1544 | 212 |
| 561 | 3300044683 | Ga0466965_0016158 | Ga0466965_0016158_1456_2094 | 212 |
| 562 | 3300044765 | Ga0466970_0054941 | Ga0466970_0054941_111_785 | 212 |
| 563 | 3300044901 | Ga0466960_0027309 | Ga0466960_0027309_1190_1864 | 212 |
| 564 | 3300044901 | Ga0466960_0028802 | Ga0466960_0028802_772_1410 | 212 |
| 565 | 3300045836 | Ga0466958_0101486 | Ga0466958_0101486_324_962 | 212 |
| 566 | 3300045976 | Ga0466967_0048979 | Ga0466967_0048979_2720_3391 | 212 |
| 567 | 3300045976 | Ga0466967_0152013 | Ga0466967_0152013_46_723 | 212 |
| 568 | 3300045976 | Ga0466967_0182440 | Ga0466967_0182440_385_1062 | 212 |
| 569 | 3300045976 | Ga0466967_1169824 | Ga0466967_1169824_64_732 | 212 |
| 570 | 3300046475 | Ga0495639_0181426 | Ga0495639_0181426_73_753 | 212 |
| 571 | 3300046477 | Ga0495664_0018905 | Ga0495664_0018905_2080_2730 | 212 |
| 572 | 3300046522 | Ga0495643_0093253 | Ga0495643_0093253_125_808 | 212 |
| 573 | 3300046543 | Ga0495645_0278894 | Ga0495645_0278894_226_876 | 212 |
| 574 | 3300048903 | Ga0496100_0335432 | Ga0496100_0335432_433_1098 | 212 |
| 575 | 3300048906 | Ga0496103_0417721 | Ga0496103_0417721_132_797 | 212 |
| 576 | 3300048907 | Ga0496104_0061498 | Ga0496104_0061498_1562_2227 | 212 |
| 577 | 3300048908 | Ga0496105_0031900 | Ga0496105_0031900_1903_2568 | 212 |
| 578 | 3300048909 | Ga0496106_0073228 | Ga0496106_0073228_1441_2106 | 212 |
| 579 | 3300048910 | Ga0496107_0056858 | Ga0496107_0056858_510_1175 | 212 |
| 580 | 3300048912 | Ga0496109_0349155 | Ga0496109_0349155_601_1266 | 212 |
| 581 | 3300048913 | Ga0496110_0118546 | Ga0496110_0118546_1702_2367 | 212 |
| 582 | 3300048914 | Ga0496111_0031104 | Ga0496111_0031104_1507_2172 | 212 |
| 583 | 3300048916 | Ga0496113_0091951 | Ga0496113_0091951_259_924 | 212 |
| 584 | 3300048918 | Ga0496115_0264211 | Ga0496115_0264211_450_1115 | 212 |
| 585 | 3300049585 | Ga0501069_0106759 | Ga0501069_0106759_503_1177 | 212 |
| 586 | 3300050491 | nmdc:mga00v17_2605_c1 | nmdc:mga00v17_2605_c1_6569_7261 | 212 |
| 587 | 3300050494 | nmdc:mga06z11_523129_c1 | nmdc:mga06z11_523129_c1_34_672 | 212 |
| 588 | 3300050507 | nmdc:mga05p37_220164_c1 | nmdc:mga05p37_220164_c1_751_1416 | 212 |
| 589 | 3300050514 | nmdc:mga08x19_117537_c1 | nmdc:mga08x19_117537_c1_836_1501 | 212 |
| 590 | 3300050515 | nmdc:mga0a205_83665_c1 | nmdc:mga0a205_83665_c1_970_1635 | 212 |
| 591 | iso_pu_bacteria | 2515154155 | 2515856568 | 212 |
| 592 | iso_pu_bacteria | 2837268691 | 2837269130 | 212 |
| 593 | iso_pu_bacteria | 2868088558 | 2868092705 | 212 |
| 594 | 3300005329 | Ga0070683_100136532 | Ga0070683_1001365322 | 213 |
| 595 | 3300005337 | Ga0070682_100069770 | Ga0070682_1000697702 | 213 |
| 596 | 3300005339 | Ga0070660_100036084 | Ga0070660_1000360842 | 213 |
| 597 | 3300005366 | Ga0070659_100089414 | Ga0070659_1000894142 | 213 |
| 598 | 3300005366 | Ga0070659_100438344 | Ga0070659_1004383441 | 213 |
| 599 | 3300005455 | Ga0070663_100019332 | Ga0070663_1000193325 | 213 |
| 600 | 3300005535 | Ga0070684_100178752 | Ga0070684_1001787522 | 213 |
| 601 | 3300005564 | Ga0070664_100529217 | Ga0070664_1005292172 | 213 |
| 602 | 3300005614 | Ga0068856_101246478 | Ga0068856_1012464782 | 213 |
| 603 | 3300006048 | Ga0075363_100011133 | Ga0075363_1000111331 | 213 |
| 604 | 3300006051 | Ga0075364_10034188 | Ga0075364_100341884 | 213 |
| 605 | 3300006237 | Ga0097621_101045862 | Ga0097621_1010458621 | 213 |
| 606 | 3300006353 | Ga0075370_10015524 | Ga0075370_100155244 | 213 |
| 607 | 3300009545 | Ga0105237_10645230 | Ga0105237_106452302 | 213 |
| 608 | 3300009553 | Ga0105249_10482721 | Ga0105249_104827212 | 213 |
| 609 | 3300010375 | Ga0105239_10012602 | Ga0105239_100126027 | 213 |
| 610 | 3300013307 | Ga0157372_10166981 | Ga0157372_101669812 | 213 |
| 611 | 3300013308 | Ga0157375_10500986 | Ga0157375_105009861 | 213 |
| 612 | 3300017792 | Ga0163161_10531334 | Ga0163161_105313341 | 213 |
| 613 | 3300020070 | Ga0206356_10664571 | Ga0206356_106645712 | 213 |
| 614 | 3300020081 | Ga0206354_10855475 | Ga0206354_108554752 | 213 |
| 615 | 3300025914 | Ga0207671_10122276 | Ga0207671_101222761 | 213 |
| 616 | 3300025919 | Ga0207657_10074462 | Ga0207657_100744622 | 213 |
| 617 | 3300025932 | Ga0207690_10014869 | Ga0207690_100148694 | 213 |
| 618 | 3300025932 | Ga0207690_10047931 | Ga0207690_100479312 | 213 |
| 619 | 3300025932 | Ga0207690_10071359 | Ga0207690_100713593 | 213 |
| 620 | 3300025944 | Ga0207661_10044358 | Ga0207661_100443583 | 213 |
| 621 | 3300026067 | Ga0207678_10068635 | Ga0207678_100686353 | 213 |
| 622 | 3300026078 | Ga0207702_11341243 | Ga0207702_113412431 | 213 |
| 623 | 3300031548 | Ga0307408_100393487 | Ga0307408_1003934872 | 213 |
| 624 | 3300031824 | Ga0307413_10040012 | Ga0307413_100400122 | 213 |
| 625 | 3300031852 | Ga0307410_10481075 | Ga0307410_104810752 | 213 |
| 626 | 3300031901 | Ga0307406_10094187 | Ga0307406_100941872 | 213 |
| 627 | 3300031903 | Ga0307407_10098732 | Ga0307407_100987321 | 213 |
| 628 | 3300031903 | Ga0307407_10466002 | Ga0307407_104660022 | 213 |
| 629 | 3300031911 | Ga0307412_10343032 | Ga0307412_103430322 | 213 |
| 630 | 3300031995 | Ga0307409_100128509 | Ga0307409_1001285092 | 213 |
| 631 | 3300032002 | Ga0307416_100170926 | Ga0307416_1001709262 | 213 |
| 632 | 3300032002 | Ga0307416_101377175 | Ga0307416_1013771751 | 213 |
| 633 | 3300032004 | Ga0307414_10571288 | Ga0307414_105712882 | 213 |
| 634 | 3300032126 | Ga0307415_100213819 | Ga0307415_1002138192 | 213 |
| 635 | 3300035725 | Ga0373947_0695791 | Ga0373947_0695791_14_664 | 213 |
| 636 | 3300038443 | Ga0395901_0320662 | Ga0395901_0320662_898_1569 | 213 |
| 637 | 3300038443 | Ga0395901_0808815 | Ga0395901_0808815_198_842 | 213 |
| 638 | 3300044693 | Ga0466961_0424427 | Ga0466961_0424427_141_794 | 213 |
| 639 | 3300044765 | Ga0466970_0048016 | Ga0466970_0048016_979_1632 | 213 |
| 640 | 3300044842 | Ga0466957_0025147 | Ga0466957_0025147_661_1311 | 213 |
| 641 | 3300044842 | Ga0466957_0063950 | Ga0466957_0063950_407_1060 | 213 |
| 642 | 3300046473 | Ga0495582_0515591 | Ga0495582_0515591_11_661 | 213 |
| 643 | 3300048903 | Ga0496100_0082924 | Ga0496100_0082924_335_985 | 213 |
| 644 | 3300048907 | Ga0496104_0064806 | Ga0496104_0064806_2285_2935 | 213 |
| 645 | 3300048907 | Ga0496104_0391999 | Ga0496104_0391999_231_881 | 213 |
| 646 | 3300048909 | Ga0496106_0140054 | Ga0496106_0140054_290_940 | 213 |
| 647 | 3300048910 | Ga0496107_0610816 | Ga0496107_0610816_86_736 | 213 |
| 648 | 3300048911 | Ga0496108_0049105 | Ga0496108_0049105_1679_2329 | 213 |
| 649 | 3300048911 | Ga0496108_0052559 | Ga0496108_0052559_2682_3332 | 213 |
| 650 | 3300048912 | Ga0496109_0798912 | Ga0496109_0798912_164_814 | 213 |
| 651 | 3300048913 | Ga0496110_0018218 | Ga0496110_0018218_1255_1896 | 213 |
| 652 | 3300048913 | Ga0496110_0404397 | Ga0496110_0404397_547_1197 | 213 |
| 653 | 3300048914 | Ga0496111_0027398 | Ga0496111_0027398_46_696 | 213 |
| 654 | 3300048917 | Ga0496114_0290411 | Ga0496114_0290411_605_1255 | 213 |
| 655 | 3300048918 | Ga0496115_0275362 | Ga0496115_0275362_587_1237 | 213 |
| 656 | 3300049576 | Ga0501040_0079656 | Ga0501040_0079656_1471_2121 | 213 |
| 657 | 3300049584 | Ga0501068_0141420 | Ga0501068_0141420_751_1401 | 213 |
| 658 | 3300049585 | Ga0501069_0043323 | Ga0501069_0043323_397_1047 | 213 |
| 659 | 3300050490 | nmdc:mga03n38_1274_c1 | nmdc:mga03n38_1274_c1_2675_3394 | 213 |
| 660 | 3300050491 | nmdc:mga00v17_19640_c1 | nmdc:mga00v17_19640_c1_2673_3392 | 213 |
| 661 | 3300050494 | nmdc:mga06z11_371447_c1 | nmdc:mga06z11_371447_c1_29_748 | 213 |
| 662 | 3300050496 | nmdc:mga07m45_9631_c1 | nmdc:mga07m45_9631_c1_2661_3380 | 213 |
| 663 | 3300053155 | Ga0500620_041692 | Ga0500620_041692_199_849 | 213 |
| 664 | 3300060353 | Ga0501082_0863155 | Ga0501082_0863155_34_684 | 213 |
| 665 | 3300002075 | JGI24738J21930_10010742 | JGI24738J21930_100107422 | 214 |
| 666 | 3300002077 | JGI24744J21845_10008086 | JGI24744J21845_100080862 | 214 |
| 667 | 3300005329 | Ga0070683_100036540 | Ga0070683_1000365402 | 214 |
| 668 | 3300005329 | Ga0070683_100201360 | Ga0070683_1002013602 | 214 |
| 669 | 3300005338 | Ga0068868_100184226 | Ga0068868_1001842262 | 214 |
| 670 | 3300005345 | Ga0070692_10005693 | Ga0070692_100056934 | 214 |
| 671 | 3300005364 | Ga0070673_100029253 | Ga0070673_1000292533 | 214 |
| 672 | 3300005366 | Ga0070659_100200249 | Ga0070659_1002002492 | 214 |
| 673 | 3300005438 | Ga0070701_10122806 | Ga0070701_101228062 | 214 |
| 674 | 3300005441 | Ga0070700_100034575 | Ga0070700_1000345753 | 214 |
| 675 | 3300005457 | Ga0070662_100164417 | Ga0070662_1001644172 | 214 |
| 676 | 3300005459 | Ga0068867_100074370 | Ga0068867_1000743702 | 214 |
| 677 | 3300005535 | Ga0070684_100028263 | Ga0070684_1000282634 | 214 |
| 678 | 3300005539 | Ga0068853_100022084 | Ga0068853_1000220842 | 214 |
| 679 | 3300005543 | Ga0070672_100019305 | Ga0070672_1000193052 | 214 |
| 680 | 3300005544 | Ga0070686_100055918 | Ga0070686_1000559182 | 214 |
| 681 | 3300005549 | Ga0070704_100584115 | Ga0070704_1005841152 | 214 |
| 682 | 3300005564 | Ga0070664_100176753 | Ga0070664_1001767532 | 214 |
| 683 | 3300005578 | Ga0068854_100084599 | Ga0068854_1000845992 | 214 |
| 684 | 3300005616 | Ga0068852_100050155 | Ga0068852_1000501554 | 214 |
| 685 | 3300005618 | Ga0068864_100111739 | Ga0068864_1001117393 | 214 |
| 686 | 3300005840 | Ga0068870_10003307 | Ga0068870_100033073 | 214 |
| 687 | 3300006881 | Ga0068865_100003722 | Ga0068865_1000037224 | 214 |
| 688 | 3300009094 | Ga0111539_10167102 | Ga0111539_101671022 | 214 |
| 689 | 3300009098 | Ga0105245_10119505 | Ga0105245_101195053 | 214 |
| 690 | 3300009148 | Ga0105243_10020111 | Ga0105243_100201113 | 214 |
| 691 | 3300009177 | Ga0105248_10212297 | Ga0105248_102122972 | 214 |
| 692 | 3300009553 | Ga0105249_10362547 | Ga0105249_103625472 | 214 |
| 693 | 3300013104 | Ga0157370_10332198 | Ga0157370_103321982 | 214 |
| 694 | 3300013307 | Ga0157372_10101197 | Ga0157372_101011973 | 214 |
| 695 | 3300014326 | Ga0157380_10051037 | Ga0157380_100510374 | 214 |
| 696 | 3300014745 | Ga0157377_10515834 | Ga0157377_105158342 | 214 |
| 697 | 3300017792 | Ga0163161_10171846 | Ga0163161_101718462 | 214 |
| 698 | 3300025315 | Ga0207697_10027155 | Ga0207697_100271552 | 214 |
| 699 | 3300025901 | Ga0207688_10015206 | Ga0207688_100152063 | 214 |
| 700 | 3300025908 | Ga0207643_10003328 | Ga0207643_100033284 | 214 |
| 701 | 3300025918 | Ga0207662_10005149 | Ga0207662_100051494 | 214 |
| 702 | 3300025927 | Ga0207687_10063166 | Ga0207687_100631662 | 214 |
| 703 | 3300025937 | Ga0207669_10040905 | Ga0207669_100409053 | 214 |
| 704 | 3300025938 | Ga0207704_10066534 | Ga0207704_100665342 | 214 |
| 705 | 3300025940 | Ga0207691_10016940 | Ga0207691_100169402 | 214 |
| 706 | 3300025941 | Ga0207711_10057824 | Ga0207711_100578242 | 214 |
| 707 | 3300025944 | Ga0207661_10140032 | Ga0207661_101400322 | 214 |
| 708 | 3300025944 | Ga0207661_10738946 | Ga0207661_107389461 | 214 |
| 709 | 3300025945 | Ga0207679_10270967 | Ga0207679_102709672 | 214 |
| 710 | 3300025960 | Ga0207651_10023558 | Ga0207651_100235583 | 214 |
| 711 | 3300025961 | Ga0207712_10275685 | Ga0207712_102756852 | 214 |
| 712 | 3300025981 | Ga0207640_10077392 | Ga0207640_100773923 | 214 |
| 713 | 3300025986 | Ga0207658_10385369 | Ga0207658_103853692 | 214 |
| 714 | 3300026023 | Ga0207677_10764601 | Ga0207677_107646011 | 214 |
| 715 | 3300026075 | Ga0207708_10000786 | Ga0207708_1000078615 | 214 |
| 716 | 3300026089 | Ga0207648_10123460 | Ga0207648_101234602 | 214 |
| 717 | 3300026118 | Ga0207675_100917568 | Ga0207675_1009175682 | 214 |
| 718 | 3300026142 | Ga0207698_10054593 | Ga0207698_100545933 | 214 |
| 719 | 3300046683 | Ga0495658_0514730 | Ga0495658_0514730_47_727 | 214 |
| 720 | 3300048909 | Ga0496106_0303692 | Ga0496106_0303692_125_769 | 214 |
| 721 | 3300048910 | Ga0496107_0132739 | Ga0496107_0132739_716_1360 | 214 |
| 722 | 3300048911 | Ga0496108_0039949 | Ga0496108_0039949_2923_3567 | 214 |
| 723 | 3300048912 | Ga0496109_0113315 | Ga0496109_0113315_632_1276 | 214 |
| 724 | 3300048914 | Ga0496111_0211399 | Ga0496111_0211399_205_849 | 214 |
| 725 | 3300048917 | Ga0496114_0029410 | Ga0496114_0029410_2414_3058 | 214 |
| 726 | 3300049568 | Ga0501031_0062971 | Ga0501031_0062971_466_1119 | 214 |
| 727 | 3300049575 | Ga0501039_0212082 | Ga0501039_0212082_564_1217 | 214 |
| 728 | 3300049575 | Ga0501039_0252390 | Ga0501039_0252390_73_726 | 214 |
| 729 | 3300049576 | Ga0501040_0098835 | Ga0501040_0098835_607_1260 | 214 |
| 730 | 3300049579 | Ga0501043_0484381 | Ga0501043_0484381_234_887 | 214 |
| 731 | 3300049582 | Ga0501048_0349230 | Ga0501048_0349230_291_944 | 214 |
| 732 | 3300049590 | Ga0501074_0293894 | Ga0501074_0293894_447_1100 | 214 |
| 733 | 3300049743 | Ga0501081_0310541 | Ga0501081_0310541_362_1015 | 214 |
| 734 | 3300050511 | nmdc:mga08y16_29745_c1 | nmdc:mga08y16_29745_c1_1568_2212 | 214 |
| 735 | iso_pu_bacteria | 2855386786 | 2855391155 | 214 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wsz-assembly1.cif.gz_B | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9664 | 150 | 214 |
| 4wul-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 26bp dna | 0.9637 | 152 | 214 |
| 4wsz-assembly1.cif.gz_A | crystal structure of the dna binding domains of wild type liar from e. faecalis | 0.9615 | 150 | 214 |
| 4wu4-assembly1.cif.gz_A | crystal structure of e. faecalis dna binding domain liard191n complexed with 22bp dna | 0.9588 | 150 | 213 |
| 7x1k-assembly1.cif.gz_B | crystal structure of the flagellar expression regulator degu from listeria monocytogenes | 0.9574 | 151 | 210 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53213_1064_1134_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9681 | 152 | 211 | 1.10.10.10 |
| 3qp5D02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9585 | 154 | 205 | 1.10.10.10 |
| 1yioA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9551 | 154 | 210 | 1.10.10.10 |
| 1zn2A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9526 | 154 | 210 | 1.10.10.10 |
| 3eulC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9512 | 5 | 120 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0MTT7-F1-model_v4 | Response regulator transcription factor | 0.9396 | 1 | 122 |
GO:0000160
|
| AF-A0A429HPZ9-F1-model_v4 | deleted | 0.9225 | 1 | 139 |
|
| AF-A0A7X9CUN2-F1-model_v4 | deleted | 0.9211 | 4 | 148 |
|
| AF-A0A7G8BEC4-F1-model_v4 | Response regulator transcription factor | 0.9197 | 2 | 131 |
GO:0000160
GO:0003677 |
| AF-A0A1F2RW02-F1-model_v4 | Response regulatory domain-containing protein | 0.9179 | 2 | 130 |
GO:0000160
GO:0003677 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar