F478229

General Info

Members Datasets Scaffolds Average Seq Length
735 374 1470 121

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0288454|Ga0496121_0288454_241_678
Length 145
Sequence LPYRRRPVRTALTISQADDAEDLMTDVASILASAYKANTLSVAKSNSKYVAVDPMLYQGSWTGKYANNKSFSITISDVSGFRAKVHYQSEGTSKYQDVLIKDGAFRVGDTKFTLTAKGKAQIKNVVTDPASGQTYLDTAYATQDK

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
79 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
89 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
90 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
183 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
184 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
185 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
191 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
192 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
193 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
196 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
197 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
198 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
199 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
200 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
201 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
202 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
203 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
204 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
205 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
208 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
217 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
218 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
224 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
225 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
226 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
227 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
235 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
236 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
237 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
238 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
239 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
240 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
241 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
242 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
243 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
244 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
245 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
248 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
249 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
250 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
259 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
262 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
265 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
266 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
267 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
279 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
283 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
284 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
285 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
286 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
287 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
288 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
289 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
290 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
291 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
292 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
293 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
296 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
297 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
312 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
319 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
323 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
324 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
327 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
328 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
329 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
330 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
331 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
332 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
333 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
334 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
335 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
336 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
337 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
338 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
339 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
340 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
341 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
342 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
343 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
344 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
345 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
346 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
347 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
348 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
349 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
350 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
351 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
352 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
353 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
354 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
355 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
356 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
357 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
358 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
359 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
360 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
361 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
362 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
363 2791355199
364 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
365 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
366 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
367 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
368 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
369 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
370 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
371 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
372 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
373 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
374 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.82
Metatranscriptomes 0
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.97
Nodule 2.31
Rhizoplane 6.26
Rhizosphere 68.44
Stem 0
Stem Tuber 0
Unclassified 3.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0288454 3300048924 Bacteria 1119
2 SwRhRL2b_contig_3053350 2162886007 Bacteria 1217
3 MBSR1b_contig_5204513 2162886012 Bacteria 1217
4 JGI24034J26672_10077356 3300002239 Bacteria 603
5 rootH1_10290882 3300003323 Bacteria 1465
6 Ga0065704_10185589 3300005289 Bacteria 1215
7 Ga0065715_10235951 3300005293 Bacteria 1217
8 Ga0065707_10133418 3300005295 Bacteria 1882
9 Ga0070690_100442878 3300005330 Bacteria 962
10 Ga0070670_101739860 3300005331 Bacteria 574
11 Ga0068869_100056441 3300005334 Bacteria 2864
12 Ga0068869_100205915 3300005334 Unclassified 1553
13 Ga0068869_100272919 3300005334 Bacteria 1357
14 Ga0068869_100988892 3300005334 Bacteria 732
15 Ga0070680_100115364 3300005336 Bacteria 2238
16 Ga0070682_101003563 3300005337 Bacteria 693
17 Ga0068868_100043625 3300005338 Bacteria 3503
18 Ga0068868_100201117 3300005338 Unclassified 1661
19 Ga0068868_101780399 3300005338 Bacteria 582
20 Ga0070660_100908860 3300005339 Bacteria 742
21 Ga0070689_101100489 3300005340 Bacteria 710
22 Ga0070689_101451526 3300005340 Unclassified 620
23 Ga0070691_10192006 3300005341 Bacteria 1069
24 Ga0070687_100063446 3300005343 Bacteria 1959
25 Ga0070668_100194520 3300005347 Bacteria 1662
26 Ga0070668_100391120 3300005347 Bacteria 1185
27 Ga0070668_100759599 3300005347 Bacteria 859
28 Ga0070669_100123261 3300005353 Bacteria 1980
29 Ga0070669_100323367 3300005353 Unclassified 1246
30 Ga0070675_101042371 3300005354 Bacteria 751
31 Ga0070671_100247964 3300005355 Bacteria 1512
32 Ga0070671_100632426 3300005355 Bacteria 926
33 Ga0070674_100585906 3300005356 Bacteria 940
34 Ga0070688_100032819 3300005365 Bacteria 3134
35 Ga0070688_100117989 3300005365 Bacteria 1773
36 Ga0070688_100341253 3300005365 Bacteria 1094
37 Ga0070659_100101152 3300005366 Bacteria 2320
38 Ga0070659_100404328 3300005366 Bacteria 1153
39 Ga0070667_100424885 3300005367 Bacteria 1212
40 Ga0070703_10108314 3300005406 Bacteria 990
41 Ga0070709_10008109 3300005434 Bacteria 5764
42 Ga0070714_100013597 3300005435 Bacteria 6524
43 Ga0070714_100197987 3300005435 Bacteria 1837
44 Ga0070713_100044621 3300005436 Bacteria 3630
45 Ga0070713_100121195 3300005436 Bacteria 2294
46 Ga0070710_10062544 3300005437 Bacteria 2123
47 Ga0070711_100009820 3300005439 Bacteria 5902
48 Ga0070700_100207417 3300005441 Bacteria 1380
49 Ga0070700_100633891 3300005441 Bacteria 842
50 Ga0070694_100375435 3300005444 Bacteria 1107
51 Ga0070694_101493777 3300005444 Bacteria 572
52 Ga0070663_100124763 3300005455 Bacteria 1949
53 Ga0070663_100178074 3300005455 Bacteria 1647
54 Ga0070663_100279256 3300005455 Bacteria 1330
55 Ga0070678_100102488 3300005456 Bacteria 2221
56 Ga0070678_100891803 3300005456 Bacteria 812
57 Ga0070662_100249291 3300005457 Bacteria 1427
58 Ga0070681_10024583 3300005458 Bacteria 6060
59 Ga0070681_10856352 3300005458 Bacteria 827
60 Ga0070685_10206953 3300005466 Bacteria 1278
61 Ga0070685_10284573 3300005466 Unclassified 1108
62 Ga0070706_100047855 3300005467 Bacteria 3947
63 Ga0070706_100972628 3300005467 Bacteria 783
64 Ga0070706_101648161 3300005467 Bacteria 585
65 Ga0070707_100135061 3300005468 Bacteria 2400
66 Ga0070699_100127985 3300005518 Bacteria 2237
67 Ga0070699_101716567 3300005518 Bacteria 575
68 Ga0070679_100023471 3300005530 Bacteria 6038
69 Ga0070679_100487535 3300005530 Bacteria 1177
70 Ga0070679_100844809 3300005530 Bacteria 859
71 Ga0070679_101571072 3300005530 Bacteria 605
72 Ga0070684_100079296 3300005535 Bacteria 2902
73 Ga0070697_100177041 3300005536 Bacteria 1807
74 Ga0070697_101249952 3300005536 Bacteria 662
75 Ga0068853_100170748 3300005539 Bacteria 1967
76 Ga0068853_100539006 3300005539 Bacteria 1105
77 Ga0068853_100630073 3300005539 Bacteria 1020
78 Ga0068853_100787757 3300005539 Bacteria 910
79 Ga0068853_101040236 3300005539 Bacteria 789
80 Ga0068853_101566993 3300005539 Bacteria 638
81 Ga0068853_102263097 3300005539 Bacteria 527
82 Ga0070672_100043911 3300005543 Bacteria 3450
83 Ga0070672_100455845 3300005543 Bacteria 1102
84 Ga0070672_101645093 3300005543 Unclassified 576
85 Ga0070686_100251900 3300005544 Bacteria 1290
86 Ga0070695_100114281 3300005545 Bacteria 1837
87 Ga0070696_100251566 3300005546 Bacteria 1336
88 Ga0070665_100087698 3300005548 Bacteria 3117
89 Ga0070665_100094628 3300005548 Bacteria 2992
90 Ga0070665_100179920 3300005548 Bacteria 2115
91 Ga0070665_100203444 3300005548 Bacteria 1980
92 Ga0070665_100771401 3300005548 Bacteria 974
93 Ga0070665_100778876 3300005548 Bacteria 969
94 Ga0068855_100105834 3300005563 Bacteria 3234
95 Ga0068855_100152374 3300005563 Bacteria 2628
96 Ga0070664_100337912 3300005564 Bacteria 1367
97 Ga0068857_100978604 3300005577 Bacteria 814
98 Ga0068854_100259829 3300005578 Bacteria 1390
99 Ga0068854_100377813 3300005578 Bacteria 1167
100 Ga0068856_100073432 3300005614 Bacteria 3387
101 Ga0068856_100205094 3300005614 Bacteria 1986
102 Ga0068856_100305717 3300005614 Bacteria 1608
103 Ga0068856_101073319 3300005614 Bacteria 823
104 Ga0070702_100236070 3300005615 Bacteria 1231
105 Ga0070702_100293931 3300005615 Bacteria 1121
106 Ga0068852_100082137 3300005616 Bacteria 2862
107 Ga0068852_100082162 3300005616 Bacteria 2862
108 Ga0068859_100280689 3300005617 Bacteria 1758
109 Ga0068859_100707978 3300005617 Bacteria 1098
110 Ga0068864_100081180 3300005618 Bacteria 2842
111 Ga0068861_100326211 3300005719 Bacteria 1338
112 Ga0068861_100894176 3300005719 Bacteria 840
113 Ga0068851_10599684 3300005834 Bacteria 670
114 Ga0068863_100201719 3300005841 Bacteria 1914
115 Ga0068858_100036406 3300005842 Bacteria 4563
116 Ga0068858_100084146 3300005842 Bacteria 2959
117 Ga0068858_100716369 3300005842 Bacteria 974
118 Ga0068858_101416528 3300005842 Bacteria 685
119 Ga0068858_101599324 3300005842 Bacteria 643
120 Ga0068860_100198940 3300005843 Bacteria 1941
121 Ga0068860_100513403 3300005843 Bacteria 1198
122 Ga0068860_100852982 3300005843 Bacteria 926
123 Ga0068860_101029868 3300005843 Bacteria 842
124 Ga0068860_101168282 3300005843 Bacteria 790
125 Ga0068862_100347946 3300005844 Bacteria 1374
126 Ga0068862_100366878 3300005844 Bacteria 1339
127 Ga0068862_100669893 3300005844 Bacteria 1002
128 Ga0068862_101133131 3300005844 Bacteria 778
129 Ga0068862_101189311 3300005844 Bacteria 760
130 Ga0081455_10004004 3300005937 Bacteria 16720
131 Ga0081455_10441211 3300005937 Bacteria 892
132 Ga0081538_10031049 3300005981 Bacteria 3613
133 Ga0081540_1038542 3300005983 Bacteria 2518
134 Ga0081540_1177378 3300005983 Bacteria 802
135 Ga0070717_10033555 3300006028 Bacteria 4141
136 Ga0070717_10399459 3300006028 Bacteria 1234
137 Ga0075365_10032990 3300006038 Bacteria 3333
138 Ga0075365_10144681 3300006038 Bacteria 1651
139 Ga0075365_10152967 3300006038 Bacteria 1605
140 Ga0075365_10185457 3300006038 Bacteria 1455
141 Ga0075365_10602464 3300006038 Bacteria 777
142 Ga0075365_10866403 3300006038 Bacteria 637
143 Ga0075365_10945206 3300006038 Bacteria 608
144 Ga0075363_100153996 3300006048 Bacteria 1299
145 Ga0075364_10008875 3300006051 Bacteria 6020
146 Ga0075364_10624181 3300006051 Bacteria 736
147 Ga0075364_11021780 3300006051 Bacteria 562
148 Ga0070716_100082019 3300006173 Bacteria 1927
149 Ga0070716_100116548 3300006173 Bacteria 1665
150 Ga0070716_100335820 3300006173 Bacteria 1064
151 Ga0070712_100271431 3300006175 Bacteria 1363
152 Ga0075362_10079633 3300006177 Bacteria 1508
153 Ga0075367_10062725 3300006178 Bacteria 2221
154 Ga0075367_10065499 3300006178 Bacteria 2176
155 Ga0075367_10196986 3300006178 Bacteria 1258
156 Ga0075367_10428690 3300006178 Bacteria 837
157 Ga0075369_10043753 3300006186 Bacteria 1922
158 Ga0075369_10047159 3300006186 Bacteria 1857
159 Ga0075369_10283766 3300006186 Bacteria 771
160 Ga0075369_10542295 3300006186 Bacteria 555
161 Ga0075366_10190746 3300006195 Bacteria 1245
162 Ga0075366_10458168 3300006195 Bacteria 787
163 Ga0075366_10603288 3300006195 Bacteria 681
164 Ga0075366_10925427 3300006195 Unclassified 543
165 Ga0097621_100221887 3300006237 Bacteria 1647
166 Ga0097621_100380874 3300006237 Bacteria 1260
167 Ga0075370_10065600 3300006353 Bacteria 2071
168 Ga0075370_10084804 3300006353 Bacteria 1823
169 Ga0075370_10607770 3300006353 Bacteria 663
170 Ga0068871_100170449 3300006358 Bacteria 1865
171 Ga0068871_100684469 3300006358 Bacteria 938
172 Ga0068871_101419944 3300006358 Bacteria 655
173 Ga0068871_102079698 3300006358 Bacteria 541
174 Ga0075428_100198696 3300006844 Bacteria 2168
175 Ga0075430_100361515 3300006846 Bacteria 1198
176 Ga0075429_100895130 3300006880 Bacteria 777
177 Ga0068865_100015646 3300006881 Bacteria 4840
178 Ga0068865_100015863 3300006881 Bacteria 4809
179 Ga0097620_100280683 3300006931 Bacteria 1758
180 Ga0097620_100707955 3300006931 Bacteria 1098
181 Ga0099824_1016379 3300006942 Bacteria 6734
182 Ga0099822_1010465 3300006943 Bacteria 11499
183 Ga0099794_10030597 3300007265 Bacteria 2515
184 Ga0099794_10118048 3300007265 Bacteria 1333
185 Ga0099795_10039956 3300007788 Bacteria 1664
186 Ga0105250_10053691 3300009092 Bacteria 1617
187 Ga0105240_10091720 3300009093 Bacteria 3711
188 Ga0105240_10378040 3300009093 Bacteria 1600
189 Ga0105245_10110177 3300009098 Bacteria 2559
190 Ga0105245_10221653 3300009098 Unclassified 1825
191 Ga0105245_11289810 3300009098 Unclassified 779
192 Ga0105245_12357959 3300009098 Unclassified 586
193 Ga0105247_10036791 3300009101 Bacteria 2984
194 Ga0105247_10159265 3300009101 Bacteria 1493
195 Ga0105247_10222290 3300009101 Bacteria 1279
196 Ga0105247_11835775 3300009101 Bacteria 505
197 Ga0105247_11864501 3300009101 Bacteria 502
198 Ga0114129_10348854 3300009147 Bacteria 1961
199 Ga0114129_11196869 3300009147 Bacteria 947
200 Ga0105243_10521981 3300009148 Bacteria 1130
201 Ga0105243_10652601 3300009148 Bacteria 1020
202 Ga0105243_10804475 3300009148 Bacteria 927
203 Ga0105241_10567150 3300009174 Bacteria 1021
204 Ga0105242_10171157 3300009176 Bacteria 1909
205 Ga0105242_10318211 3300009176 Bacteria 1426
206 Ga0105242_10436980 3300009176 Bacteria 1230
207 Ga0105242_10485990 3300009176 Bacteria 1171
208 Ga0105242_10533897 3300009176 Bacteria 1122
209 Ga0105242_11278465 3300009176 Bacteria 756
210 Ga0105242_11683217 3300009176 Bacteria 670
211 Ga0105248_10120118 3300009177 Bacteria 2965
212 Ga0105248_10152637 3300009177 Bacteria 2606
213 Ga0105248_10490646 3300009177 Bacteria 1385
214 Ga0105248_10565011 3300009177 Bacteria 1283
215 Ga0105237_10000566 3300009545 Bacteria 51699
216 Ga0105237_10127309 3300009545 Bacteria 2541
217 Ga0105237_10273766 3300009545 Bacteria 1691
218 Ga0105237_10457655 3300009545 Bacteria 1282
219 Ga0105237_10551796 3300009545 Bacteria 1159
220 Ga0105237_11244117 3300009545 Bacteria 751
221 Ga0105237_11675086 3300009545 Bacteria 643
222 Ga0105238_10039519 3300009551 Bacteria 4785
223 Ga0105238_10294516 3300009551 Bacteria 1606
224 Ga0105238_10531089 3300009551 Bacteria 1180
225 Ga0105238_10836990 3300009551 Bacteria 937
226 Ga0105238_10984988 3300009551 Unclassified 864
227 Ga0105238_12203676 3300009551 Bacteria 586
228 Ga0105249_10222778 3300009553 Bacteria 1857
229 Ga0105249_10348490 3300009553 Bacteria 1500
230 Ga0105249_10487041 3300009553 Bacteria 1277
231 Ga0105249_10854786 3300009553 Bacteria 975
232 Ga0105249_10868368 3300009553 Bacteria 968
233 Ga0099796_10014801 3300010159 Bacteria 2263
234 Ga0099796_10028063 3300010159 Bacteria 1804
235 Ga0105239_10003024 3300010375 Bacteria 20955
236 Ga0105239_10046043 3300010375 Bacteria 4779
237 Ga0105239_10049095 3300010375 Bacteria 4627
238 Ga0105239_10123482 3300010375 Bacteria 2877
239 Ga0105239_10639571 3300010375 Bacteria 1215
240 Ga0105239_11087930 3300010375 Unclassified 920
241 Ga0105239_11273793 3300010375 Bacteria 848
242 Ga0105246_10023635 3300011119 Bacteria 3979
243 Ga0105246_10523978 3300011119 Bacteria 1011
244 Ga0157329_1008628 3300012491 Bacteria 765
245 Ga0157371_10245345 3300013102 Bacteria 1289
246 Ga0157370_10063762 3300013104 Bacteria 3490
247 Ga0157370_11219680 3300013104 Bacteria 678
248 Ga0157369_10384557 3300013105 Bacteria 1456
249 Ga0157374_10015024 3300013296 Bacteria 6787
250 Ga0157374_10018856 3300013296 Bacteria 6099
251 Ga0157374_10456828 3300013296 Unclassified 1279
252 Ga0157374_10593200 3300013296 Unclassified 1117
253 Ga0157374_11763577 3300013296 Bacteria 644
254 Ga0157378_10058003 3300013297 Bacteria 3452
255 Ga0157378_10139831 3300013297 Bacteria 2247
256 Ga0157378_10201674 3300013297 Bacteria 1882
257 Ga0157378_10791970 3300013297 Bacteria 973
258 Ga0157378_11167146 3300013297 Bacteria 809
259 Ga0157378_11210919 3300013297 Bacteria 795
260 Ga0157378_11630385 3300013297 Bacteria 691
261 Ga0163162_10077388 3300013306 Bacteria 3390
262 Ga0163162_10322662 3300013306 Bacteria 1677
263 Ga0163162_10526217 3300013306 Bacteria 1312
264 Ga0163162_10679283 3300013306 Bacteria 1152
265 Ga0157375_11038606 3300013308 Unclassified 958
266 Ga0157375_12342295 3300013308 Bacteria 637
267 Ga0163163_10072107 3300014325 Bacteria 3442
268 Ga0163163_10234525 3300014325 Bacteria 1884
269 Ga0157380_10070016 3300014326 Bacteria 2833
270 Ga0157380_11096939 3300014326 Unclassified 835
271 Ga0157380_11275269 3300014326 Bacteria 781
272 Ga0157377_10397842 3300014745 Unclassified 937
273 Ga0157379_10117931 3300014968 Bacteria 2388
274 Ga0157379_10240585 3300014968 Bacteria 1642
275 Ga0157379_10408345 3300014968 Bacteria 1249
276 Ga0157379_11035518 3300014968 Bacteria 784
277 Ga0157376_10135138 3300014969 Bacteria 2206
278 Ga0157376_10188169 3300014969 Bacteria 1891
279 Ga0157376_10198181 3300014969 Bacteria 1846
280 Ga0157376_10558887 3300014969 Bacteria 1133
281 Ga0157376_11411049 3300014969 Bacteria 728
282 Ga0163161_10163163 3300017792 Bacteria 1700
283 Ga0163161_10281378 3300017792 Bacteria 1305
284 Ga0163161_10420980 3300017792 Bacteria 1074
285 Ga0163161_11794362 3300017792 Bacteria 545
286 Ga0213874_10166035 3300021377 Bacteria 778
287 Ga0213876_10004264 3300021384 Bacteria 8019
288 Ga0209677_101499 3300025253 Bacteria 10019
289 Ga0209148_1014159 3300025254 Bacteria 1415
290 Ga0209455_1004722 3300025272 Bacteria 4379
291 Ga0209455_1011836 3300025272 Bacteria 2125
292 Ga0209758_1096250 3300025297 Bacteria 854
293 Ga0209758_1116128 3300025297 Bacteria 731
294 Ga0207697_10207690 3300025315 Bacteria 862
295 Ga0207697_10489217 3300025315 Bacteria 544
296 Ga0207656_10290569 3300025321 Bacteria 808
297 Ga0207692_10007547 3300025898 Bacteria 4458
298 Ga0207692_10066857 3300025898 Bacteria 1880
299 Ga0207692_10866737 3300025898 Bacteria 593
300 Ga0207688_10082256 3300025901 Bacteria 1840
301 Ga0207688_10088956 3300025901 Bacteria 1771
302 Ga0207688_10174704 3300025901 Bacteria 1279
303 Ga0207680_10309482 3300025903 Bacteria 1103
304 Ga0207699_10006212 3300025906 Bacteria 5765
305 Ga0207699_10290689 3300025906 Bacteria 1139
306 Ga0207645_10089854 3300025907 Bacteria 1975
307 Ga0207705_10163203 3300025909 Bacteria 1675
308 Ga0207684_10148293 3300025910 Bacteria 2018
309 Ga0207684_10768641 3300025910 Bacteria 816
310 Ga0207707_10007848 3300025912 Bacteria 9279
311 Ga0207707_10261221 3300025912 Bacteria 1502
312 Ga0207695_10061892 3300025913 Bacteria 3867
313 Ga0207671_10000685 3300025914 Bacteria 43842
314 Ga0207671_10105706 3300025914 Bacteria 2136
315 Ga0207671_10306337 3300025914 Bacteria 1255
316 Ga0207693_10053186 3300025915 Bacteria 3177
317 Ga0207663_10187804 3300025916 Bacteria 1481
318 Ga0207660_10128818 3300025917 Bacteria 1924
319 Ga0207660_10996924 3300025917 Bacteria 683
320 Ga0207662_10089860 3300025918 Bacteria 1887
321 Ga0207657_10767036 3300025919 Bacteria 747
322 Ga0207649_10208049 3300025920 Bacteria 1386
323 Ga0207649_10554061 3300025920 Bacteria 880
324 Ga0207649_11073147 3300025920 Bacteria 635
325 Ga0207652_10072910 3300025921 Bacteria 2986
326 Ga0207652_10398479 3300025921 Bacteria 1242
327 Ga0207652_10632802 3300025921 Bacteria 958
328 Ga0207652_10992049 3300025921 Bacteria 738
329 Ga0207646_10072743 3300025922 Bacteria 3070
330 Ga0207681_10361337 3300025923 Bacteria 1164
331 Ga0207681_10913796 3300025923 Unclassified 735
332 Ga0207694_10225237 3300025924 Bacteria 1530
333 Ga0207694_10458104 3300025924 Bacteria 1065
334 Ga0207694_11106664 3300025924 Unclassified 670
335 Ga0207659_10737245 3300025926 Bacteria 845
336 Ga0207659_10787786 3300025926 Bacteria 816
337 Ga0207687_10037144 3300025927 Bacteria 3321
338 Ga0207687_10135931 3300025927 Bacteria 1859
339 Ga0207687_10187383 3300025927 Unclassified 1607
340 Ga0207700_10098402 3300025928 Bacteria 2327
341 Ga0207664_10102009 3300025929 Bacteria 2372
342 Ga0207664_10414565 3300025929 Bacteria 1199
343 Ga0207644_10156509 3300025931 Bacteria 1768
344 Ga0207644_10258073 3300025931 Bacteria 1393
345 Ga0207644_10328994 3300025931 Bacteria 1237
346 Ga0207690_10243837 3300025932 Bacteria 1385
347 Ga0207690_10434793 3300025932 Bacteria 1052
348 Ga0207686_10355379 3300025934 Bacteria 1104
349 Ga0207686_10364710 3300025934 Bacteria 1091
350 Ga0207686_11470212 3300025934 Bacteria 561
351 Ga0207709_10485839 3300025935 Bacteria 961
352 Ga0207709_11002445 3300025935 Bacteria 683
353 Ga0207670_10827704 3300025936 Bacteria 772
354 Ga0207669_11089980 3300025937 Bacteria 674
355 Ga0207704_10087870 3300025938 Bacteria 2032
356 Ga0207665_10008127 3300025939 Bacteria 6925
357 Ga0207665_10079152 3300025939 Bacteria 2259
358 Ga0207665_10175480 3300025939 Bacteria 1550
359 Ga0207691_10460001 3300025940 Bacteria 1082
360 Ga0207691_11303429 3300025940 Unclassified 600
361 Ga0207711_10069916 3300025941 Bacteria 3044
362 Ga0207711_10331246 3300025941 Bacteria 1408
363 Ga0207711_10613006 3300025941 Bacteria 1015
364 Ga0207711_11446876 3300025941 Bacteria 630
365 Ga0207689_10131944 3300025942 Bacteria 2056
366 Ga0207689_10384064 3300025942 Unclassified 1169
367 Ga0207689_10944659 3300025942 Bacteria 727
368 Ga0207679_10308405 3300025945 Bacteria 1367
369 Ga0207667_10064174 3300025949 Bacteria 3835
370 Ga0207667_10219095 3300025949 Bacteria 1950
371 Ga0207667_10416841 3300025949 Bacteria 1366
372 Ga0207712_10368322 3300025961 Bacteria 1199
373 Ga0207668_10006793 3300025972 Bacteria 6776
374 Ga0207668_10334842 3300025972 Bacteria 1260
375 Ga0207668_10365668 3300025972 Bacteria 1210
376 Ga0207668_10399843 3300025972 Bacteria 1161
377 Ga0207668_11310617 3300025972 Bacteria 652
378 Ga0207640_10173309 3300025981 Bacteria 1610
379 Ga0207658_10064553 3300025986 Bacteria 2747
380 Ga0207658_10255791 3300025986 Bacteria 1490
381 Ga0207658_10630537 3300025986 Bacteria 965
382 Ga0207677_10265772 3300026023 Bacteria 1401
383 Ga0207677_10288953 3300026023 Bacteria 1349
384 Ga0207677_11560965 3300026023 Bacteria 611
385 Ga0207703_10347561 3300026035 Bacteria 1365
386 Ga0207703_10423445 3300026035 Bacteria 1239
387 Ga0207703_10829310 3300026035 Bacteria 884
388 Ga0207639_10500164 3300026041 Bacteria 1110
389 Ga0207639_10551737 3300026041 Bacteria 1058
390 Ga0207639_10693843 3300026041 Bacteria 944
391 Ga0207639_11262754 3300026041 Bacteria 693
392 Ga0207639_11375260 3300026041 Bacteria 663
393 Ga0207678_10019922 3300026067 Bacteria 5896
394 Ga0207678_10084297 3300026067 Bacteria 2718
395 Ga0207678_10486168 3300026067 Bacteria 1075
396 Ga0207678_10691531 3300026067 Bacteria 897
397 Ga0207678_11248405 3300026067 Bacteria 658
398 Ga0207678_12028538 3300026067 Bacteria 500
399 Ga0207708_10297098 3300026075 Bacteria 1313
400 Ga0207702_10340652 3300026078 Bacteria 1432
401 Ga0207641_11385104 3300026088 Bacteria 704
402 Ga0207648_10102732 3300026089 Bacteria 2506
403 Ga0207674_10938083 3300026116 Bacteria 834
404 Ga0207675_100598742 3300026118 Bacteria 1105
405 Ga0207675_100752505 3300026118 Bacteria 986
406 Ga0207683_10322513 3300026121 Bacteria 1415
407 Ga0207683_10831011 3300026121 Bacteria 857
408 Ga0207698_10204474 3300026142 Bacteria 1771
409 Ga0207698_10217906 3300026142 Bacteria 1722
410 Ga0207698_10768733 3300026142 Bacteria 963
411 Ga0209589_1000018 3300027357 Bacteria 192614
412 Ga0209489_100026 3300027361 Bacteria 192614
413 Ga0209700_100035 3300027363 Bacteria 192614
414 Ga0209179_1015705 3300027512 Bacteria 1410
415 Ga0209813_10372795 3300027866 Bacteria 570
416 Ga0268266_10001123 3300028379 Bacteria 33388
417 Ga0268266_10077416 3300028379 Bacteria 2891
418 Ga0268266_10126832 3300028379 Bacteria 2278
419 Ga0268266_10336402 3300028379 Bacteria 1416
420 Ga0268266_10693088 3300028379 Bacteria 981
421 Ga0268266_10908719 3300028379 Bacteria 851
422 Ga0268265_10109025 3300028380 Bacteria 2255
423 Ga0268265_10390311 3300028380 Bacteria 1283
424 Ga0268265_11133635 3300028380 Bacteria 777
425 Ga0268264_10867748 3300028381 Bacteria 904
426 Ga0268264_10949381 3300028381 Bacteria 865
427 Ga0268264_11023665 3300028381 Bacteria 833
428 Ga0268264_12657695 3300028381 Bacteria 505
429 Ga0265337_1012016 3300028556 Bacteria 2959
430 Ga0265326_10003911 3300028558 Bacteria 4833
431 Ga0265319_1015525 3300028563 Bacteria 2951
432 Ga0265334_10004551 3300028573 Bacteria 6147
433 Ga0265318_10012731 3300028577 Bacteria 3569
434 Ga0265323_10003131 3300028653 Bacteria 7368
435 Ga0265322_10013601 3300028654 Bacteria 2355
436 Ga0265336_10000682 3300028666 Bacteria 18331
437 Ga0307517_10000049 3300028786 Bacteria 160368
438 Ga0265338_10000746 3300028800 Bacteria 55415
439 Ga0265324_10003546 3300029957 Bacteria 7358
440 Ga0307511_10150555 3300030521 Bacteria 1337
441 Ga0307512_10403534 3300030522 Bacteria 573
442 Ga0265340_10330566 3300031247 Bacteria 674
443 Ga0307513_10229680 3300031456 Bacteria 1669
444 Ga0307509_10602566 3300031507 Bacteria 771
445 Ga0307408_100128444 3300031548 Bacteria 1974
446 Ga0307508_10015265 3300031616 Bacteria 6998
447 Ga0307508_10521514 3300031616 Bacteria 784
448 Ga0307516_10084080 3300031730 Bacteria 3022
449 Ga0307516_10092110 3300031730 Bacteria 2858
450 Ga0307405_10109285 3300031731 Bacteria 1870
451 Ga0307405_10235717 3300031731 Bacteria 1352
452 Ga0307405_10651883 3300031731 Bacteria 866
453 Ga0307413_10058086 3300031824 Bacteria 2369
454 Ga0307413_10457395 3300031824 Bacteria 1015
455 Ga0307410_10213194 3300031852 Bacteria 1481
456 Ga0307407_10057010 3300031903 Bacteria 2265
457 Ga0307407_10083033 3300031903 Bacteria 1943
458 Ga0307407_10473018 3300031903 Bacteria 914
459 Ga0307407_10473086 3300031903 Bacteria 914
460 Ga0307409_100088714 3300031995 Bacteria 2526
461 Ga0307409_100142021 3300031995 Bacteria 2070
462 Ga0307416_100251169 3300032002 Bacteria 1721
463 Ga0307416_100278749 3300032002 Bacteria 1647
464 Ga0307416_102091326 3300032002 Bacteria 668
465 Ga0307414_10255532 3300032004 Bacteria 1459
466 Ga0307415_100090429 3300032126 Bacteria 2214
467 Ga0307415_100201322 3300032126 Bacteria 1580
468 Ga0307415_100821696 3300032126 Bacteria 850
469 Ga0373929_0076363 3300035085 Bacteria 809
470 Ga0373949_0185693 3300035090 Bacteria 618
471 Ga0373932_0062813 3300035112 Bacteria 1133
472 Ga0373936_0131114 3300035113 Bacteria 1077
473 Ga0373936_0417555 3300035113 Bacteria 617
474 Ga0373939_0145567 3300035114 Bacteria 858
475 Ga0373941_0009681 3300035115 Bacteria 2433
476 Ga0373962_0259696 3300035242 Bacteria 605
477 Ga0373931_0019229 3300035691 Bacteria 3407
478 Ga0373927_0095380 3300035695 Bacteria 1933
479 Ga0373947_0052397 3300035725 Bacteria 2458
480 Ga0395905_0294629 3300037471 Bacteria 1509
481 Ga0395905_0465642 3300037471 Bacteria 1163
482 Ga0395901_0269383 3300038443 Bacteria 1772
483 Ga0436365_0389646 3300039437 Bacteria 8266
484 Ga0436365_1666383 3300039437 Bacteria 585
485 Ga0436360_0163864 3300039438 Bacteria 1040
486 Ga0436361_0751881 3300039447 Bacteria 1120
487 Ga0436363_1053383 3300039450 Bacteria 2129
488 Ga0436363_1201407 3300039450 Bacteria 623
489 Ga0436362_0521923 3300039453 Bacteria 2820
490 Ga0439465_0099736 3300041413 Bacteria 1002
491 Ga0451787_264371 3300041441 Bacteria 536
492 Ga0451791_1845783 3300041451 Bacteria 595
493 Ga0451793_0611641 3300041452 Bacteria 640
494 Ga0451793_0652203 3300041452 Bacteria 877
495 Ga0451793_1861028 3300041452 Bacteria 527
496 Ga0451797_0448406 3300041453 Bacteria 731
497 Ga0451807_2355999 3300041486 Bacteria 1087
498 Ga0451833_1277664 3300041491 Bacteria 860
499 Ga0451837_0723789 3300041494 Bacteria 525
500 Ga0451839_1001220 3300041496 Bacteria 901
501 Ga0451839_1236673 3300041496 Bacteria 599
502 Ga0451849_0456939 3300041505 Bacteria 719
503 Ga0451853_1005459 3300041512 Bacteria 1640
504 Ga0451853_1454072 3300041512 Bacteria 1203
505 Ga0466972_0467680 3300044658 Bacteria 593
506 Ga0466957_0430598 3300044842 Bacteria 906
507 Ga0466960_0025989 3300044901 Bacteria 2655
508 Ga0495617_069026 3300046452 Bacteria 1163
509 Ga0495629_0244853 3300046459 Bacteria 1234
510 Ga0495629_0251190 3300046459 Bacteria 1217
511 Ga0495651_0084133 3300046462 Bacteria 2398
512 Ga0495651_0857433 3300046462 Bacteria 558
513 Ga0495650_0080609 3300046471 Bacteria 1256
514 Ga0495639_0310016 3300046475 Bacteria 788
515 Ga0495584_0204930 3300046491 Bacteria 1002
516 Ga0495585_0259422 3300046492 Bacteria 865
517 Ga0495585_0321954 3300046492 Bacteria 756
518 Ga0495594_0570545 3300046499 Bacteria 642
519 Ga0495606_0263716 3300046507 Bacteria 950
520 Ga0495632_0126916 3300046519 Bacteria 1189
521 Ga0495632_0135043 3300046519 Bacteria 1147
522 Ga0495648_0063304 3300046524 Bacteria 2185
523 Ga0495663_0049585 3300046525 Bacteria 1297
524 Ga0495663_0350253 3300046525 Bacteria 538
525 Ga0495652_0347375 3300046529 Bacteria 1064
526 Ga0495598_0072986 3300046537 Bacteria 1085
527 Ga0495598_0165195 3300046537 Bacteria 781
528 Ga0495633_0097324 3300046558 Bacteria 1367
529 Ga0495667_0460399 3300046559 Bacteria 799
530 Ga0495656_0039644 3300046615 Bacteria 1958
531 Ga0495656_0219586 3300046615 Bacteria 950
532 Ga0495668_0054172 3300046616 Bacteria 2218
533 Ga0495668_0587423 3300046616 Bacteria 615
534 Ga0495668_0676632 3300046616 Bacteria 571
535 Ga0495611_0082562 3300046648 Bacteria 1479
536 Ga0495625_0242062 3300046660 Bacteria 1174
537 Ga0495625_0291570 3300046660 Bacteria 1047
538 Ga0495625_0395999 3300046660 Bacteria 864
539 Ga0495625_0643517 3300046660 Bacteria 632
540 Ga0495635_1023639 3300046663 Unclassified 525
541 Ga0495659_0009483 3300046664 Bacteria 3108
542 Ga0495669_0298863 3300046684 Bacteria 776
543 Ga0495671_0144294 3300046692 Bacteria 1160
544 Ga0495649_0148681 3300046694 Bacteria 1231
545 Ga0495649_0486543 3300046694 Bacteria 614
546 Ga0495600_0074137 3300046809 Bacteria 2222
547 Ga0495600_0328383 3300046809 Bacteria 961
548 Ga0495581_0243894 3300047315 Bacteria 1051
549 Ga0495636_0069328 3300047318 Bacteria 1503
550 Ga0495672_0027021 3300047320 Bacteria 3653
551 Ga0495676_0891744 3300047321 Bacteria 570
552 Ga0495683_0112157 3300047323 Bacteria 1301
553 Ga0495673_0078605 3300047469 Bacteria 1371
554 Ga0495673_0120641 3300047469 Bacteria 1039
555 Ga0495686_0034288 3300047472 Bacteria 3270
556 Ga0495686_0075473 3300047472 Bacteria 2067
557 Ga0495686_0177199 3300047472 Bacteria 1237
558 Ga0495593_0226954 3300047673 Bacteria 937
559 Ga0496100_0039218 3300048903 Bacteria 3007
560 Ga0496100_0130381 3300048903 Bacteria 1770
561 Ga0496100_0134357 3300048903 Bacteria 1746
562 Ga0496101_0011635 3300048904 Bacteria 5845
563 Ga0496101_0152365 3300048904 Bacteria 1769
564 Ga0496101_0349023 3300048904 Bacteria 1163
565 Ga0496102_0053475 3300048905 Bacteria 3680
566 Ga0496102_0662823 3300048905 Bacteria 966
567 Ga0496102_1477540 3300048905 Bacteria 598
568 Ga0496103_0045723 3300048906 Bacteria 2701
569 Ga0496103_0300451 3300048906 Bacteria 1033
570 Ga0496103_0391944 3300048906 Bacteria 892
571 Ga0496104_0003279 3300048907 Bacteria 13962
572 Ga0496104_0337679 3300048907 Bacteria 1419
573 Ga0496105_0167493 3300048908 Bacteria 1802
574 Ga0496105_0263448 3300048908 Bacteria 1393
575 Ga0496106_0049488 3300048909 Bacteria 3166
576 Ga0496106_0333162 3300048909 Bacteria 1219
577 Ga0496107_0012368 3300048910 Bacteria 5957
578 Ga0496107_0049952 3300048910 Bacteria 3014
579 Ga0496107_0076424 3300048910 Bacteria 2439
580 Ga0496107_0110515 3300048910 Bacteria 2020
581 Ga0496108_0041868 3300048911 Bacteria 3824
582 Ga0496108_0085246 3300048911 Bacteria 2681
583 Ga0496108_0623707 3300048911 Bacteria 939
584 Ga0496109_0024908 3300048912 Bacteria 5326
585 Ga0496109_0124503 3300048912 Bacteria 2403
586 Ga0496110_0010433 3300048913 Bacteria 7554
587 Ga0496110_0451974 3300048913 Bacteria 1171
588 Ga0496111_0039485 3300048914 Bacteria 3384
589 Ga0496111_0074157 3300048914 Bacteria 2478
590 Ga0496112_0038622 3300048915 Bacteria 4662
591 Ga0496112_0083541 3300048915 Bacteria 3158
592 Ga0496112_0400052 3300048915 Bacteria 1313
593 Ga0496113_0191687 3300048916 Bacteria 1622
594 Ga0496113_0346574 3300048916 Bacteria 1191
595 Ga0496114_0060321 3300048917 Bacteria 3170
596 Ga0496114_0114228 3300048917 Bacteria 2315
597 Ga0496115_0006328 3300048918 Bacteria 8667
598 Ga0496117_0045663 3300048920 Bacteria 3161
599 Ga0496117_0141635 3300048920 Bacteria 1439
600 Ga0496118_0013338 3300048921 Bacteria 7782
601 Ga0496118_0117599 3300048921 Bacteria 1743
602 Ga0496119_0048564 3300048922 Bacteria 2631
603 Ga0496119_0157055 3300048922 Bacteria 1213
604 Ga0496121_0001712 3300048924 Bacteria 35901
605 Ga0496121_0019695 3300048924 Bacteria 6731
606 Ga0496121_0093667 3300048924 Bacteria 2338
607 Ga0496121_0106570 3300048924 Bacteria 2148
608 Ga0496121_0131049 3300048924 Bacteria 1876
609 Ga0496121_0439200 3300048924 Bacteria 844
610 Ga0496121_0566214 3300048924 Bacteria 708
611 Ga0496121_0599306 3300048924 Bacteria 680
612 Ga0496122_0030050 3300048925 Bacteria 4563
613 Ga0496123_0421852 3300048926 Bacteria 601
614 Ga0496124_0109399 3300048927 Bacteria 2227
615 Ga0496125_0000829 3300048928 Bacteria 49885
616 Ga0496125_0055540 3300048928 Bacteria 3225
617 Ga0496125_0093938 3300048928 Bacteria 2236
618 Ga0496125_0110381 3300048928 Bacteria 1994
619 Ga0496126_0021983 3300048929 Bacteria 6218
620 Ga0496126_0037495 3300048929 Bacteria 4522
621 Ga0496126_0096968 3300048929 Bacteria 2584
622 Ga0496126_0113297 3300048929 Bacteria 2361
623 Ga0496126_0169427 3300048929 Bacteria 1861
624 Ga0496126_0240146 3300048929 Bacteria 1514
625 Ga0496126_0265204 3300048929 Bacteria 1427
626 Ga0496126_0327347 3300048929 Bacteria 1258
627 Ga0496126_0923680 3300048929 Bacteria 660
628 Ga0501038_0309481 3300049574 Bacteria 1238
629 Ga0501042_0283672 3300049578 Bacteria 1196
630 Ga0501048_0329366 3300049582 Bacteria 1088
631 Ga0501069_0420938 3300049585 Bacteria 792
632 Ga0501071_0243942 3300049587 Bacteria 1355
633 Ga0501072_0853078 3300049588 Bacteria 712
634 Ga0501076_0485485 3300049592 Bacteria 1018
635 Ga0501080_0531216 3300049742 Bacteria 1049
636 nmdc:mga00v17_194113_c1 3300050491 Bacteria 1312
637 nmdc:mga0yw44_10617_c1 3300050492 Bacteria 4714
638 nmdc:mga0yw44_155526_c1 3300050492 Bacteria 1494
639 nmdc:mga0yw44_187118_c1 3300050492 Bacteria 1365
640 nmdc:mga0yw44_234567_c1 3300050492 Bacteria 1218
641 nmdc:mga0yw44_80883_c1 3300050492 Bacteria 2036
642 nmdc:mga0yw44_94643_c1 3300050492 Bacteria 1894
643 nmdc:mga0k408_169702_c1 3300050493 Bacteria 1300
644 nmdc:mga0k408_406579_c1 3300050493 Bacteria 810
645 nmdc:mga0k408_438488_c1 3300050493 Bacteria 776
646 nmdc:mga06z11_13395_c1 3300050494 Bacteria 3600
647 nmdc:mga06z11_147113_c1 3300050494 Bacteria 1336
648 nmdc:mga06z11_22300_c1 3300050494 Bacteria 2955
649 nmdc:mga06z11_245631_c1 3300050494 Bacteria 1052
650 nmdc:mga06z11_332388_c1 3300050494 Bacteria 908
651 nmdc:mga04h51_203726_c1 3300050495 Bacteria 778
652 nmdc:mga04h51_538443_c1 3300050495 Bacteria 502
653 nmdc:mga07m45_114626_c1 3300050496 Bacteria 1249
654 nmdc:mga07m45_255578_c1 3300050496 Bacteria 1019
655 nmdc:mga07m45_363804_c1 3300050496 Bacteria 840
656 nmdc:mga07m45_46697_c2 3300050496 Bacteria 1990
657 nmdc:mga07m45_53230_c1 3300050496 Bacteria 2286
658 nmdc:mga05p37_1589260_c1 3300050507 Bacteria 645
659 nmdc:mga05p37_624786_c1 3300050507 Bacteria 1211
660 nmdc:mga0qj67_445629_c1 3300050509 Bacteria 1043
661 nmdc:mga08y16_267877_c1 3300050511 Bacteria 1764
662 nmdc:mga0sz30_128678_c1 3300050516 Bacteria 1115
663 nmdc:mga0sz30_43629_c1 3300050516 Bacteria 1888
664 nmdc:mga0sz30_553426_c1 3300050516 Bacteria 519
665 nmdc:mga0sz30_568426_c1 3300050516 Bacteria 512
666 Ga0495655_0376117 3300053083 Bacteria 501
667 Ga0495619_0685712 3300053085 Bacteria 697
668 Ga0500646_0092872 3300053090 Unclassified 937
669 Ga0500651_0057887 3300053093 Bacteria 2424
670 Ga0500651_0093144 3300053093 Bacteria 1853
671 Ga0500566_0000268 3300053094 Bacteria 27976
672 Ga0500566_0001603 3300053094 Bacteria 13315
673 Ga0500566_0009612 3300053094 Bacteria 5715
674 Ga0500640_017117 3300053095 Bacteria 3070
675 Ga0500641_0009104 3300053096 Bacteria 3561
676 Ga0500641_0015942 3300053096 Bacteria 2794
677 Ga0500554_006947 3300053102 Bacteria 2575
678 Ga0500554_116400 3300053102 Bacteria 900
679 Ga0500572_000600 3300053111 Bacteria 12129
680 Ga0500591_127434 3300053115 Bacteria 1033
681 Ga0500592_013538 3300053116 Bacteria 1308
682 Ga0500594_0024635 3300053118 Bacteria 1535
683 Ga0500595_000469 3300053119 Bacteria 24960
684 Ga0500595_000641 3300053119 Bacteria 20993
685 Ga0500595_001479 3300053119 Bacteria 12486
686 Ga0500595_007549 3300053119 Bacteria 4507
687 Ga0500595_031521 3300053119 Bacteria 1778
688 Ga0500608_021616 3300053122 Bacteria 2975
689 Ga0500614_009050 3300053123 Bacteria 2120
690 Ga0500642_0028850 3300053130 Bacteria 2293
691 Ga0500658_0044067 3300053134 Bacteria 1799
692 Ga0500559_0002022 3300053136 Bacteria 10855
693 Ga0500559_0105817 3300053136 Bacteria 1300
694 Ga0500559_0202942 3300053136 Bacteria 935
695 Ga0500568_0053609 3300053139 Bacteria 1580
696 Ga0500568_0138609 3300053139 Unclassified 902
697 Ga0500588_0057594 3300053146 Bacteria 1234
698 Ga0500589_108591 3300053147 Bacteria 1193
699 Ga0500603_003061 3300053150 Bacteria 3609
700 Ga0500604_0018339 3300053151 Bacteria 1949
701 Ga0500627_0021452 3300053158 Bacteria 2607
702 Ga0500627_0344570 3300053158 Bacteria 644
703 Ga0500630_060055 3300053159 Bacteria 1818
704 Ga0500634_0046931 3300053161 Bacteria 2333
705 Ga0500638_003446 3300053162 Bacteria 5853
706 Ga0500638_021174 3300053162 Bacteria 3069
707 Ga0500638_160345 3300053162 Bacteria 991
708 Ga0500636_0016159 3300053177 Bacteria 4401
709 Ga0500636_0407734 3300053177 Bacteria 628
710 Ga0500637_0000107 3300053178 Bacteria 29902
711 Ga0500637_0000471 3300053178 Bacteria 15567
712 Ga0500637_0113766 3300053178 Bacteria 1569
713 Ga0500576_136584 3300053725 Bacteria 940
714 Ga0500609_044835 3300053731 Bacteria 612
715 Ga0500596_002662 3300053735 Bacteria 3503
716 Ga0500661_000845 3300055283 Bacteria 5707
717 Ga0500661_006921 3300055283 Bacteria 2104
718 Ga0501082_0000077 3300060353 Bacteria 72496
719 2513673185 2513237098 Bacteria 9902361
720 2513695420 2513237101 Bacteria 7952346
721 2524466136 2524023210 Bacteria 9029266
722 2723843810 2721755755 Bacteria 8322773
723 2728749508 2728368998 Bacteria 8720350
724 2793079355
725 2874612208 2874604998 Bacteria 7834745
726 2885390099 2885383462 Bacteria 9473874
727 2889041989 2889033259 Bacteria 9099371
728 2903776809 2903768456 Bacteria 9749579
729 2908744448 2908739725 Bacteria 8628932
730 2908762087 2908756301 Bacteria 8864324
731 8006964977 8006964411 Bacteria 8966052
732 8006991624 8006984368 Bacteria 9651211
733 8056679886 8056673599 Bacteria 7871253
734 8056685279 8056681323 Bacteria 8472857
735 8056691719 8056689827 Bacteria 6712655
736 Ga0496121_0288454
737 SwRhRL2b_contig_3053350
738 MBSR1b_contig_5204513
739 JGI24034J26672_10077356
740 rootH1_10290882
741 Ga0065704_10185589
742 Ga0065715_10235951
743 Ga0065707_10133418
744 Ga0070690_100442878
745 Ga0070670_101739860
746 Ga0068869_100056441
747 Ga0068869_100205915
748 Ga0068869_100272919
749 Ga0068869_100988892
750 Ga0070680_100115364
751 Ga0070682_101003563
752 Ga0068868_100043625
753 Ga0068868_100201117
754 Ga0068868_101780399
755 Ga0070660_100908860
756 Ga0070689_101100489
757 Ga0070689_101451526
758 Ga0070691_10192006
759 Ga0070687_100063446
760 Ga0070668_100194520
761 Ga0070668_100391120
762 Ga0070668_100759599
763 Ga0070669_100123261
764 Ga0070669_100323367
765 Ga0070675_101042371
766 Ga0070671_100247964
767 Ga0070671_100632426
768 Ga0070674_100585906
769 Ga0070688_100032819
770 Ga0070688_100117989
771 Ga0070688_100341253
772 Ga0070659_100101152
773 Ga0070659_100404328
774 Ga0070667_100424885
775 Ga0070703_10108314
776 Ga0070709_10008109
777 Ga0070714_100013597
778 Ga0070714_100197987
779 Ga0070713_100044621
780 Ga0070713_100121195
781 Ga0070710_10062544
782 Ga0070711_100009820
783 Ga0070700_100207417
784 Ga0070700_100633891
785 Ga0070694_100375435
786 Ga0070694_101493777
787 Ga0070663_100124763
788 Ga0070663_100178074
789 Ga0070663_100279256
790 Ga0070678_100102488
791 Ga0070678_100891803
792 Ga0070662_100249291
793 Ga0070681_10024583
794 Ga0070681_10856352
795 Ga0070685_10206953
796 Ga0070685_10284573
797 Ga0070706_100047855
798 Ga0070706_100972628
799 Ga0070706_101648161
800 Ga0070707_100135061
801 Ga0070699_100127985
802 Ga0070699_101716567
803 Ga0070679_100023471
804 Ga0070679_100487535
805 Ga0070679_100844809
806 Ga0070679_101571072
807 Ga0070684_100079296
808 Ga0070697_100177041
809 Ga0070697_101249952
810 Ga0068853_100170748
811 Ga0068853_100539006
812 Ga0068853_100630073
813 Ga0068853_100787757
814 Ga0068853_101040236
815 Ga0068853_101566993
816 Ga0068853_102263097
817 Ga0070672_100043911
818 Ga0070672_100455845
819 Ga0070672_101645093
820 Ga0070686_100251900
821 Ga0070695_100114281
822 Ga0070696_100251566
823 Ga0070665_100087698
824 Ga0070665_100094628
825 Ga0070665_100179920
826 Ga0070665_100203444
827 Ga0070665_100771401
828 Ga0070665_100778876
829 Ga0068855_100105834
830 Ga0068855_100152374
831 Ga0070664_100337912
832 Ga0068857_100978604
833 Ga0068854_100259829
834 Ga0068854_100377813
835 Ga0068856_100073432
836 Ga0068856_100205094
837 Ga0068856_100305717
838 Ga0068856_101073319
839 Ga0070702_100236070
840 Ga0070702_100293931
841 Ga0068852_100082137
842 Ga0068852_100082162
843 Ga0068859_100280689
844 Ga0068859_100707978
845 Ga0068864_100081180
846 Ga0068861_100326211
847 Ga0068861_100894176
848 Ga0068851_10599684
849 Ga0068863_100201719
850 Ga0068858_100036406
851 Ga0068858_100084146
852 Ga0068858_100716369
853 Ga0068858_101416528
854 Ga0068858_101599324
855 Ga0068860_100198940
856 Ga0068860_100513403
857 Ga0068860_100852982
858 Ga0068860_101029868
859 Ga0068860_101168282
860 Ga0068862_100347946
861 Ga0068862_100366878
862 Ga0068862_100669893
863 Ga0068862_101133131
864 Ga0068862_101189311
865 Ga0081455_10004004
866 Ga0081455_10441211
867 Ga0081538_10031049
868 Ga0081540_1038542
869 Ga0081540_1177378
870 Ga0070717_10033555
871 Ga0070717_10399459
872 Ga0075365_10032990
873 Ga0075365_10144681
874 Ga0075365_10152967
875 Ga0075365_10185457
876 Ga0075365_10602464
877 Ga0075365_10866403
878 Ga0075365_10945206
879 Ga0075363_100153996
880 Ga0075364_10008875
881 Ga0075364_10624181
882 Ga0075364_11021780
883 Ga0070716_100082019
884 Ga0070716_100116548
885 Ga0070716_100335820
886 Ga0070712_100271431
887 Ga0075362_10079633
888 Ga0075367_10062725
889 Ga0075367_10065499
890 Ga0075367_10196986
891 Ga0075367_10428690
892 Ga0075369_10043753
893 Ga0075369_10047159
894 Ga0075369_10283766
895 Ga0075369_10542295
896 Ga0075366_10190746
897 Ga0075366_10458168
898 Ga0075366_10603288
899 Ga0075366_10925427
900 Ga0097621_100221887
901 Ga0097621_100380874
902 Ga0075370_10065600
903 Ga0075370_10084804
904 Ga0075370_10607770
905 Ga0068871_100170449
906 Ga0068871_100684469
907 Ga0068871_101419944
908 Ga0068871_102079698
909 Ga0075428_100198696
910 Ga0075430_100361515
911 Ga0075429_100895130
912 Ga0068865_100015646
913 Ga0068865_100015863
914 Ga0097620_100280683
915 Ga0097620_100707955
916 Ga0099824_1016379
917 Ga0099822_1010465
918 Ga0099794_10030597
919 Ga0099794_10118048
920 Ga0099795_10039956
921 Ga0105250_10053691
922 Ga0105240_10091720
923 Ga0105240_10378040
924 Ga0105245_10110177
925 Ga0105245_10221653
926 Ga0105245_11289810
927 Ga0105245_12357959
928 Ga0105247_10036791
929 Ga0105247_10159265
930 Ga0105247_10222290
931 Ga0105247_11835775
932 Ga0105247_11864501
933 Ga0114129_10348854
934 Ga0114129_11196869
935 Ga0105243_10521981
936 Ga0105243_10652601
937 Ga0105243_10804475
938 Ga0105241_10567150
939 Ga0105242_10171157
940 Ga0105242_10318211
941 Ga0105242_10436980
942 Ga0105242_10485990
943 Ga0105242_10533897
944 Ga0105242_11278465
945 Ga0105242_11683217
946 Ga0105248_10120118
947 Ga0105248_10152637
948 Ga0105248_10490646
949 Ga0105248_10565011
950 Ga0105237_10000566
951 Ga0105237_10127309
952 Ga0105237_10273766
953 Ga0105237_10457655
954 Ga0105237_10551796
955 Ga0105237_11244117
956 Ga0105237_11675086
957 Ga0105238_10039519
958 Ga0105238_10294516
959 Ga0105238_10531089
960 Ga0105238_10836990
961 Ga0105238_10984988
962 Ga0105238_12203676
963 Ga0105249_10222778
964 Ga0105249_10348490
965 Ga0105249_10487041
966 Ga0105249_10854786
967 Ga0105249_10868368
968 Ga0099796_10014801
969 Ga0099796_10028063
970 Ga0105239_10003024
971 Ga0105239_10046043
972 Ga0105239_10049095
973 Ga0105239_10123482
974 Ga0105239_10639571
975 Ga0105239_11087930
976 Ga0105239_11273793
977 Ga0105246_10023635
978 Ga0105246_10523978
979 Ga0157329_1008628
980 Ga0157371_10245345
981 Ga0157370_10063762
982 Ga0157370_11219680
983 Ga0157369_10384557
984 Ga0157374_10015024
985 Ga0157374_10018856
986 Ga0157374_10456828
987 Ga0157374_10593200
988 Ga0157374_11763577
989 Ga0157378_10058003
990 Ga0157378_10139831
991 Ga0157378_10201674
992 Ga0157378_10791970
993 Ga0157378_11167146
994 Ga0157378_11210919
995 Ga0157378_11630385
996 Ga0163162_10077388
997 Ga0163162_10322662
998 Ga0163162_10526217
999 Ga0163162_10679283
1000 Ga0157375_11038606
1001 Ga0157375_12342295
1002 Ga0163163_10072107
1003 Ga0163163_10234525
1004 Ga0157380_10070016
1005 Ga0157380_11096939
1006 Ga0157380_11275269
1007 Ga0157377_10397842
1008 Ga0157379_10117931
1009 Ga0157379_10240585
1010 Ga0157379_10408345
1011 Ga0157379_11035518
1012 Ga0157376_10135138
1013 Ga0157376_10188169
1014 Ga0157376_10198181
1015 Ga0157376_10558887
1016 Ga0157376_11411049
1017 Ga0163161_10163163
1018 Ga0163161_10281378
1019 Ga0163161_10420980
1020 Ga0163161_11794362
1021 Ga0213874_10166035
1022 Ga0213876_10004264
1023 Ga0209677_101499
1024 Ga0209148_1014159
1025 Ga0209455_1004722
1026 Ga0209455_1011836
1027 Ga0209758_1096250
1028 Ga0209758_1116128
1029 Ga0207697_10207690
1030 Ga0207697_10489217
1031 Ga0207656_10290569
1032 Ga0207692_10007547
1033 Ga0207692_10066857
1034 Ga0207692_10866737
1035 Ga0207688_10082256
1036 Ga0207688_10088956
1037 Ga0207688_10174704
1038 Ga0207680_10309482
1039 Ga0207699_10006212
1040 Ga0207699_10290689
1041 Ga0207645_10089854
1042 Ga0207705_10163203
1043 Ga0207684_10148293
1044 Ga0207684_10768641
1045 Ga0207707_10007848
1046 Ga0207707_10261221
1047 Ga0207695_10061892
1048 Ga0207671_10000685
1049 Ga0207671_10105706
1050 Ga0207671_10306337
1051 Ga0207693_10053186
1052 Ga0207663_10187804
1053 Ga0207660_10128818
1054 Ga0207660_10996924
1055 Ga0207662_10089860
1056 Ga0207657_10767036
1057 Ga0207649_10208049
1058 Ga0207649_10554061
1059 Ga0207649_11073147
1060 Ga0207652_10072910
1061 Ga0207652_10398479
1062 Ga0207652_10632802
1063 Ga0207652_10992049
1064 Ga0207646_10072743
1065 Ga0207681_10361337
1066 Ga0207681_10913796
1067 Ga0207694_10225237
1068 Ga0207694_10458104
1069 Ga0207694_11106664
1070 Ga0207659_10737245
1071 Ga0207659_10787786
1072 Ga0207687_10037144
1073 Ga0207687_10135931
1074 Ga0207687_10187383
1075 Ga0207700_10098402
1076 Ga0207664_10102009
1077 Ga0207664_10414565
1078 Ga0207644_10156509
1079 Ga0207644_10258073
1080 Ga0207644_10328994
1081 Ga0207690_10243837
1082 Ga0207690_10434793
1083 Ga0207686_10355379
1084 Ga0207686_10364710
1085 Ga0207686_11470212
1086 Ga0207709_10485839
1087 Ga0207709_11002445
1088 Ga0207670_10827704
1089 Ga0207669_11089980
1090 Ga0207704_10087870
1091 Ga0207665_10008127
1092 Ga0207665_10079152
1093 Ga0207665_10175480
1094 Ga0207691_10460001
1095 Ga0207691_11303429
1096 Ga0207711_10069916
1097 Ga0207711_10331246
1098 Ga0207711_10613006
1099 Ga0207711_11446876
1100 Ga0207689_10131944
1101 Ga0207689_10384064
1102 Ga0207689_10944659
1103 Ga0207679_10308405
1104 Ga0207667_10064174
1105 Ga0207667_10219095
1106 Ga0207667_10416841
1107 Ga0207712_10368322
1108 Ga0207668_10006793
1109 Ga0207668_10334842
1110 Ga0207668_10365668
1111 Ga0207668_10399843
1112 Ga0207668_11310617
1113 Ga0207640_10173309
1114 Ga0207658_10064553
1115 Ga0207658_10255791
1116 Ga0207658_10630537
1117 Ga0207677_10265772
1118 Ga0207677_10288953
1119 Ga0207677_11560965
1120 Ga0207703_10347561
1121 Ga0207703_10423445
1122 Ga0207703_10829310
1123 Ga0207639_10500164
1124 Ga0207639_10551737
1125 Ga0207639_10693843
1126 Ga0207639_11262754
1127 Ga0207639_11375260
1128 Ga0207678_10019922
1129 Ga0207678_10084297
1130 Ga0207678_10486168
1131 Ga0207678_10691531
1132 Ga0207678_11248405
1133 Ga0207678_12028538
1134 Ga0207708_10297098
1135 Ga0207702_10340652
1136 Ga0207641_11385104
1137 Ga0207648_10102732
1138 Ga0207674_10938083
1139 Ga0207675_100598742
1140 Ga0207675_100752505
1141 Ga0207683_10322513
1142 Ga0207683_10831011
1143 Ga0207698_10204474
1144 Ga0207698_10217906
1145 Ga0207698_10768733
1146 Ga0209589_1000018
1147 Ga0209489_100026
1148 Ga0209700_100035
1149 Ga0209179_1015705
1150 Ga0209813_10372795
1151 Ga0268266_10001123
1152 Ga0268266_10077416
1153 Ga0268266_10126832
1154 Ga0268266_10336402
1155 Ga0268266_10693088
1156 Ga0268266_10908719
1157 Ga0268265_10109025
1158 Ga0268265_10390311
1159 Ga0268265_11133635
1160 Ga0268264_10867748
1161 Ga0268264_10949381
1162 Ga0268264_11023665
1163 Ga0268264_12657695
1164 Ga0265337_1012016
1165 Ga0265326_10003911
1166 Ga0265319_1015525
1167 Ga0265334_10004551
1168 Ga0265318_10012731
1169 Ga0265323_10003131
1170 Ga0265322_10013601
1171 Ga0265336_10000682
1172 Ga0307517_10000049
1173 Ga0265338_10000746
1174 Ga0265324_10003546
1175 Ga0307511_10150555
1176 Ga0307512_10403534
1177 Ga0265340_10330566
1178 Ga0307513_10229680
1179 Ga0307509_10602566
1180 Ga0307408_100128444
1181 Ga0307508_10015265
1182 Ga0307508_10521514
1183 Ga0307516_10084080
1184 Ga0307516_10092110
1185 Ga0307405_10109285
1186 Ga0307405_10235717
1187 Ga0307405_10651883
1188 Ga0307413_10058086
1189 Ga0307413_10457395
1190 Ga0307410_10213194
1191 Ga0307407_10057010
1192 Ga0307407_10083033
1193 Ga0307407_10473018
1194 Ga0307407_10473086
1195 Ga0307409_100088714
1196 Ga0307409_100142021
1197 Ga0307416_100251169
1198 Ga0307416_100278749
1199 Ga0307416_102091326
1200 Ga0307414_10255532
1201 Ga0307415_100090429
1202 Ga0307415_100201322
1203 Ga0307415_100821696
1204 Ga0373929_0076363
1205 Ga0373949_0185693
1206 Ga0373932_0062813
1207 Ga0373936_0131114
1208 Ga0373936_0417555
1209 Ga0373939_0145567
1210 Ga0373941_0009681
1211 Ga0373962_0259696
1212 Ga0373931_0019229
1213 Ga0373927_0095380
1214 Ga0373947_0052397
1215 Ga0395905_0294629
1216 Ga0395905_0465642
1217 Ga0395901_0269383
1218 Ga0436365_0389646
1219 Ga0436365_1666383
1220 Ga0436360_0163864
1221 Ga0436361_0751881
1222 Ga0436363_1053383
1223 Ga0436363_1201407
1224 Ga0436362_0521923
1225 Ga0439465_0099736
1226 Ga0451787_264371
1227 Ga0451791_1845783
1228 Ga0451793_0611641
1229 Ga0451793_0652203
1230 Ga0451793_1861028
1231 Ga0451797_0448406
1232 Ga0451807_2355999
1233 Ga0451833_1277664
1234 Ga0451837_0723789
1235 Ga0451839_1001220
1236 Ga0451839_1236673
1237 Ga0451849_0456939
1238 Ga0451853_1005459
1239 Ga0451853_1454072
1240 Ga0466972_0467680
1241 Ga0466957_0430598
1242 Ga0466960_0025989
1243 Ga0495617_069026
1244 Ga0495629_0244853
1245 Ga0495629_0251190
1246 Ga0495651_0084133
1247 Ga0495651_0857433
1248 Ga0495650_0080609
1249 Ga0495639_0310016
1250 Ga0495584_0204930
1251 Ga0495585_0259422
1252 Ga0495585_0321954
1253 Ga0495594_0570545
1254 Ga0495606_0263716
1255 Ga0495632_0126916
1256 Ga0495632_0135043
1257 Ga0495648_0063304
1258 Ga0495663_0049585
1259 Ga0495663_0350253
1260 Ga0495652_0347375
1261 Ga0495598_0072986
1262 Ga0495598_0165195
1263 Ga0495633_0097324
1264 Ga0495667_0460399
1265 Ga0495656_0039644
1266 Ga0495656_0219586
1267 Ga0495668_0054172
1268 Ga0495668_0587423
1269 Ga0495668_0676632
1270 Ga0495611_0082562
1271 Ga0495625_0242062
1272 Ga0495625_0291570
1273 Ga0495625_0395999
1274 Ga0495625_0643517
1275 Ga0495635_1023639
1276 Ga0495659_0009483
1277 Ga0495669_0298863
1278 Ga0495671_0144294
1279 Ga0495649_0148681
1280 Ga0495649_0486543
1281 Ga0495600_0074137
1282 Ga0495600_0328383
1283 Ga0495581_0243894
1284 Ga0495636_0069328
1285 Ga0495672_0027021
1286 Ga0495676_0891744
1287 Ga0495683_0112157
1288 Ga0495673_0078605
1289 Ga0495673_0120641
1290 Ga0495686_0034288
1291 Ga0495686_0075473
1292 Ga0495686_0177199
1293 Ga0495593_0226954
1294 Ga0496100_0039218
1295 Ga0496100_0130381
1296 Ga0496100_0134357
1297 Ga0496101_0011635
1298 Ga0496101_0152365
1299 Ga0496101_0349023
1300 Ga0496102_0053475
1301 Ga0496102_0662823
1302 Ga0496102_1477540
1303 Ga0496103_0045723
1304 Ga0496103_0300451
1305 Ga0496103_0391944
1306 Ga0496104_0003279
1307 Ga0496104_0337679
1308 Ga0496105_0167493
1309 Ga0496105_0263448
1310 Ga0496106_0049488
1311 Ga0496106_0333162
1312 Ga0496107_0012368
1313 Ga0496107_0049952
1314 Ga0496107_0076424
1315 Ga0496107_0110515
1316 Ga0496108_0041868
1317 Ga0496108_0085246
1318 Ga0496108_0623707
1319 Ga0496109_0024908
1320 Ga0496109_0124503
1321 Ga0496110_0010433
1322 Ga0496110_0451974
1323 Ga0496111_0039485
1324 Ga0496111_0074157
1325 Ga0496112_0038622
1326 Ga0496112_0083541
1327 Ga0496112_0400052
1328 Ga0496113_0191687
1329 Ga0496113_0346574
1330 Ga0496114_0060321
1331 Ga0496114_0114228
1332 Ga0496115_0006328
1333 Ga0496117_0045663
1334 Ga0496117_0141635
1335 Ga0496118_0013338
1336 Ga0496118_0117599
1337 Ga0496119_0048564
1338 Ga0496119_0157055
1339 Ga0496121_0001712
1340 Ga0496121_0019695
1341 Ga0496121_0093667
1342 Ga0496121_0106570
1343 Ga0496121_0131049
1344 Ga0496121_0439200
1345 Ga0496121_0566214
1346 Ga0496121_0599306
1347 Ga0496122_0030050
1348 Ga0496123_0421852
1349 Ga0496124_0109399
1350 Ga0496125_0000829
1351 Ga0496125_0055540
1352 Ga0496125_0093938
1353 Ga0496125_0110381
1354 Ga0496126_0021983
1355 Ga0496126_0037495
1356 Ga0496126_0096968
1357 Ga0496126_0113297
1358 Ga0496126_0169427
1359 Ga0496126_0240146
1360 Ga0496126_0265204
1361 Ga0496126_0327347
1362 Ga0496126_0923680
1363 Ga0501038_0309481
1364 Ga0501042_0283672
1365 Ga0501048_0329366
1366 Ga0501069_0420938
1367 Ga0501071_0243942
1368 Ga0501072_0853078
1369 Ga0501076_0485485
1370 Ga0501080_0531216
1371 nmdc:mga00v17_194113_c1
1372 nmdc:mga0yw44_10617_c1
1373 nmdc:mga0yw44_155526_c1
1374 nmdc:mga0yw44_187118_c1
1375 nmdc:mga0yw44_234567_c1
1376 nmdc:mga0yw44_80883_c1
1377 nmdc:mga0yw44_94643_c1
1378 nmdc:mga0k408_169702_c1
1379 nmdc:mga0k408_406579_c1
1380 nmdc:mga0k408_438488_c1
1381 nmdc:mga06z11_13395_c1
1382 nmdc:mga06z11_147113_c1
1383 nmdc:mga06z11_22300_c1
1384 nmdc:mga06z11_245631_c1
1385 nmdc:mga06z11_332388_c1
1386 nmdc:mga04h51_203726_c1
1387 nmdc:mga04h51_538443_c1
1388 nmdc:mga07m45_114626_c1
1389 nmdc:mga07m45_255578_c1
1390 nmdc:mga07m45_363804_c1
1391 nmdc:mga07m45_46697_c2
1392 nmdc:mga07m45_53230_c1
1393 nmdc:mga05p37_1589260_c1
1394 nmdc:mga05p37_624786_c1
1395 nmdc:mga0qj67_445629_c1
1396 nmdc:mga08y16_267877_c1
1397 nmdc:mga0sz30_128678_c1
1398 nmdc:mga0sz30_43629_c1
1399 nmdc:mga0sz30_553426_c1
1400 nmdc:mga0sz30_568426_c1
1401 Ga0495655_0376117
1402 Ga0495619_0685712
1403 Ga0500646_0092872
1404 Ga0500651_0057887
1405 Ga0500651_0093144
1406 Ga0500566_0000268
1407 Ga0500566_0001603
1408 Ga0500566_0009612
1409 Ga0500640_017117
1410 Ga0500641_0009104
1411 Ga0500641_0015942
1412 Ga0500554_006947
1413 Ga0500554_116400
1414 Ga0500572_000600
1415 Ga0500591_127434
1416 Ga0500592_013538
1417 Ga0500594_0024635
1418 Ga0500595_000469
1419 Ga0500595_000641
1420 Ga0500595_001479
1421 Ga0500595_007549
1422 Ga0500595_031521
1423 Ga0500608_021616
1424 Ga0500614_009050
1425 Ga0500642_0028850
1426 Ga0500658_0044067
1427 Ga0500559_0002022
1428 Ga0500559_0105817
1429 Ga0500559_0202942
1430 Ga0500568_0053609
1431 Ga0500568_0138609
1432 Ga0500588_0057594
1433 Ga0500589_108591
1434 Ga0500603_003061
1435 Ga0500604_0018339
1436 Ga0500627_0021452
1437 Ga0500627_0344570
1438 Ga0500630_060055
1439 Ga0500634_0046931
1440 Ga0500638_003446
1441 Ga0500638_021174
1442 Ga0500638_160345
1443 Ga0500636_0016159
1444 Ga0500636_0407734
1445 Ga0500637_0000107
1446 Ga0500637_0000471
1447 Ga0500637_0113766
1448 Ga0500576_136584
1449 Ga0500609_044835
1450 Ga0500596_002662
1451 Ga0500661_000845
1452 Ga0500661_006921
1453 Ga0501082_0000077
1454 2513673185
1455 2513695420
1456 2524466136
1457 2723843810
1458 2728749508
1459 2793079355
1460 2874612208
1461 2885390099
1462 2889041989
1463 2903776809
1464 2908744448
1465 2908762087
1466 8006964977
1467 8006991624
1468 8056679886
1469 8056685279
1470 8056691719

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mgy-assembly6.cif.gz_B crystal structure of the new deli metallo beta lactamase variant 5 from klebsiella pneumoniae 0.8056 80 121
6c89-assembly4.cif.gz_B ndm-1 beta-lactamase exhibits differential active site sequence requirements for the hydrolysis of penicillin versus carbapenem antibiotics 0.7853 80 120
6mgx-assembly3.cif.gz_B crystal structure of the new deli metallo beta lactamase variant 6 klebsiella pneumoniae 0.7821 79 120
6twt-assembly2.cif.gz_B crystal structure of n-terminally truncated ndm-1 metallo-beta-lactamase 0.763 77 120
6v73-assembly1.cif.gz_A-2 crystal structure of metallo beta lactamase from erythrobacter litoralis with beta mercaptoethanol in the active site 0.762 80 116
ID Description Score Start End Superfamily
af_G5EFR8_1_233_2.40.40.20 Mainly Beta;Beta Barrel;Barwin-like endoglucanases; 0.7568 97 121 2.40.40.20
4a17P01 Mainly Beta;Roll;SH3 type barrels.;Ribosomal protein L21 0.7317 86 118 2.30.30.70
af_G5EFY6_345_761_1.25.40.1030 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.7215 82 116 1.25.40.1030
af_I1JUG7_1_167_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7206 86 120 3.10.450.50
af_O16766_336_399_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6797 77 121 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A1I3VI69-F1-model_v4 Uncharacterized protein 0.906 79 121
AF-H0T9B8-F1-model_v4 Uncharacterized protein 0.8603 1 120
AF-A0A336JSI5-F1-model_v4 Uncharacterized protein 0.8537 1 120
AF-A0A336JSI5-F1-model_v4 Uncharacterized protein 0.8469 1 120
AF-H0T9B8-F1-model_v4 Uncharacterized protein 0.8398 1 120

Map