F478231

General Info

Members Datasets Scaffolds Average Seq Length
735 342 1470 196

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0663298|Ga0496126_0663298_201_794
Length 197
Sequence MTTIRKALMETVRFTKMAEGTKEEYELLAARGAAFTVRLPDRILAALDELREGGDGYRVTRFEHSVQTATRAHRDGKDEEYVVMALVHDIGDGLAPYTHSEMIGAVLQPFVRPEIVWIARHHGAFQLYYYAHHYGRDRNVREAHRGHQWFDACAEFCEQYDQVSFDPDYDNLPIEHFQPMVRRVFGQPRYARPDGDS

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
92 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
113 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
123 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
124 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
125 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
126 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
127 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
128 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
129 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
130 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
131 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
132 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
133 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
134 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
135 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
136 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
137 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
138 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
139 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
140 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
141 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
142 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
143 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
144 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
145 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
146 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
147 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
148 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
149 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
150 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
151 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
152 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
153 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
154 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
162 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
163 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
167 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
168 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
169 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
170 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
174 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
175 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
176 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
193 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
208 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
209 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
225 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
226 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
227 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
228 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
229 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
232 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
258 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
259 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
260 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
261 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
268 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
269 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
270 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
271 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
272 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
279 2511231004 Pseudomonas sp. GM102 Isolate Nodule
280 2511231006 Pseudomonas sp. GM17 Isolate Nodule
281 2511231007 Pseudomonas sp. GM18 Isolate Nodule
282 2511231008 Pseudomonas sp. GM21 Isolate Nodule
283 2511231010 Pseudomonas sp. GM25 Isolate Nodule
284 2511231016 Pseudomonas sp. GM50 Isolate Nodule
285 2511231021 Pseudomonas sp. GM78 Isolate Nodule
286 2511231022 Pseudomonas sp. GM79 Isolate Nodule
287 2511231023 Pseudomonas sp. GM80 Isolate Nodule
288 2511231031 Pseudomonas sp. GM16 Isolate Nodule
289 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
290 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
291 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
292 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
293 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
294 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
295 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
296 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
297 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
298 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
299 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
300 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
301 2643221585 Pelomonas sp. Root662 Isolate Unclassified
302 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
303 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
304 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
305 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
306 2643221656 Pelomonas sp. Root405 Isolate Unclassified
307 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
308 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
309 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
310 2738541337 Pelomonas sp. BT06 Isolate Unclassified
311 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
312 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
313 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
314 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
315 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
316 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
317 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
318 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
319 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
320 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
321 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
322 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
323 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
324 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
325 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
326 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
327 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
328 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
329 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
330 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
331 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
332 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
333 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
334 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
335 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
336 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
337 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
338 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
339 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
340 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
341 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
342 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.88
Metatranscriptomes 0.41
Isolates 8.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.39
Nodule 1.5
Rhizoplane 2.31
Rhizosphere 83.13
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0663298 3300048929 Bacteria 815
2 rootL2_10012056 3300003322 Bacteria 13768
3 rootH1_10020558 3300003323 Bacteria 3467
4 rootH1_10114129 3300003323 Bacteria 1353
5 Ga0055536_1000041 3300003781 Bacteria 127266
6 Ga0055536_1000042 3300003781 Bacteria 125029
7 Ga0055536_1004420 3300003781 Bacteria 7198
8 Ga0055536_1007529 3300003781 Bacteria 4851
9 Ga0055530_10000063 3300003791 Bacteria 94619
10 Ga0055530_10000174 3300003791 Bacteria 58795
11 Ga0055530_10000411 3300003791 Bacteria 38127
12 Ga0055530_10002068 3300003791 Bacteria 13475
13 Ga0055530_10035526 3300003791 Bacteria 1263
14 Ga0055540_1000278 3300003792 Bacteria 45985
15 Ga0055540_1000318 3300003792 Bacteria 42704
16 Ga0055531_10000412 3300003794 Bacteria 41097
17 Ga0055531_10001746 3300003794 Bacteria 15529
18 Ga0055531_10014294 3300003794 Bacteria 3584
19 Ga0065165_1000806 3300005262 Bacteria 41749
20 Ga0065714_10067840 3300005288 Bacteria 5163
21 Ga0065714_10077559 3300005288 Bacteria 2676
22 Ga0065714_10091407 3300005288 Bacteria 1896
23 Ga0065704_10016922 3300005289 Bacteria 2168
24 Ga0070683_100080622 3300005329 Bacteria 3047
25 Ga0070683_100226489 3300005329 Bacteria 1777
26 Ga0070670_100341714 3300005331 Bacteria 1314
27 Ga0070689_100029810 3300005340 Bacteria 4135
28 Ga0070669_100045051 3300005353 Bacteria 3214
29 Ga0070669_100136641 3300005353 Bacteria 1886
30 Ga0070659_100052719 3300005366 Bacteria 3200
31 Ga0070713_100283654 3300005436 Bacteria 1520
32 Ga0070711_100280486 3300005439 Bacteria 1318
33 Ga0070694_100134776 3300005444 Bacteria 1788
34 Ga0070708_100194289 3300005445 Bacteria 1899
35 Ga0070678_100175672 3300005456 Bacteria 1748
36 Ga0070662_100781482 3300005457 Bacteria 811
37 Ga0070681_10068669 3300005458 Bacteria 3511
38 Ga0070706_100316838 3300005467 Bacteria 1455
39 Ga0070707_100164803 3300005468 Bacteria 2160
40 Ga0070699_100038092 3300005518 Bacteria 4164
41 Ga0070679_100215314 3300005530 Bacteria 1883
42 Ga0070697_100236948 3300005536 Bacteria 1558
43 Ga0070695_100275938 3300005545 Bacteria 1233
44 Ga0070696_100145438 3300005546 Bacteria 1736
45 Ga0070665_100079480 3300005548 Bacteria 3285
46 Ga0070665_100228216 3300005548 Bacteria 1862
47 Ga0068857_100203152 3300005577 Bacteria 1806
48 Ga0068857_100672582 3300005577 Bacteria 982
49 Ga0068856_100107692 3300005614 Bacteria 2783
50 Ga0068858_100189143 3300005842 Bacteria 1945
51 Ga0068858_100563001 3300005842 Bacteria 1104
52 Ga0075363_100296188 3300006048 Bacteria 938
53 Ga0075364_10143619 3300006051 Bacteria 1606
54 Ga0075364_10177054 3300006051 Bacteria 1443
55 Ga0075432_10008785 3300006058 Bacteria 3447
56 Ga0075432_10180657 3300006058 Bacteria 825
57 Ga0070715_10033756 3300006163 Bacteria 2094
58 Ga0070715_10125265 3300006163 Bacteria 1230
59 Ga0070716_100087497 3300006173 Bacteria 1877
60 Ga0070712_100023860 3300006175 Bacteria 4045
61 Ga0075370_10252695 3300006353 Bacteria 1045
62 Ga0068871_100425571 3300006358 Bacteria 1186
63 Ga0075436_100101982 3300006914 Bacteria 1999
64 Ga0075435_100109957 3300007076 Bacteria 2292
65 Ga0099794_10002724 3300007265 Bacteria 6587
66 Ga0099794_10060371 3300007265 Bacteria 1841
67 Ga0099795_10187977 3300007788 Bacteria 866
68 Ga0105251_10062978 3300009011 Bacteria 1741
69 Ga0105244_10003184 3300009036 Bacteria 11908
70 Ga0105244_10037103 3300009036 Bacteria 2549
71 Ga0105244_10188655 3300009036 Bacteria 975
72 Ga0111539_10115694 3300009094 Bacteria 3144
73 Ga0105243_10000162 3300009148 Bacteria 75904
74 Ga0105239_10951413 3300010375 Bacteria 987
75 Ga0105246_10000155 3300011119 Bacteria 32536
76 Ga0157345_1000143 3300012498 Bacteria 12901
77 Ga0157373_10003502 3300013100 Bacteria 11872
78 Ga0157373_10047355 3300013100 Bacteria 3067
79 Ga0157371_10003729 3300013102 Bacteria 13654
80 Ga0157370_10001776 3300013104 Bacteria 26607
81 Ga0157370_10032589 3300013104 Bacteria 5087
82 Ga0157370_10052312 3300013104 Bacteria 3899
83 Ga0157370_10121765 3300013104 Bacteria 2436
84 Ga0157369_10006367 3300013105 Bacteria 13695
85 Ga0157369_10007063 3300013105 Bacteria 12952
86 Ga0157369_10031677 3300013105 Bacteria 5819
87 Ga0163162_10001228 3300013306 Bacteria 23952
88 Ga0157372_10183550 3300013307 Bacteria 2422
89 Ga0157372_10281290 3300013307 Bacteria 1934
90 Ga0157375_10112993 3300013308 Bacteria 2817
91 Ga0163163_10542602 3300014325 Bacteria 1225
92 Ga0182008_10003253 3300014497 Bacteria 9911
93 Ga0182006_1002922 3300015261 Bacteria 9062
94 Ga0163161_10004436 3300017792 Bacteria 9780
95 Ga0163161_10050043 3300017792 Bacteria 3022
96 Ga0163161_10472340 3300017792 Bacteria 1017
97 Ga0209148_1009265 3300025254 Bacteria 1927
98 Ga0209675_1017541 3300025291 Bacteria 2042
99 Ga0209676_1000016 3300025292 Bacteria 655561
100 Ga0209676_1000021 3300025292 Bacteria 609534
101 Ga0209676_1000033 3300025292 Bacteria 463236
102 Ga0209676_1000084 3300025292 Bacteria 274330
103 Ga0209676_1000259 3300025292 Bacteria 111746
104 Ga0209676_1000678 3300025292 Bacteria 48300
105 Ga0209676_1032689 3300025292 Bacteria 1561
106 Ga0209676_1044287 3300025292 Bacteria 1221
107 Ga0209025_1010159 3300025294 Bacteria 6422
108 Ga0209025_1097914 3300025294 Bacteria 938
109 Ga0209050_1000036 3300025298 Bacteria 423070
110 Ga0209050_1000104 3300025298 Bacteria 228921
111 Ga0209050_1000107 3300025298 Bacteria 223303
112 Ga0209051_1000043 3300025303 Bacteria 305473
113 Ga0209051_1000090 3300025303 Bacteria 173748
114 Ga0209257_1000098 3300025304 Bacteria 256390
115 Ga0209257_1000120 3300025304 Bacteria 223025
116 Ga0209257_1000174 3300025304 Bacteria 165255
117 Ga0209257_1005689 3300025304 Bacteria 8578
118 Ga0207696_1003232 3300025711 Bacteria 7518
119 Ga0207696_1012217 3300025711 Bacteria 3045
120 Ga0207655_1000297 3300025728 Bacteria 75120
121 Ga0207655_1005351 3300025728 Bacteria 8757
122 Ga0207655_1005951 3300025728 Bacteria 8173
123 Ga0207713_1000904 3300025735 Bacteria 26862
124 Ga0207684_10061541 3300025910 Bacteria 3188
125 Ga0207684_10159060 3300025910 Bacteria 1945
126 Ga0207693_10029957 3300025915 Bacteria 4295
127 Ga0207663_10515519 3300025916 Bacteria 930
128 Ga0207660_10106363 3300025917 Bacteria 2104
129 Ga0207652_10211914 3300025921 Bacteria 1744
130 Ga0207646_10075203 3300025922 Bacteria 3018
131 Ga0207681_10010392 3300025923 Bacteria 5696
132 Ga0207681_10516310 3300025923 Bacteria 980
133 Ga0207690_10013933 3300025932 Bacteria 4845
134 Ga0207706_10128430 3300025933 Bacteria 2229
135 Ga0207706_10422077 3300025933 Bacteria 1155
136 Ga0207709_10000053 3300025935 Bacteria 225514
137 Ga0207670_10020423 3300025936 Bacteria 4070
138 Ga0207665_10412055 3300025939 Bacteria 1031
139 Ga0207667_10339602 3300025949 Bacteria 1533
140 Ga0207703_10091429 3300026035 Bacteria 2559
141 Ga0207702_10098651 3300026078 Bacteria 2574
142 Ga0207674_10242343 3300026116 Bacteria 1750
143 Ga0207683_10068188 3300026121 Bacteria 3139
144 Ga0209281_1017534 3300027111 Bacteria 1449
145 Ga0209588_1011457 3300027671 Bacteria 2679
146 Ga0207428_10744364 3300027907 Bacteria 699
147 Ga0268266_10040819 3300028379 Bacteria 3956
148 Ga0268264_10645307 3300028381 Bacteria 1047
149 Ga0268264_10743960 3300028381 Bacteria 976
150 Ga0307517_10125729 3300028786 Bacteria 1872
151 Ga0307511_10069438 3300030521 Bacteria 2590
152 Ga0316178_1074314 3300030735 Bacteria 21620
153 Ga0307513_10026909 3300031456 Bacteria 6616
154 Ga0307509_10154927 3300031507 Bacteria 2199
155 Ga0307408_100043286 3300031548 Bacteria 3203
156 Ga0307408_100062538 3300031548 Bacteria 2720
157 Ga0307408_100146097 3300031548 Bacteria 1861
158 Ga0307408_100339421 3300031548 Bacteria 1271
159 Ga0307408_100759601 3300031548 Bacteria 876
160 Ga0307408_100992266 3300031548 Bacteria 773
161 Ga0307516_10652995 3300031730 Bacteria 707
162 Ga0307405_10092853 3300031731 Bacteria 2003
163 Ga0307405_10238874 3300031731 Bacteria 1344
164 Ga0307405_10412334 3300031731 Bacteria 1061
165 Ga0307405_10462843 3300031731 Bacteria 1008
166 Ga0307413_10039463 3300031824 Bacteria 2746
167 Ga0307410_10130051 3300031852 Bacteria 1848
168 Ga0307410_10133193 3300031852 Bacteria 1828
169 Ga0307410_10632905 3300031852 Bacteria 895
170 Ga0307406_10039441 3300031901 Bacteria 2930
171 Ga0307406_10401992 3300031901 Bacteria 1086
172 Ga0307406_10702001 3300031901 Bacteria 845
173 Ga0307407_10042278 3300031903 Bacteria 2554
174 Ga0307412_10055008 3300031911 Bacteria 2645
175 Ga0307412_10072804 3300031911 Bacteria 2349
176 Ga0307412_10079840 3300031911 Bacteria 2258
177 Ga0307412_10114202 3300031911 Bacteria 1933
178 Ga0307412_10223493 3300031911 Bacteria 1445
179 Ga0307412_10435193 3300031911 Bacteria 1076
180 Ga0307412_10541563 3300031911 Bacteria 976
181 Ga0307412_10556179 3300031911 Bacteria 964
182 Ga0307412_11470721 3300031911 Bacteria 618
183 Ga0307409_101208841 3300031995 Bacteria 779
184 Ga0307416_100023954 3300032002 Bacteria 4443
185 Ga0307416_100197817 3300032002 Bacteria 1903
186 Ga0307416_100296603 3300032002 Bacteria 1604
187 Ga0307416_100455895 3300032002 Bacteria 1332
188 Ga0307416_100506890 3300032002 Bacteria 1272
189 Ga0307416_100652117 3300032002 Bacteria 1137
190 Ga0307414_10003389 3300032004 Bacteria 8514
191 Ga0307414_10005872 3300032004 Bacteria 6791
192 Ga0307414_10013889 3300032004 Bacteria 4809
193 Ga0307414_10060347 3300032004 Bacteria 2681
194 Ga0307414_10080013 3300032004 Bacteria 2388
195 Ga0307414_10085351 3300032004 Bacteria 2325
196 Ga0307414_10289001 3300032004 Bacteria 1381
197 Ga0307414_10402495 3300032004 Bacteria 1189
198 Ga0307414_10765296 3300032004 Bacteria 878
199 Ga0307411_10028057 3300032005 Bacteria 3416
200 Ga0307411_10065164 3300032005 Bacteria 2442
201 Ga0307411_10117242 3300032005 Bacteria 1918
202 Ga0307411_10558783 3300032005 Bacteria 977
203 Ga0307411_11069895 3300032005 Bacteria 725
204 Ga0307415_100165558 3300032126 Bacteria 1718
205 Ga0307510_10024905 3300033180 Bacteria 6908
206 Ga0307510_10046980 3300033180 Bacteria 4633
207 Ga0373956_0003525 3300035119 Bacteria 6302
208 Ga0373924_0398543 3300035410 Bacteria 615
209 Ga0373935_0524595 3300035692 Bacteria 862
210 Ga0373933_0031907 3300035724 Bacteria 3059
211 Ga0373937_0034048 3300036401 Bacteria 4631
212 Ga0395900_0135728 3300037418 Bacteria 2520
213 Ga0395905_0001480 3300037471 Bacteria 28107
214 Ga0395905_1103402 3300037471 Bacteria 697
215 Ga0237819_02368 3300038705 Bacteria 3841
216 Ga0400483_223733 3300039062 Bacteria 1201
217 Ga0436361_0763530 3300039447 Bacteria 2724
218 Ga0439438_000923 3300041405 Bacteria 13115
219 Ga0439438_001061 3300041405 Bacteria 12247
220 Ga0439438_010911 3300041405 Bacteria 2852
221 Ga0439447_003511 3300041407 Bacteria 5564
222 Ga0439447_045284 3300041407 Bacteria 1062
223 Ga0439466_0004829 3300041411 Bacteria 5181
224 Ga0439466_0031401 3300041411 Bacteria 1816
225 Ga0439466_0099333 3300041411 Bacteria 908
226 Ga0451789_0899180 3300041443 Bacteria 627
227 Ga0451841_0453392 3300041498 Bacteria 1455
228 Ga0439437_000022 3300042000 Bacteria 12184
229 Ga0439445_0084717 3300042004 Bacteria 888
230 Ga0439432_003835 3300042006 Bacteria 5543
231 Ga0439451_000492 3300042009 Bacteria 7623
232 Ga0439451_003515 3300042009 Bacteria 3178
233 Ga0439452_000228 3300042010 Bacteria 39646
234 Ga0439452_000887 3300042010 Bacteria 13768
235 Ga0439452_005669 3300042010 Bacteria 3996
236 Ga0439452_032686 3300042010 Bacteria 1269
237 Ga0439455_0121919 3300042012 Bacteria 731
238 Ga0439456_000846 3300042013 Bacteria 6187
239 Ga0439456_015178 3300042013 Bacteria 1608
240 Ga0439456_016896 3300042013 Bacteria 1528
241 Ga0439463_061554 3300042016 Bacteria 959
242 Ga0450911_000109 3300042115 Bacteria 34092
243 Ga0450911_000586 3300042115 Bacteria 11210
244 Ga0450911_000664 3300042115 Bacteria 10293
245 Ga0450911_001017 3300042115 Bacteria 7151
246 Ga0450911_018217 3300042115 Bacteria 922
247 Ga0450922_001334 3300042124 Bacteria 2435
248 Ga0450890_002436 3300042127 Bacteria 2561
249 Ga0450900_024871 3300042136 Bacteria 851
250 Ga0450902_002639 3300042137 Bacteria 2550
251 Ga0450902_012270 3300042137 Bacteria 1369
252 Ga0450902_020192 3300042137 Bacteria 1097
253 Ga0450903_002399 3300042138 Bacteria 3339
254 Ga0450904_000351 3300042139 Bacteria 9603
255 Ga0450904_004766 3300042139 Bacteria 1397
256 Ga0450906_000113 3300042145 Bacteria 14042
257 Ga0450906_007555 3300042145 Bacteria 2142
258 Ga0450907_034413 3300042146 Bacteria 864
259 Ga0450910_003593 3300042147 Bacteria 2064
260 Ga0450908_010450 3300042184 Bacteria 1712
261 Ga0450909_000292 3300042185 Bacteria 6160
262 Ga0439434_0034399 3300042435 Bacteria 1547
263 Ga0439464_0020000 3300042439 Bacteria 1831
264 Ga0450916_000745 3300042530 Bacteria 3003
265 Ga0450918_003338 3300042531 Bacteria 2983
266 Ga0450918_028788 3300042531 Bacteria 978
267 Ga0439440_0007444 3300042993 Bacteria 2224
268 Ga0466957_0579549 3300044842 Bacteria 784
269 Ga0451576_0499717 3300045051 Bacteria 1278
270 Ga0451576_1447878 3300045051 Bacteria 714
271 Ga0466967_0626043 3300045976 Bacteria 1063
272 Ga0495617_005747 3300046452 Bacteria 4380
273 Ga0495617_026777 3300046452 Bacteria 1941
274 Ga0495617_048235 3300046452 Bacteria 1417
275 Ga0495617_140815 3300046452 Bacteria 770
276 Ga0495617_141361 3300046452 Bacteria 768
277 Ga0495627_000294 3300046453 Bacteria 49457
278 Ga0495627_001723 3300046453 Bacteria 11931
279 Ga0495627_028962 3300046453 Bacteria 1765
280 Ga0495627_081888 3300046453 Bacteria 935
281 Ga0495592_0183625 3300046454 Bacteria 1423
282 Ga0495590_0001607 3300046457 Bacteria 9664
283 Ga0495590_0004330 3300046457 Bacteria 5738
284 Ga0495590_0064064 3300046457 Bacteria 1286
285 Ga0495590_0095853 3300046457 Bacteria 1052
286 Ga0495591_000264 3300046458 Bacteria 49787
287 Ga0495591_000779 3300046458 Bacteria 22757
288 Ga0495591_001542 3300046458 Bacteria 14133
289 Ga0495591_001583 3300046458 Bacteria 13825
290 Ga0495591_006851 3300046458 Bacteria 4949
291 Ga0495591_007918 3300046458 Bacteria 4430
292 Ga0495591_018875 3300046458 Bacteria 2326
293 Ga0495591_036133 3300046458 Bacteria 1440
294 Ga0495591_042273 3300046458 Bacteria 1289
295 Ga0495591_057609 3300046458 Bacteria 1041
296 Ga0495638_0004020 3300046460 Bacteria 11286
297 Ga0495638_0007343 3300046460 Bacteria 7910
298 Ga0495638_0017011 3300046460 Bacteria 4859
299 Ga0495638_0046463 3300046460 Bacteria 2727
300 Ga0495638_0063009 3300046460 Bacteria 2287
301 Ga0495638_0093210 3300046460 Bacteria 1811
302 Ga0495638_0209299 3300046460 Bacteria 1096
303 Ga0495650_0000252 3300046471 Bacteria 105475
304 Ga0495650_0004225 3300046471 Bacteria 9946
305 Ga0495650_0005746 3300046471 Bacteria 7922
306 Ga0495650_0006190 3300046471 Bacteria 7513
307 Ga0495650_0013627 3300046471 Bacteria 4287
308 Ga0495650_0017220 3300046471 Bacteria 3628
309 Ga0495650_0038328 3300046471 Bacteria 2077
310 Ga0495650_0113758 3300046471 Bacteria 1002
311 Ga0495605_0001812 3300046474 Bacteria 13680
312 Ga0495605_0003840 3300046474 Bacteria 8913
313 Ga0495605_0050564 3300046474 Bacteria 2027
314 Ga0495605_0111437 3300046474 Bacteria 1248
315 Ga0495605_0120391 3300046474 Bacteria 1190
316 Ga0495584_0003081 3300046491 Bacteria 9267
317 Ga0495584_0008042 3300046491 Bacteria 5482
318 Ga0495584_0011758 3300046491 Bacteria 4475
319 Ga0495584_0012361 3300046491 Bacteria 4357
320 Ga0495584_0016505 3300046491 Bacteria 3765
321 Ga0495584_0024704 3300046491 Bacteria 3047
322 Ga0495584_0039118 3300046491 Bacteria 2396
323 Ga0495584_0063013 3300046491 Bacteria 1863
324 Ga0495584_0092976 3300046491 Bacteria 1521
325 Ga0495584_0134190 3300046491 Bacteria 1256
326 Ga0495584_0258107 3300046491 Bacteria 886
327 Ga0495585_0001397 3300046492 Bacteria 19044
328 Ga0495585_0003265 3300046492 Bacteria 11043
329 Ga0495585_0003336 3300046492 Bacteria 10894
330 Ga0495585_0010127 3300046492 Bacteria 5631
331 Ga0495585_0014588 3300046492 Bacteria 4572
332 Ga0495585_0037032 3300046492 Bacteria 2748
333 Ga0495585_0057295 3300046492 Bacteria 2150
334 Ga0495585_0058935 3300046492 Bacteria 2117
335 Ga0495585_0218900 3300046492 Bacteria 961
336 Ga0495596_0000004 3300046500 Bacteria 163832
337 Ga0495596_0049580 3300046500 Bacteria 1646
338 Ga0495596_0114882 3300046500 Bacteria 1045
339 Ga0495607_0000234 3300046501 Bacteria 59488
340 Ga0495607_0002691 3300046501 Bacteria 14180
341 Ga0495607_0013818 3300046501 Bacteria 5276
342 Ga0495607_0017981 3300046501 Bacteria 4518
343 Ga0495607_0028312 3300046501 Bacteria 3459
344 Ga0495607_0032571 3300046501 Bacteria 3179
345 Ga0495607_0043439 3300046501 Bacteria 2657
346 Ga0495607_0072888 3300046501 Bacteria 1910
347 Ga0495607_0134096 3300046501 Bacteria 1284
348 Ga0495607_0188745 3300046501 Bacteria 1028
349 Ga0495607_0294622 3300046501 Bacteria 765
350 Ga0495607_0294634 3300046501 Bacteria 765
351 Ga0495583_0001199 3300046506 Bacteria 27850
352 Ga0495583_0004374 3300046506 Bacteria 10173
353 Ga0495583_0054324 3300046506 Bacteria 1814
354 Ga0495606_0000027 3300046507 Bacteria 253573
355 Ga0495606_0000167 3300046507 Bacteria 115739
356 Ga0495606_0000432 3300046507 Bacteria 69645
357 Ga0495606_0004330 3300046507 Bacteria 14273
358 Ga0495606_0004584 3300046507 Bacteria 13708
359 Ga0495606_0008054 3300046507 Bacteria 9247
360 Ga0495606_0031869 3300046507 Bacteria 3659
361 Ga0495606_0033966 3300046507 Bacteria 3508
362 Ga0495606_0037407 3300046507 Bacteria 3297
363 Ga0495606_0138700 3300046507 Bacteria 1438
364 Ga0495606_0169322 3300046507 Bacteria 1268
365 Ga0495606_0188470 3300046507 Bacteria 1184
366 Ga0495606_0221842 3300046507 Bacteria 1064
367 Ga0495606_0234503 3300046507 Bacteria 1026
368 Ga0495610_0001754 3300046512 Bacteria 18984
369 Ga0495610_0004292 3300046512 Bacteria 10605
370 Ga0495610_0005652 3300046512 Bacteria 8814
371 Ga0495610_0036818 3300046512 Bacteria 2497
372 Ga0495610_0037611 3300046512 Bacteria 2461
373 Ga0495610_0040776 3300046512 Bacteria 2336
374 Ga0495610_0042341 3300046512 Bacteria 2278
375 Ga0495610_0131779 3300046512 Bacteria 1084
376 Ga0495610_0232050 3300046512 Bacteria 740
377 Ga0495616_0002308 3300046513 Bacteria 12756
378 Ga0495616_0003473 3300046513 Bacteria 10080
379 Ga0495616_0010604 3300046513 Bacteria 5325
380 Ga0495616_0012448 3300046513 Bacteria 4829
381 Ga0495616_0018182 3300046513 Bacteria 3863
382 Ga0495620_0002095 3300046515 Bacteria 11596
383 Ga0495620_0003062 3300046515 Bacteria 9601
384 Ga0495620_0003879 3300046515 Bacteria 8530
385 Ga0495620_0004015 3300046515 Bacteria 8355
386 Ga0495620_0004328 3300046515 Bacteria 8024
387 Ga0495620_0062615 3300046515 Bacteria 1544
388 Ga0495631_0000149 3300046518 Bacteria 47491
389 Ga0495631_0002305 3300046518 Bacteria 10884
390 Ga0495631_0004457 3300046518 Bacteria 7459
391 Ga0495631_0076998 3300046518 Bacteria 1439
392 Ga0495631_0129927 3300046518 Bacteria 1082
393 Ga0495632_0030521 3300046519 Bacteria 2796
394 Ga0495632_0034500 3300046519 Bacteria 2588
395 Ga0495632_0036575 3300046519 Bacteria 2496
396 Ga0495632_0056595 3300046519 Bacteria 1916
397 Ga0495637_0000115 3300046520 Bacteria 58484
398 Ga0495637_0000654 3300046520 Bacteria 24163
399 Ga0495637_0001934 3300046520 Bacteria 11745
400 Ga0495637_0002446 3300046520 Bacteria 10261
401 Ga0495637_0004911 3300046520 Bacteria 6885
402 Ga0495637_0010206 3300046520 Bacteria 4551
403 Ga0495637_0010283 3300046520 Bacteria 4533
404 Ga0495637_0015761 3300046520 Bacteria 3541
405 Ga0495637_0021681 3300046520 Bacteria 2942
406 Ga0495637_0038394 3300046520 Bacteria 2073
407 Ga0495637_0055376 3300046520 Bacteria 1644
408 Ga0495637_0119874 3300046520 Bacteria 1013
409 Ga0495643_0000017 3300046522 Bacteria 313381
410 Ga0495643_0002097 3300046522 Bacteria 16505
411 Ga0495643_0002834 3300046522 Bacteria 13196
412 Ga0495643_0008137 3300046522 Bacteria 6675
413 Ga0495643_0012757 3300046522 Bacteria 5056
414 Ga0495643_0095018 3300046522 Bacteria 1534
415 Ga0495643_0210009 3300046522 Bacteria 929
416 Ga0495643_0210615 3300046522 Bacteria 928
417 Ga0495643_0212589 3300046522 Bacteria 922
418 Ga0495644_0005006 3300046523 Bacteria 5186
419 Ga0495644_0014553 3300046523 Bacteria 3012
420 Ga0495644_0042611 3300046523 Bacteria 1709
421 Ga0495648_0000984 3300046524 Bacteria 29405
422 Ga0495648_0002891 3300046524 Bacteria 15445
423 Ga0495648_0005805 3300046524 Bacteria 10172
424 Ga0495648_0007492 3300046524 Bacteria 8730
425 Ga0495648_0026103 3300046524 Bacteria 3938
426 Ga0495648_0045096 3300046524 Bacteria 2745
427 Ga0495648_0069100 3300046524 Bacteria 2057
428 Ga0495648_0076627 3300046524 Bacteria 1919
429 Ga0495648_0116778 3300046524 Bacteria 1441
430 Ga0495648_0169728 3300046524 Bacteria 1119
431 Ga0495642_0002441 3300046528 Bacteria 7567
432 Ga0495642_0236055 3300046528 Bacteria 799
433 Ga0495652_0659055 3300046529 Bacteria 708
434 Ga0495654_0000562 3300046530 Bacteria 29977
435 Ga0495654_0002377 3300046530 Bacteria 12142
436 Ga0495654_0003492 3300046530 Bacteria 9597
437 Ga0495654_0006522 3300046530 Bacteria 6617
438 Ga0495654_0007462 3300046530 Bacteria 6106
439 Ga0495654_0041327 3300046530 Bacteria 2293
440 Ga0495654_0098420 3300046530 Bacteria 1349
441 Ga0495654_0112840 3300046530 Bacteria 1238
442 Ga0495654_0119617 3300046530 Bacteria 1193
443 Ga0495654_0140797 3300046530 Bacteria 1075
444 Ga0495654_0183025 3300046530 Bacteria 906
445 Ga0495609_0000167 3300046538 Bacteria 68911
446 Ga0495609_0007889 3300046538 Bacteria 5261
447 Ga0495609_0010937 3300046538 Bacteria 4334
448 Ga0495609_0128818 3300046538 Bacteria 1084
449 Ga0495597_0003183 3300046542 Bacteria 9806
450 Ga0495597_0015167 3300046542 Bacteria 3650
451 Ga0495597_0076975 3300046542 Bacteria 1430
452 Ga0495622_0001087 3300046557 Bacteria 14206
453 Ga0495622_0005194 3300046557 Bacteria 6035
454 Ga0495622_0150388 3300046557 Bacteria 1054
455 Ga0495633_0001003 3300046558 Bacteria 23142
456 Ga0495633_0002568 3300046558 Bacteria 12719
457 Ga0495633_0333178 3300046558 Bacteria 688
458 Ga0495656_0359253 3300046615 Bacteria 756
459 Ga0495668_0000001 3300046616 Bacteria 1013420
460 Ga0495668_0000940 3300046616 Bacteria 32529
461 Ga0495668_0003395 3300046616 Bacteria 11971
462 Ga0495668_0023851 3300046616 Bacteria 3483
463 Ga0495668_0066858 3300046616 Bacteria 1977
464 Ga0495611_0000389 3300046648 Bacteria 27902
465 Ga0495611_0002128 3300046648 Bacteria 9264
466 Ga0495611_0100941 3300046648 Bacteria 1340
467 Ga0495611_0115178 3300046648 Bacteria 1252
468 Ga0495625_0000134 3300046660 Bacteria 115073
469 Ga0495625_0001920 3300046660 Bacteria 23504
470 Ga0495625_0011342 3300046660 Bacteria 7277
471 Ga0495625_0023743 3300046660 Bacteria 4680
472 Ga0495625_0041046 3300046660 Bacteria 3369
473 Ga0495625_0043260 3300046660 Bacteria 3267
474 Ga0495625_0093804 3300046660 Bacteria 2071
475 Ga0495625_0146097 3300046660 Bacteria 1592
476 Ga0495625_0174420 3300046660 Bacteria 1433
477 Ga0495625_0205310 3300046660 Bacteria 1298
478 Ga0495659_0022129 3300046664 Bacteria 2147
479 Ga0495661_0000088 3300046665 Bacteria 111782
480 Ga0495661_0008979 3300046665 Bacteria 6879
481 Ga0495661_0066139 3300046665 Bacteria 2128
482 Ga0495661_0071483 3300046665 Bacteria 2027
483 Ga0495661_0107480 3300046665 Bacteria 1560
484 Ga0495661_0149759 3300046665 Bacteria 1261
485 Ga0495661_0161533 3300046665 Bacteria 1202
486 Ga0495661_0187417 3300046665 Bacteria 1092
487 Ga0495661_0216117 3300046665 Bacteria 995
488 Ga0495661_0267606 3300046665 Bacteria 866
489 Ga0495588_0174771 3300046674 Bacteria 1135
490 Ga0495658_0070719 3300046683 Bacteria 2026
491 Ga0495658_0113516 3300046683 Bacteria 1631
492 Ga0495613_0149140 3300046689 Bacteria 1669
493 Ga0495670_0001008 3300046691 Bacteria 13684
494 Ga0495670_0001827 3300046691 Bacteria 10464
495 Ga0495670_0034921 3300046691 Bacteria 2505
496 Ga0495670_0125963 3300046691 Bacteria 1333
497 Ga0495671_0000415 3300046692 Bacteria 34078
498 Ga0495671_0008110 3300046692 Bacteria 5928
499 Ga0495671_0032798 3300046692 Bacteria 2649
500 Ga0495671_0038716 3300046692 Bacteria 2409
501 Ga0495671_0058186 3300046692 Bacteria 1912
502 Ga0495671_0101086 3300046692 Bacteria 1409
503 Ga0495671_0216479 3300046692 Bacteria 927
504 Ga0495649_0002749 3300046694 Bacteria 12244
505 Ga0495649_0003541 3300046694 Bacteria 10493
506 Ga0495649_0015332 3300046694 Bacteria 4363
507 Ga0495649_0024472 3300046694 Bacteria 3366
508 Ga0495649_0051679 3300046694 Bacteria 2228
509 Ga0495649_0073950 3300046694 Bacteria 1825
510 Ga0495649_0076099 3300046694 Bacteria 1797
511 Ga0495649_0091165 3300046694 Bacteria 1625
512 Ga0495649_0101904 3300046694 Bacteria 1525
513 Ga0495589_0001040 3300046794 Bacteria 16709
514 Ga0495589_0027780 3300046794 Bacteria 2859
515 Ga0495589_0039648 3300046794 Bacteria 2353
516 Ga0495589_0089435 3300046794 Bacteria 1495
517 Ga0495589_0140742 3300046794 Bacteria 1155
518 Ga0495589_0347368 3300046794 Bacteria 684
519 Ga0495660_0002844 3300046810 Bacteria 10874
520 Ga0495660_0031049 3300046810 Bacteria 3006
521 Ga0495660_0038328 3300046810 Bacteria 2664
522 Ga0495660_0042187 3300046810 Bacteria 2521
523 Ga0495660_0059247 3300046810 Bacteria 2060
524 Ga0495660_0067709 3300046810 Bacteria 1901
525 Ga0495660_0071356 3300046810 Bacteria 1841
526 Ga0495660_0078911 3300046810 Bacteria 1729
527 Ga0495660_0106128 3300046810 Bacteria 1439
528 Ga0495660_0126678 3300046810 Bacteria 1285
529 Ga0495660_0145568 3300046810 Bacteria 1174
530 Ga0495660_0146266 3300046810 Bacteria 1171
531 Ga0495660_0155903 3300046810 Bacteria 1124
532 Ga0495660_0176292 3300046810 Bacteria 1038
533 Ga0495581_0342779 3300047315 Bacteria 872
534 Ga0495604_0089291 3300047317 Bacteria 2291
535 Ga0495672_0003397 3300047320 Bacteria 13683
536 Ga0495672_0005137 3300047320 Bacteria 10445
537 Ga0495672_0110212 3300047320 Bacteria 1478
538 Ga0495672_0135188 3300047320 Bacteria 1293
539 Ga0495672_0195550 3300047320 Bacteria 1014
540 Ga0495672_0196093 3300047320 Bacteria 1012
541 Ga0495672_0222008 3300047320 Bacteria 932
542 Ga0495676_0000018 3300047321 Bacteria 178380
543 Ga0495676_0005024 3300047321 Bacteria 12131
544 Ga0495680_0061105 3300047322 Bacteria 2900
545 Ga0495683_0000217 3300047323 Bacteria 54243
546 Ga0495683_0045859 3300047323 Bacteria 2195
547 Ga0495683_0066167 3300047323 Bacteria 1781
548 Ga0495683_0242211 3300047323 Bacteria 795
549 Ga0495683_0244836 3300047323 Bacteria 789
550 Ga0495679_001426 3300047446 Bacteria 13611
551 Ga0495679_002236 3300047446 Bacteria 10052
552 Ga0495679_008371 3300047446 Bacteria 4211
553 Ga0495679_031744 3300047446 Bacteria 1701
554 Ga0495685_010530 3300047447 Bacteria 3103
555 Ga0495673_0001075 3300047469 Bacteria 23963
556 Ga0495673_0002192 3300047469 Bacteria 14155
557 Ga0495673_0003526 3300047469 Bacteria 10297
558 Ga0495673_0004319 3300047469 Bacteria 8948
559 Ga0495673_0007446 3300047469 Bacteria 6292
560 Ga0495673_0033062 3300047469 Bacteria 2404
561 Ga0495673_0056910 3300047469 Bacteria 1689
562 Ga0495673_0077146 3300047469 Bacteria 1388
563 Ga0495673_0212344 3300047469 Bacteria 719
564 Ga0495681_0003361 3300047470 Bacteria 11135
565 Ga0495681_0008798 3300047470 Bacteria 6286
566 Ga0495681_0009250 3300047470 Bacteria 6091
567 Ga0495681_0015123 3300047470 Bacteria 4379
568 Ga0495681_0018432 3300047470 Bacteria 3846
569 Ga0495681_0024628 3300047470 Bacteria 3163
570 Ga0495681_0033755 3300047470 Bacteria 2557
571 Ga0495681_0034021 3300047470 Bacteria 2543
572 Ga0495681_0055225 3300047470 Bacteria 1852
573 Ga0495681_0093808 3300047470 Bacteria 1321
574 Ga0495681_0099802 3300047470 Bacteria 1270
575 Ga0495686_0003379 3300047472 Bacteria 13896
576 Ga0495686_0007931 3300047472 Bacteria 7881
577 Ga0495686_0008555 3300047472 Bacteria 7497
578 Ga0495686_0266678 3300047472 Bacteria 956
579 Ga0495602_0008372 3300048088 Bacteria 10809
580 Ga0495626_0000172 3300048091 Bacteria 79971
581 Ga0495626_0000216 3300048091 Bacteria 68946
582 Ga0495626_0001853 3300048091 Bacteria 15869
583 Ga0495626_0007749 3300048091 Bacteria 5949
584 Ga0495626_0011815 3300048091 Bacteria 4599
585 Ga0495626_0064937 3300048091 Bacteria 1652
586 Ga0495626_0069190 3300048091 Bacteria 1590
587 Ga0495626_0075810 3300048091 Bacteria 1502
588 Ga0495626_0103034 3300048091 Bacteria 1242
589 Ga0496102_0020736 3300048905 Bacteria 5808
590 Ga0496102_0090487 3300048905 Bacteria 2832
591 Ga0496103_0337393 3300048906 Bacteria 969
592 Ga0496104_0306694 3300048907 Bacteria 1500
593 Ga0496106_0171427 3300048909 Bacteria 1720
594 Ga0496107_0282353 3300048910 Bacteria 1236
595 Ga0496108_0404994 3300048911 Bacteria 1191
596 Ga0496109_0023680 3300048912 Bacteria 5451
597 Ga0496109_0085340 3300048912 Bacteria 2914
598 Ga0496110_0016404 3300048913 Bacteria 6183
599 Ga0496112_0232886 3300048915 Bacteria 1796
600 Ga0496116_0000936 3300048919 Bacteria 35925
601 Ga0496116_0003902 3300048919 Bacteria 14533
602 Ga0496116_0193619 3300048919 Bacteria 1073
603 Ga0496118_0202442 3300048921 Bacteria 1174
604 Ga0496121_0008363 3300048924 Bacteria 12211
605 Ga0496121_0071244 3300048924 Bacteria 2796
606 Ga0496122_0034067 3300048925 Bacteria 4175
607 Ga0496123_0093014 3300048926 Bacteria 1782
608 Ga0496124_0020565 3300048927 Bacteria 6093
609 Ga0496124_0402695 3300048927 Bacteria 949
610 Ga0496125_0094321 3300048928 Bacteria 2230
611 Ga0496126_0568843 3300048929 Bacteria 897
612 Ga0495678_002211 3300049459 Bacteria 13640
613 Ga0495678_002245 3300049459 Bacteria 13452
614 Ga0495678_002671 3300049459 Bacteria 11803
615 Ga0495678_010990 3300049459 Bacteria 4357
616 Ga0495678_020457 3300049459 Bacteria 2929
617 Ga0495678_031180 3300049459 Bacteria 2225
618 Ga0495678_067754 3300049459 Bacteria 1317
619 Ga0495678_092940 3300049459 Bacteria 1058
620 Ga0495678_115754 3300049459 Bacteria 907
621 Ga0495682_0047811 3300049460 Bacteria 1560
622 Ga0501031_0108655 3300049568 Bacteria 1811
623 Ga0501032_0025564 3300049569 Bacteria 4069
624 Ga0501034_0108480 3300049571 Bacteria 2767
625 Ga0501036_0009156 3300049572 Bacteria 8141
626 Ga0501038_0017779 3300049574 Bacteria 6425
627 Ga0501039_0043147 3300049575 Bacteria 3484
628 Ga0501039_0158740 3300049575 Bacteria 1777
629 Ga0501043_0021833 3300049579 Bacteria 5020
630 Ga0501043_0099213 3300049579 Bacteria 2289
631 Ga0501046_0231046 3300049580 Bacteria 1367
632 Ga0501047_0000598 3300049581 Bacteria 38369
633 Ga0501048_0288221 3300049582 Bacteria 1168
634 Ga0501067_0009501 3300049583 Bacteria 5386
635 Ga0501068_0000042 3300049584 Bacteria 48007
636 Ga0501069_0005495 3300049585 Bacteria 6596
637 Ga0501070_0130393 3300049586 Bacteria 2077
638 Ga0501072_0000004 3300049588 Bacteria 282897
639 Ga0501073_0462574 3300049589 Bacteria 877
640 Ga0501074_0003700 3300049590 Bacteria 10839
641 Ga0501075_0572193 3300049591 Bacteria 862
642 Ga0501076_0005826 3300049592 Bacteria 8889
643 Ga0501077_0004746 3300049593 Bacteria 8264
644 Ga0501240_003085 3300049673 Bacteria 1827
645 Ga0501079_0011435 3300049741 Bacteria 6774
646 Ga0501080_0024373 3300049742 Bacteria 5608
647 Ga0501083_0004101 3300049744 Bacteria 10256
648 Ga0501241_004867 3300049758 Bacteria 2508
649 Ga0501262_017184 3300049759 Bacteria 963
650 Ga0501269_002261 3300049766 Bacteria 2390
651 Ga0501280_007577 3300049776 Bacteria 1517
652 Ga0501035_0127922 3300049822 Bacteria 2216
653 Ga0501035_0162760 3300049822 Bacteria 1931
654 Ga0501035_0807838 3300049822 Bacteria 749
655 Ga0501044_0032096 3300049823 Bacteria 5521
656 Ga0501226_000006 3300049853 Bacteria 259153
657 nmdc:mga00v17_441996_c1 3300050491 Bacteria 844
658 nmdc:mga0rr50_77931_c1 3300050513 Bacteria 2548
659 nmdc:mga08x19_509867_c1 3300050514 Bacteria 850
660 Ga0500572_001081 3300053111 Bacteria 8023
661 Ga0500592_005174 3300053116 Bacteria 2072
662 Ga0500595_026562 3300053119 Bacteria 1994
663 Ga0500568_0016977 3300053139 Bacteria 3222
664 Ga0500627_0000149 3300053158 Bacteria 20586
665 Ga0500649_155733 3300053722 Bacteria 812
666 Ga0501084_0000552 3300054114 Bacteria 28547
667 Ga0587083_0002115 3300059505 Bacteria 2408
668 Ga0587088_015475 3300059508 Bacteria 1202
669 Ga0587067_025154 3300059640 Bacteria 1057
670 Ga0501082_0015460 3300060353 Bacteria 6568
671 Ga0530510_0015841 3300061734 Bacteria 5330
672 2511252775 2511231004 Bacteria 6669789
673 2511267592 2511231006 Bacteria 6794709
674 2511271990 2511231007 Bacteria 6306603
675 2511280220 2511231008 Bacteria 6624100
676 2511292092 2511231010 Bacteria 6373152
677 2511327117 2511231016 Bacteria 6704427
678 2511354311 2511231021 Bacteria 7302637
679 2511365247 2511231022 Bacteria 6719296
680 2511371940 2511231023 Bacteria 6808468
681 2511416178 2511231031 Bacteria 6558529
682 2512324996 2512047018 Bacteria 6663241
683 2583791120 2582580891 Bacteria 6800976
684 2597856735 2597489887 Bacteria 6666321
685 2599483758 2599185185 Bacteria 6652270
686 2600365705 2600254931 Bacteria 6734225
687 2601801138 2600255318 Bacteria 6383414
688 2606073232 2603880185 Bacteria 6379190
689 2606126107 2603880199 Bacteria 6377649
690 2624479319 2623620443 Bacteria 6427864
691 2643822856 2643221560 Bacteria 4801179
692 2643832523 2643221563 Bacteria 4726935
693 2643841853 2643221565 Bacteria 6216018
694 2643934037 2643221585 Bacteria 5812563
695 2644026505 2643221603 Bacteria 6147767
696 2644053682 2643221608 Bacteria 4724829
697 2644220106 2643221639 Bacteria 6649903
698 2644261120 2643221646 Bacteria 6433402
699 2644315524 2643221656 Bacteria 5809961
700 2715751842 2713897148 Bacteria 5883533
701 2715754890 2713897149 Bacteria 6506249
702 2718633166 2718217725 Bacteria 5758958
703 2739053277 2738541337 Bacteria 6183410
704 2739285503 2738543020 Bacteria 5718238
705 2739290816 2738543021 Bacteria 5718241
706 2739314222 2738543025 Bacteria 6600348
707 2842806915 2842805378 Bacteria 5385175
708 2842832809 2842832357 Bacteria 5959113
709 2842848105 2842843487 Bacteria 6004777
710 2852654880 2852653556 Bacteria 4050083
711 2852681418 2852680915 Bacteria 4100189
712 2878031328 2878029506 Bacteria 6418441
713 2919064203 2919063839 Bacteria 6302690
714 2919386287 2919385768 Bacteria 5897293
715 2919457225 2919456309 Bacteria 6586567
716 2919491436 2919487758 Bacteria 5929766
717 2969306096 2969304461 Bacteria 6601805
718 2974292244 2974289157 Bacteria 6080362
719 2984290861 2984286254 Bacteria 6702062
720 2998141497 2998139840 Bacteria 6073514
721 3007400718 3007395558 Bacteria 6755444
722 3007512899 3007511990 Bacteria 6481491
723 3007618925 3007614139 Bacteria 6053559
724 3007620302 3007619802 Bacteria 6411688
725 3007723176 3007718800 Bacteria 5971527
726 3007856094 3007855910 Bacteria 5637581
727 3007863263 3007861166 Bacteria 6045338
728 8011352473 8011350971 Bacteria 6158957
729 8015689396 8015687852 Bacteria 6613826
730 8029999251 8029995093 Bacteria 5990776
731 8055772532 8055770955 Bacteria 6827675
732 8056122245 8056120720 Bacteria 5758328
733 8056156752 8056155041 Bacteria 6486948
734 8056169489 8056166840 Bacteria 5820959
735 8056181039 8056177738 Bacteria 6748268
736 Ga0496126_0663298
737 rootL2_10012056
738 rootH1_10020558
739 rootH1_10114129
740 Ga0055536_1000041
741 Ga0055536_1000042
742 Ga0055536_1004420
743 Ga0055536_1007529
744 Ga0055530_10000063
745 Ga0055530_10000174
746 Ga0055530_10000411
747 Ga0055530_10002068
748 Ga0055530_10035526
749 Ga0055540_1000278
750 Ga0055540_1000318
751 Ga0055531_10000412
752 Ga0055531_10001746
753 Ga0055531_10014294
754 Ga0065165_1000806
755 Ga0065714_10067840
756 Ga0065714_10077559
757 Ga0065714_10091407
758 Ga0065704_10016922
759 Ga0070683_100080622
760 Ga0070683_100226489
761 Ga0070670_100341714
762 Ga0070689_100029810
763 Ga0070669_100045051
764 Ga0070669_100136641
765 Ga0070659_100052719
766 Ga0070713_100283654
767 Ga0070711_100280486
768 Ga0070694_100134776
769 Ga0070708_100194289
770 Ga0070678_100175672
771 Ga0070662_100781482
772 Ga0070681_10068669
773 Ga0070706_100316838
774 Ga0070707_100164803
775 Ga0070699_100038092
776 Ga0070679_100215314
777 Ga0070697_100236948
778 Ga0070695_100275938
779 Ga0070696_100145438
780 Ga0070665_100079480
781 Ga0070665_100228216
782 Ga0068857_100203152
783 Ga0068857_100672582
784 Ga0068856_100107692
785 Ga0068858_100189143
786 Ga0068858_100563001
787 Ga0075363_100296188
788 Ga0075364_10143619
789 Ga0075364_10177054
790 Ga0075432_10008785
791 Ga0075432_10180657
792 Ga0070715_10033756
793 Ga0070715_10125265
794 Ga0070716_100087497
795 Ga0070712_100023860
796 Ga0075370_10252695
797 Ga0068871_100425571
798 Ga0075436_100101982
799 Ga0075435_100109957
800 Ga0099794_10002724
801 Ga0099794_10060371
802 Ga0099795_10187977
803 Ga0105251_10062978
804 Ga0105244_10003184
805 Ga0105244_10037103
806 Ga0105244_10188655
807 Ga0111539_10115694
808 Ga0105243_10000162
809 Ga0105239_10951413
810 Ga0105246_10000155
811 Ga0157345_1000143
812 Ga0157373_10003502
813 Ga0157373_10047355
814 Ga0157371_10003729
815 Ga0157370_10001776
816 Ga0157370_10032589
817 Ga0157370_10052312
818 Ga0157370_10121765
819 Ga0157369_10006367
820 Ga0157369_10007063
821 Ga0157369_10031677
822 Ga0163162_10001228
823 Ga0157372_10183550
824 Ga0157372_10281290
825 Ga0157375_10112993
826 Ga0163163_10542602
827 Ga0182008_10003253
828 Ga0182006_1002922
829 Ga0163161_10004436
830 Ga0163161_10050043
831 Ga0163161_10472340
832 Ga0209148_1009265
833 Ga0209675_1017541
834 Ga0209676_1000016
835 Ga0209676_1000021
836 Ga0209676_1000033
837 Ga0209676_1000084
838 Ga0209676_1000259
839 Ga0209676_1000678
840 Ga0209676_1032689
841 Ga0209676_1044287
842 Ga0209025_1010159
843 Ga0209025_1097914
844 Ga0209050_1000036
845 Ga0209050_1000104
846 Ga0209050_1000107
847 Ga0209051_1000043
848 Ga0209051_1000090
849 Ga0209257_1000098
850 Ga0209257_1000120
851 Ga0209257_1000174
852 Ga0209257_1005689
853 Ga0207696_1003232
854 Ga0207696_1012217
855 Ga0207655_1000297
856 Ga0207655_1005351
857 Ga0207655_1005951
858 Ga0207713_1000904
859 Ga0207684_10061541
860 Ga0207684_10159060
861 Ga0207693_10029957
862 Ga0207663_10515519
863 Ga0207660_10106363
864 Ga0207652_10211914
865 Ga0207646_10075203
866 Ga0207681_10010392
867 Ga0207681_10516310
868 Ga0207690_10013933
869 Ga0207706_10128430
870 Ga0207706_10422077
871 Ga0207709_10000053
872 Ga0207670_10020423
873 Ga0207665_10412055
874 Ga0207667_10339602
875 Ga0207703_10091429
876 Ga0207702_10098651
877 Ga0207674_10242343
878 Ga0207683_10068188
879 Ga0209281_1017534
880 Ga0209588_1011457
881 Ga0207428_10744364
882 Ga0268266_10040819
883 Ga0268264_10645307
884 Ga0268264_10743960
885 Ga0307517_10125729
886 Ga0307511_10069438
887 Ga0316178_1074314
888 Ga0307513_10026909
889 Ga0307509_10154927
890 Ga0307408_100043286
891 Ga0307408_100062538
892 Ga0307408_100146097
893 Ga0307408_100339421
894 Ga0307408_100759601
895 Ga0307408_100992266
896 Ga0307516_10652995
897 Ga0307405_10092853
898 Ga0307405_10238874
899 Ga0307405_10412334
900 Ga0307405_10462843
901 Ga0307413_10039463
902 Ga0307410_10130051
903 Ga0307410_10133193
904 Ga0307410_10632905
905 Ga0307406_10039441
906 Ga0307406_10401992
907 Ga0307406_10702001
908 Ga0307407_10042278
909 Ga0307412_10055008
910 Ga0307412_10072804
911 Ga0307412_10079840
912 Ga0307412_10114202
913 Ga0307412_10223493
914 Ga0307412_10435193
915 Ga0307412_10541563
916 Ga0307412_10556179
917 Ga0307412_11470721
918 Ga0307409_101208841
919 Ga0307416_100023954
920 Ga0307416_100197817
921 Ga0307416_100296603
922 Ga0307416_100455895
923 Ga0307416_100506890
924 Ga0307416_100652117
925 Ga0307414_10003389
926 Ga0307414_10005872
927 Ga0307414_10013889
928 Ga0307414_10060347
929 Ga0307414_10080013
930 Ga0307414_10085351
931 Ga0307414_10289001
932 Ga0307414_10402495
933 Ga0307414_10765296
934 Ga0307411_10028057
935 Ga0307411_10065164
936 Ga0307411_10117242
937 Ga0307411_10558783
938 Ga0307411_11069895
939 Ga0307415_100165558
940 Ga0307510_10024905
941 Ga0307510_10046980
942 Ga0373956_0003525
943 Ga0373924_0398543
944 Ga0373935_0524595
945 Ga0373933_0031907
946 Ga0373937_0034048
947 Ga0395900_0135728
948 Ga0395905_0001480
949 Ga0395905_1103402
950 Ga0237819_02368
951 Ga0400483_223733
952 Ga0436361_0763530
953 Ga0439438_000923
954 Ga0439438_001061
955 Ga0439438_010911
956 Ga0439447_003511
957 Ga0439447_045284
958 Ga0439466_0004829
959 Ga0439466_0031401
960 Ga0439466_0099333
961 Ga0451789_0899180
962 Ga0451841_0453392
963 Ga0439437_000022
964 Ga0439445_0084717
965 Ga0439432_003835
966 Ga0439451_000492
967 Ga0439451_003515
968 Ga0439452_000228
969 Ga0439452_000887
970 Ga0439452_005669
971 Ga0439452_032686
972 Ga0439455_0121919
973 Ga0439456_000846
974 Ga0439456_015178
975 Ga0439456_016896
976 Ga0439463_061554
977 Ga0450911_000109
978 Ga0450911_000586
979 Ga0450911_000664
980 Ga0450911_001017
981 Ga0450911_018217
982 Ga0450922_001334
983 Ga0450890_002436
984 Ga0450900_024871
985 Ga0450902_002639
986 Ga0450902_012270
987 Ga0450902_020192
988 Ga0450903_002399
989 Ga0450904_000351
990 Ga0450904_004766
991 Ga0450906_000113
992 Ga0450906_007555
993 Ga0450907_034413
994 Ga0450910_003593
995 Ga0450908_010450
996 Ga0450909_000292
997 Ga0439434_0034399
998 Ga0439464_0020000
999 Ga0450916_000745
1000 Ga0450918_003338
1001 Ga0450918_028788
1002 Ga0439440_0007444
1003 Ga0466957_0579549
1004 Ga0451576_0499717
1005 Ga0451576_1447878
1006 Ga0466967_0626043
1007 Ga0495617_005747
1008 Ga0495617_026777
1009 Ga0495617_048235
1010 Ga0495617_140815
1011 Ga0495617_141361
1012 Ga0495627_000294
1013 Ga0495627_001723
1014 Ga0495627_028962
1015 Ga0495627_081888
1016 Ga0495592_0183625
1017 Ga0495590_0001607
1018 Ga0495590_0004330
1019 Ga0495590_0064064
1020 Ga0495590_0095853
1021 Ga0495591_000264
1022 Ga0495591_000779
1023 Ga0495591_001542
1024 Ga0495591_001583
1025 Ga0495591_006851
1026 Ga0495591_007918
1027 Ga0495591_018875
1028 Ga0495591_036133
1029 Ga0495591_042273
1030 Ga0495591_057609
1031 Ga0495638_0004020
1032 Ga0495638_0007343
1033 Ga0495638_0017011
1034 Ga0495638_0046463
1035 Ga0495638_0063009
1036 Ga0495638_0093210
1037 Ga0495638_0209299
1038 Ga0495650_0000252
1039 Ga0495650_0004225
1040 Ga0495650_0005746
1041 Ga0495650_0006190
1042 Ga0495650_0013627
1043 Ga0495650_0017220
1044 Ga0495650_0038328
1045 Ga0495650_0113758
1046 Ga0495605_0001812
1047 Ga0495605_0003840
1048 Ga0495605_0050564
1049 Ga0495605_0111437
1050 Ga0495605_0120391
1051 Ga0495584_0003081
1052 Ga0495584_0008042
1053 Ga0495584_0011758
1054 Ga0495584_0012361
1055 Ga0495584_0016505
1056 Ga0495584_0024704
1057 Ga0495584_0039118
1058 Ga0495584_0063013
1059 Ga0495584_0092976
1060 Ga0495584_0134190
1061 Ga0495584_0258107
1062 Ga0495585_0001397
1063 Ga0495585_0003265
1064 Ga0495585_0003336
1065 Ga0495585_0010127
1066 Ga0495585_0014588
1067 Ga0495585_0037032
1068 Ga0495585_0057295
1069 Ga0495585_0058935
1070 Ga0495585_0218900
1071 Ga0495596_0000004
1072 Ga0495596_0049580
1073 Ga0495596_0114882
1074 Ga0495607_0000234
1075 Ga0495607_0002691
1076 Ga0495607_0013818
1077 Ga0495607_0017981
1078 Ga0495607_0028312
1079 Ga0495607_0032571
1080 Ga0495607_0043439
1081 Ga0495607_0072888
1082 Ga0495607_0134096
1083 Ga0495607_0188745
1084 Ga0495607_0294622
1085 Ga0495607_0294634
1086 Ga0495583_0001199
1087 Ga0495583_0004374
1088 Ga0495583_0054324
1089 Ga0495606_0000027
1090 Ga0495606_0000167
1091 Ga0495606_0000432
1092 Ga0495606_0004330
1093 Ga0495606_0004584
1094 Ga0495606_0008054
1095 Ga0495606_0031869
1096 Ga0495606_0033966
1097 Ga0495606_0037407
1098 Ga0495606_0138700
1099 Ga0495606_0169322
1100 Ga0495606_0188470
1101 Ga0495606_0221842
1102 Ga0495606_0234503
1103 Ga0495610_0001754
1104 Ga0495610_0004292
1105 Ga0495610_0005652
1106 Ga0495610_0036818
1107 Ga0495610_0037611
1108 Ga0495610_0040776
1109 Ga0495610_0042341
1110 Ga0495610_0131779
1111 Ga0495610_0232050
1112 Ga0495616_0002308
1113 Ga0495616_0003473
1114 Ga0495616_0010604
1115 Ga0495616_0012448
1116 Ga0495616_0018182
1117 Ga0495620_0002095
1118 Ga0495620_0003062
1119 Ga0495620_0003879
1120 Ga0495620_0004015
1121 Ga0495620_0004328
1122 Ga0495620_0062615
1123 Ga0495631_0000149
1124 Ga0495631_0002305
1125 Ga0495631_0004457
1126 Ga0495631_0076998
1127 Ga0495631_0129927
1128 Ga0495632_0030521
1129 Ga0495632_0034500
1130 Ga0495632_0036575
1131 Ga0495632_0056595
1132 Ga0495637_0000115
1133 Ga0495637_0000654
1134 Ga0495637_0001934
1135 Ga0495637_0002446
1136 Ga0495637_0004911
1137 Ga0495637_0010206
1138 Ga0495637_0010283
1139 Ga0495637_0015761
1140 Ga0495637_0021681
1141 Ga0495637_0038394
1142 Ga0495637_0055376
1143 Ga0495637_0119874
1144 Ga0495643_0000017
1145 Ga0495643_0002097
1146 Ga0495643_0002834
1147 Ga0495643_0008137
1148 Ga0495643_0012757
1149 Ga0495643_0095018
1150 Ga0495643_0210009
1151 Ga0495643_0210615
1152 Ga0495643_0212589
1153 Ga0495644_0005006
1154 Ga0495644_0014553
1155 Ga0495644_0042611
1156 Ga0495648_0000984
1157 Ga0495648_0002891
1158 Ga0495648_0005805
1159 Ga0495648_0007492
1160 Ga0495648_0026103
1161 Ga0495648_0045096
1162 Ga0495648_0069100
1163 Ga0495648_0076627
1164 Ga0495648_0116778
1165 Ga0495648_0169728
1166 Ga0495642_0002441
1167 Ga0495642_0236055
1168 Ga0495652_0659055
1169 Ga0495654_0000562
1170 Ga0495654_0002377
1171 Ga0495654_0003492
1172 Ga0495654_0006522
1173 Ga0495654_0007462
1174 Ga0495654_0041327
1175 Ga0495654_0098420
1176 Ga0495654_0112840
1177 Ga0495654_0119617
1178 Ga0495654_0140797
1179 Ga0495654_0183025
1180 Ga0495609_0000167
1181 Ga0495609_0007889
1182 Ga0495609_0010937
1183 Ga0495609_0128818
1184 Ga0495597_0003183
1185 Ga0495597_0015167
1186 Ga0495597_0076975
1187 Ga0495622_0001087
1188 Ga0495622_0005194
1189 Ga0495622_0150388
1190 Ga0495633_0001003
1191 Ga0495633_0002568
1192 Ga0495633_0333178
1193 Ga0495656_0359253
1194 Ga0495668_0000001
1195 Ga0495668_0000940
1196 Ga0495668_0003395
1197 Ga0495668_0023851
1198 Ga0495668_0066858
1199 Ga0495611_0000389
1200 Ga0495611_0002128
1201 Ga0495611_0100941
1202 Ga0495611_0115178
1203 Ga0495625_0000134
1204 Ga0495625_0001920
1205 Ga0495625_0011342
1206 Ga0495625_0023743
1207 Ga0495625_0041046
1208 Ga0495625_0043260
1209 Ga0495625_0093804
1210 Ga0495625_0146097
1211 Ga0495625_0174420
1212 Ga0495625_0205310
1213 Ga0495659_0022129
1214 Ga0495661_0000088
1215 Ga0495661_0008979
1216 Ga0495661_0066139
1217 Ga0495661_0071483
1218 Ga0495661_0107480
1219 Ga0495661_0149759
1220 Ga0495661_0161533
1221 Ga0495661_0187417
1222 Ga0495661_0216117
1223 Ga0495661_0267606
1224 Ga0495588_0174771
1225 Ga0495658_0070719
1226 Ga0495658_0113516
1227 Ga0495613_0149140
1228 Ga0495670_0001008
1229 Ga0495670_0001827
1230 Ga0495670_0034921
1231 Ga0495670_0125963
1232 Ga0495671_0000415
1233 Ga0495671_0008110
1234 Ga0495671_0032798
1235 Ga0495671_0038716
1236 Ga0495671_0058186
1237 Ga0495671_0101086
1238 Ga0495671_0216479
1239 Ga0495649_0002749
1240 Ga0495649_0003541
1241 Ga0495649_0015332
1242 Ga0495649_0024472
1243 Ga0495649_0051679
1244 Ga0495649_0073950
1245 Ga0495649_0076099
1246 Ga0495649_0091165
1247 Ga0495649_0101904
1248 Ga0495589_0001040
1249 Ga0495589_0027780
1250 Ga0495589_0039648
1251 Ga0495589_0089435
1252 Ga0495589_0140742
1253 Ga0495589_0347368
1254 Ga0495660_0002844
1255 Ga0495660_0031049
1256 Ga0495660_0038328
1257 Ga0495660_0042187
1258 Ga0495660_0059247
1259 Ga0495660_0067709
1260 Ga0495660_0071356
1261 Ga0495660_0078911
1262 Ga0495660_0106128
1263 Ga0495660_0126678
1264 Ga0495660_0145568
1265 Ga0495660_0146266
1266 Ga0495660_0155903
1267 Ga0495660_0176292
1268 Ga0495581_0342779
1269 Ga0495604_0089291
1270 Ga0495672_0003397
1271 Ga0495672_0005137
1272 Ga0495672_0110212
1273 Ga0495672_0135188
1274 Ga0495672_0195550
1275 Ga0495672_0196093
1276 Ga0495672_0222008
1277 Ga0495676_0000018
1278 Ga0495676_0005024
1279 Ga0495680_0061105
1280 Ga0495683_0000217
1281 Ga0495683_0045859
1282 Ga0495683_0066167
1283 Ga0495683_0242211
1284 Ga0495683_0244836
1285 Ga0495679_001426
1286 Ga0495679_002236
1287 Ga0495679_008371
1288 Ga0495679_031744
1289 Ga0495685_010530
1290 Ga0495673_0001075
1291 Ga0495673_0002192
1292 Ga0495673_0003526
1293 Ga0495673_0004319
1294 Ga0495673_0007446
1295 Ga0495673_0033062
1296 Ga0495673_0056910
1297 Ga0495673_0077146
1298 Ga0495673_0212344
1299 Ga0495681_0003361
1300 Ga0495681_0008798
1301 Ga0495681_0009250
1302 Ga0495681_0015123
1303 Ga0495681_0018432
1304 Ga0495681_0024628
1305 Ga0495681_0033755
1306 Ga0495681_0034021
1307 Ga0495681_0055225
1308 Ga0495681_0093808
1309 Ga0495681_0099802
1310 Ga0495686_0003379
1311 Ga0495686_0007931
1312 Ga0495686_0008555
1313 Ga0495686_0266678
1314 Ga0495602_0008372
1315 Ga0495626_0000172
1316 Ga0495626_0000216
1317 Ga0495626_0001853
1318 Ga0495626_0007749
1319 Ga0495626_0011815
1320 Ga0495626_0064937
1321 Ga0495626_0069190
1322 Ga0495626_0075810
1323 Ga0495626_0103034
1324 Ga0496102_0020736
1325 Ga0496102_0090487
1326 Ga0496103_0337393
1327 Ga0496104_0306694
1328 Ga0496106_0171427
1329 Ga0496107_0282353
1330 Ga0496108_0404994
1331 Ga0496109_0023680
1332 Ga0496109_0085340
1333 Ga0496110_0016404
1334 Ga0496112_0232886
1335 Ga0496116_0000936
1336 Ga0496116_0003902
1337 Ga0496116_0193619
1338 Ga0496118_0202442
1339 Ga0496121_0008363
1340 Ga0496121_0071244
1341 Ga0496122_0034067
1342 Ga0496123_0093014
1343 Ga0496124_0020565
1344 Ga0496124_0402695
1345 Ga0496125_0094321
1346 Ga0496126_0568843
1347 Ga0495678_002211
1348 Ga0495678_002245
1349 Ga0495678_002671
1350 Ga0495678_010990
1351 Ga0495678_020457
1352 Ga0495678_031180
1353 Ga0495678_067754
1354 Ga0495678_092940
1355 Ga0495678_115754
1356 Ga0495682_0047811
1357 Ga0501031_0108655
1358 Ga0501032_0025564
1359 Ga0501034_0108480
1360 Ga0501036_0009156
1361 Ga0501038_0017779
1362 Ga0501039_0043147
1363 Ga0501039_0158740
1364 Ga0501043_0021833
1365 Ga0501043_0099213
1366 Ga0501046_0231046
1367 Ga0501047_0000598
1368 Ga0501048_0288221
1369 Ga0501067_0009501
1370 Ga0501068_0000042
1371 Ga0501069_0005495
1372 Ga0501070_0130393
1373 Ga0501072_0000004
1374 Ga0501073_0462574
1375 Ga0501074_0003700
1376 Ga0501075_0572193
1377 Ga0501076_0005826
1378 Ga0501077_0004746
1379 Ga0501240_003085
1380 Ga0501079_0011435
1381 Ga0501080_0024373
1382 Ga0501083_0004101
1383 Ga0501241_004867
1384 Ga0501262_017184
1385 Ga0501269_002261
1386 Ga0501280_007577
1387 Ga0501035_0127922
1388 Ga0501035_0162760
1389 Ga0501035_0807838
1390 Ga0501044_0032096
1391 Ga0501226_000006
1392 nmdc:mga00v17_441996_c1
1393 nmdc:mga0rr50_77931_c1
1394 nmdc:mga08x19_509867_c1
1395 Ga0500572_001081
1396 Ga0500592_005174
1397 Ga0500595_026562
1398 Ga0500568_0016977
1399 Ga0500627_0000149
1400 Ga0500649_155733
1401 Ga0501084_0000552
1402 Ga0587083_0002115
1403 Ga0587088_015475
1404 Ga0587067_025154
1405 Ga0501082_0015460
1406 Ga0530510_0015841
1407 2511252775
1408 2511267592
1409 2511271990
1410 2511280220
1411 2511292092
1412 2511327117
1413 2511354311
1414 2511365247
1415 2511371940
1416 2511416178
1417 2512324996
1418 2583791120
1419 2597856735
1420 2599483758
1421 2600365705
1422 2601801138
1423 2606073232
1424 2606126107
1425 2624479319
1426 2643822856
1427 2643832523
1428 2643841853
1429 2643934037
1430 2644026505
1431 2644053682
1432 2644220106
1433 2644261120
1434 2644315524
1435 2715751842
1436 2715754890
1437 2718633166
1438 2739053277
1439 2739285503
1440 2739290816
1441 2739314222
1442 2842806915
1443 2842832809
1444 2842848105
1445 2852654880
1446 2852681418
1447 2878031328
1448 2919064203
1449 2919386287
1450 2919457225
1451 2919491436
1452 2969306096
1453 2974292244
1454 2984290861
1455 2998141497
1456 3007400718
1457 3007512899
1458 3007618925
1459 3007620302
1460 3007723176
1461 3007856094
1462 3007863263
1463 8011352473
1464 8015689396
1465 8029999251
1466 8055772532
1467 8056122245
1468 8056156752
1469 8056169489
1470 8056181039

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n71-assembly3.cif.gz_D x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.8268 29 179
4mln-assembly1.cif.gz_A crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid 0.8191 29 180
4n71-assembly4.cif.gz_E x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.819 29 179
4n6w-assembly1.cif.gz_A x-ray crystal structure of citrate-bound phnz 0.8124 29 180
4mln-assembly2.cif.gz_B crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid 0.7958 29 180
ID Description Score Start End Superfamily
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7958 29 180 1.10.3210.10
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6741 29 180 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5964 14 179 1.10.3210.10
af_P9WN29_336_562_1.10.3090.10 Mainly Alpha;Orthogonal Bundle;cca-adding enzyme, domain 2;cca-adding enzyme, domain 2 0.5741 57 174 1.10.3090.10
af_Q9QXN4_37_285_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5737 22 184 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A2E5TDX1-F1-model_v4 deleted 0.994 2 190
AF-A0A848QJA5-F1-model_v4 HD domain-containing protein 0.9938 1 186
AF-A0A2U0VKN6-F1-model_v4 deleted 0.9932 2 188
AF-A0A0K6HUR8-F1-model_v4 deleted 0.9921 1 191
AF-A0A7Y1TB96-F1-model_v4 HD domain-containing protein 0.9914 10 176

Map