F478231
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 735 | 342 | 1470 | 196 |
Family's Representative Sequence
| Representative Sequence | 3300048929|Ga0496126_0663298|Ga0496126_0663298_201_794 |
| Length | 197 |
| Sequence | MTTIRKALMETVRFTKMAEGTKEEYELLAARGAAFTVRLPDRILAALDELREGGDGYRVTRFEHSVQTATRAHRDGKDEEYVVMALVHDIGDGLAPYTHSEMIGAVLQPFVRPEIVWIARHHGAFQLYYYAHHYGRDRNVREAHRGHQWFDACAEFCEQYDQVSFDPDYDNLPIEHFQPMVRRVFGQPRYARPDGDS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 2 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 5 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 6 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 34 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 35 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 36 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 37 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 41 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 42 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 45 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 46 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 62 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 92 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 94 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 97 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 98 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 99 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 100 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 101 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 102 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 103 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 104 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 105 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 106 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 107 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 108 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 109 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 110 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 111 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 112 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 113 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 114 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 115 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 116 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 117 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 118 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 119 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 121 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 122 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 123 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 124 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 125 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 126 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 127 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 128 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 129 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 130 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 131 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 132 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 133 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 134 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 135 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 136 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 137 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 138 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 139 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 140 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 141 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 142 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 143 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 144 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 145 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 146 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 147 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 148 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 149 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 150 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 151 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 152 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 153 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 154 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 155 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 156 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 157 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 158 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 216 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 217 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 218 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 219 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 220 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 222 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 223 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 224 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 225 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 226 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 227 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 228 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 229 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 230 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 231 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 254 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 258 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 259 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 260 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 261 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 268 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 269 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 270 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 271 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 272 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 273 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 279 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 280 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 281 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 282 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 283 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 284 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 285 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 286 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 287 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 288 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 289 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 290 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 291 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 292 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 293 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 294 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 295 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 296 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 297 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 298 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 299 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 300 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 301 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 302 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 303 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 304 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 305 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 306 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 307 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 308 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 309 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 310 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 311 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 312 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 313 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 314 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 315 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 316 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 317 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 318 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 319 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 320 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 321 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 322 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 323 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 324 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 325 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 326 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 327 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 328 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 329 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 330 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 331 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 332 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 333 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 334 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 335 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 336 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 337 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 338 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 339 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 340 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 341 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 342 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.88 |
| Metatranscriptomes | 0.41 |
| Isolates | 8.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.39 |
| Nodule | 1.5 |
| Rhizoplane | 2.31 |
| Rhizosphere | 83.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496126_0663298 | 3300048929 | Bacteria | 815 |
| 2 | rootL2_10012056 | 3300003322 | Bacteria | 13768 |
| 3 | rootH1_10020558 | 3300003323 | Bacteria | 3467 |
| 4 | rootH1_10114129 | 3300003323 | Bacteria | 1353 |
| 5 | Ga0055536_1000041 | 3300003781 | Bacteria | 127266 |
| 6 | Ga0055536_1000042 | 3300003781 | Bacteria | 125029 |
| 7 | Ga0055536_1004420 | 3300003781 | Bacteria | 7198 |
| 8 | Ga0055536_1007529 | 3300003781 | Bacteria | 4851 |
| 9 | Ga0055530_10000063 | 3300003791 | Bacteria | 94619 |
| 10 | Ga0055530_10000174 | 3300003791 | Bacteria | 58795 |
| 11 | Ga0055530_10000411 | 3300003791 | Bacteria | 38127 |
| 12 | Ga0055530_10002068 | 3300003791 | Bacteria | 13475 |
| 13 | Ga0055530_10035526 | 3300003791 | Bacteria | 1263 |
| 14 | Ga0055540_1000278 | 3300003792 | Bacteria | 45985 |
| 15 | Ga0055540_1000318 | 3300003792 | Bacteria | 42704 |
| 16 | Ga0055531_10000412 | 3300003794 | Bacteria | 41097 |
| 17 | Ga0055531_10001746 | 3300003794 | Bacteria | 15529 |
| 18 | Ga0055531_10014294 | 3300003794 | Bacteria | 3584 |
| 19 | Ga0065165_1000806 | 3300005262 | Bacteria | 41749 |
| 20 | Ga0065714_10067840 | 3300005288 | Bacteria | 5163 |
| 21 | Ga0065714_10077559 | 3300005288 | Bacteria | 2676 |
| 22 | Ga0065714_10091407 | 3300005288 | Bacteria | 1896 |
| 23 | Ga0065704_10016922 | 3300005289 | Bacteria | 2168 |
| 24 | Ga0070683_100080622 | 3300005329 | Bacteria | 3047 |
| 25 | Ga0070683_100226489 | 3300005329 | Bacteria | 1777 |
| 26 | Ga0070670_100341714 | 3300005331 | Bacteria | 1314 |
| 27 | Ga0070689_100029810 | 3300005340 | Bacteria | 4135 |
| 28 | Ga0070669_100045051 | 3300005353 | Bacteria | 3214 |
| 29 | Ga0070669_100136641 | 3300005353 | Bacteria | 1886 |
| 30 | Ga0070659_100052719 | 3300005366 | Bacteria | 3200 |
| 31 | Ga0070713_100283654 | 3300005436 | Bacteria | 1520 |
| 32 | Ga0070711_100280486 | 3300005439 | Bacteria | 1318 |
| 33 | Ga0070694_100134776 | 3300005444 | Bacteria | 1788 |
| 34 | Ga0070708_100194289 | 3300005445 | Bacteria | 1899 |
| 35 | Ga0070678_100175672 | 3300005456 | Bacteria | 1748 |
| 36 | Ga0070662_100781482 | 3300005457 | Bacteria | 811 |
| 37 | Ga0070681_10068669 | 3300005458 | Bacteria | 3511 |
| 38 | Ga0070706_100316838 | 3300005467 | Bacteria | 1455 |
| 39 | Ga0070707_100164803 | 3300005468 | Bacteria | 2160 |
| 40 | Ga0070699_100038092 | 3300005518 | Bacteria | 4164 |
| 41 | Ga0070679_100215314 | 3300005530 | Bacteria | 1883 |
| 42 | Ga0070697_100236948 | 3300005536 | Bacteria | 1558 |
| 43 | Ga0070695_100275938 | 3300005545 | Bacteria | 1233 |
| 44 | Ga0070696_100145438 | 3300005546 | Bacteria | 1736 |
| 45 | Ga0070665_100079480 | 3300005548 | Bacteria | 3285 |
| 46 | Ga0070665_100228216 | 3300005548 | Bacteria | 1862 |
| 47 | Ga0068857_100203152 | 3300005577 | Bacteria | 1806 |
| 48 | Ga0068857_100672582 | 3300005577 | Bacteria | 982 |
| 49 | Ga0068856_100107692 | 3300005614 | Bacteria | 2783 |
| 50 | Ga0068858_100189143 | 3300005842 | Bacteria | 1945 |
| 51 | Ga0068858_100563001 | 3300005842 | Bacteria | 1104 |
| 52 | Ga0075363_100296188 | 3300006048 | Bacteria | 938 |
| 53 | Ga0075364_10143619 | 3300006051 | Bacteria | 1606 |
| 54 | Ga0075364_10177054 | 3300006051 | Bacteria | 1443 |
| 55 | Ga0075432_10008785 | 3300006058 | Bacteria | 3447 |
| 56 | Ga0075432_10180657 | 3300006058 | Bacteria | 825 |
| 57 | Ga0070715_10033756 | 3300006163 | Bacteria | 2094 |
| 58 | Ga0070715_10125265 | 3300006163 | Bacteria | 1230 |
| 59 | Ga0070716_100087497 | 3300006173 | Bacteria | 1877 |
| 60 | Ga0070712_100023860 | 3300006175 | Bacteria | 4045 |
| 61 | Ga0075370_10252695 | 3300006353 | Bacteria | 1045 |
| 62 | Ga0068871_100425571 | 3300006358 | Bacteria | 1186 |
| 63 | Ga0075436_100101982 | 3300006914 | Bacteria | 1999 |
| 64 | Ga0075435_100109957 | 3300007076 | Bacteria | 2292 |
| 65 | Ga0099794_10002724 | 3300007265 | Bacteria | 6587 |
| 66 | Ga0099794_10060371 | 3300007265 | Bacteria | 1841 |
| 67 | Ga0099795_10187977 | 3300007788 | Bacteria | 866 |
| 68 | Ga0105251_10062978 | 3300009011 | Bacteria | 1741 |
| 69 | Ga0105244_10003184 | 3300009036 | Bacteria | 11908 |
| 70 | Ga0105244_10037103 | 3300009036 | Bacteria | 2549 |
| 71 | Ga0105244_10188655 | 3300009036 | Bacteria | 975 |
| 72 | Ga0111539_10115694 | 3300009094 | Bacteria | 3144 |
| 73 | Ga0105243_10000162 | 3300009148 | Bacteria | 75904 |
| 74 | Ga0105239_10951413 | 3300010375 | Bacteria | 987 |
| 75 | Ga0105246_10000155 | 3300011119 | Bacteria | 32536 |
| 76 | Ga0157345_1000143 | 3300012498 | Bacteria | 12901 |
| 77 | Ga0157373_10003502 | 3300013100 | Bacteria | 11872 |
| 78 | Ga0157373_10047355 | 3300013100 | Bacteria | 3067 |
| 79 | Ga0157371_10003729 | 3300013102 | Bacteria | 13654 |
| 80 | Ga0157370_10001776 | 3300013104 | Bacteria | 26607 |
| 81 | Ga0157370_10032589 | 3300013104 | Bacteria | 5087 |
| 82 | Ga0157370_10052312 | 3300013104 | Bacteria | 3899 |
| 83 | Ga0157370_10121765 | 3300013104 | Bacteria | 2436 |
| 84 | Ga0157369_10006367 | 3300013105 | Bacteria | 13695 |
| 85 | Ga0157369_10007063 | 3300013105 | Bacteria | 12952 |
| 86 | Ga0157369_10031677 | 3300013105 | Bacteria | 5819 |
| 87 | Ga0163162_10001228 | 3300013306 | Bacteria | 23952 |
| 88 | Ga0157372_10183550 | 3300013307 | Bacteria | 2422 |
| 89 | Ga0157372_10281290 | 3300013307 | Bacteria | 1934 |
| 90 | Ga0157375_10112993 | 3300013308 | Bacteria | 2817 |
| 91 | Ga0163163_10542602 | 3300014325 | Bacteria | 1225 |
| 92 | Ga0182008_10003253 | 3300014497 | Bacteria | 9911 |
| 93 | Ga0182006_1002922 | 3300015261 | Bacteria | 9062 |
| 94 | Ga0163161_10004436 | 3300017792 | Bacteria | 9780 |
| 95 | Ga0163161_10050043 | 3300017792 | Bacteria | 3022 |
| 96 | Ga0163161_10472340 | 3300017792 | Bacteria | 1017 |
| 97 | Ga0209148_1009265 | 3300025254 | Bacteria | 1927 |
| 98 | Ga0209675_1017541 | 3300025291 | Bacteria | 2042 |
| 99 | Ga0209676_1000016 | 3300025292 | Bacteria | 655561 |
| 100 | Ga0209676_1000021 | 3300025292 | Bacteria | 609534 |
| 101 | Ga0209676_1000033 | 3300025292 | Bacteria | 463236 |
| 102 | Ga0209676_1000084 | 3300025292 | Bacteria | 274330 |
| 103 | Ga0209676_1000259 | 3300025292 | Bacteria | 111746 |
| 104 | Ga0209676_1000678 | 3300025292 | Bacteria | 48300 |
| 105 | Ga0209676_1032689 | 3300025292 | Bacteria | 1561 |
| 106 | Ga0209676_1044287 | 3300025292 | Bacteria | 1221 |
| 107 | Ga0209025_1010159 | 3300025294 | Bacteria | 6422 |
| 108 | Ga0209025_1097914 | 3300025294 | Bacteria | 938 |
| 109 | Ga0209050_1000036 | 3300025298 | Bacteria | 423070 |
| 110 | Ga0209050_1000104 | 3300025298 | Bacteria | 228921 |
| 111 | Ga0209050_1000107 | 3300025298 | Bacteria | 223303 |
| 112 | Ga0209051_1000043 | 3300025303 | Bacteria | 305473 |
| 113 | Ga0209051_1000090 | 3300025303 | Bacteria | 173748 |
| 114 | Ga0209257_1000098 | 3300025304 | Bacteria | 256390 |
| 115 | Ga0209257_1000120 | 3300025304 | Bacteria | 223025 |
| 116 | Ga0209257_1000174 | 3300025304 | Bacteria | 165255 |
| 117 | Ga0209257_1005689 | 3300025304 | Bacteria | 8578 |
| 118 | Ga0207696_1003232 | 3300025711 | Bacteria | 7518 |
| 119 | Ga0207696_1012217 | 3300025711 | Bacteria | 3045 |
| 120 | Ga0207655_1000297 | 3300025728 | Bacteria | 75120 |
| 121 | Ga0207655_1005351 | 3300025728 | Bacteria | 8757 |
| 122 | Ga0207655_1005951 | 3300025728 | Bacteria | 8173 |
| 123 | Ga0207713_1000904 | 3300025735 | Bacteria | 26862 |
| 124 | Ga0207684_10061541 | 3300025910 | Bacteria | 3188 |
| 125 | Ga0207684_10159060 | 3300025910 | Bacteria | 1945 |
| 126 | Ga0207693_10029957 | 3300025915 | Bacteria | 4295 |
| 127 | Ga0207663_10515519 | 3300025916 | Bacteria | 930 |
| 128 | Ga0207660_10106363 | 3300025917 | Bacteria | 2104 |
| 129 | Ga0207652_10211914 | 3300025921 | Bacteria | 1744 |
| 130 | Ga0207646_10075203 | 3300025922 | Bacteria | 3018 |
| 131 | Ga0207681_10010392 | 3300025923 | Bacteria | 5696 |
| 132 | Ga0207681_10516310 | 3300025923 | Bacteria | 980 |
| 133 | Ga0207690_10013933 | 3300025932 | Bacteria | 4845 |
| 134 | Ga0207706_10128430 | 3300025933 | Bacteria | 2229 |
| 135 | Ga0207706_10422077 | 3300025933 | Bacteria | 1155 |
| 136 | Ga0207709_10000053 | 3300025935 | Bacteria | 225514 |
| 137 | Ga0207670_10020423 | 3300025936 | Bacteria | 4070 |
| 138 | Ga0207665_10412055 | 3300025939 | Bacteria | 1031 |
| 139 | Ga0207667_10339602 | 3300025949 | Bacteria | 1533 |
| 140 | Ga0207703_10091429 | 3300026035 | Bacteria | 2559 |
| 141 | Ga0207702_10098651 | 3300026078 | Bacteria | 2574 |
| 142 | Ga0207674_10242343 | 3300026116 | Bacteria | 1750 |
| 143 | Ga0207683_10068188 | 3300026121 | Bacteria | 3139 |
| 144 | Ga0209281_1017534 | 3300027111 | Bacteria | 1449 |
| 145 | Ga0209588_1011457 | 3300027671 | Bacteria | 2679 |
| 146 | Ga0207428_10744364 | 3300027907 | Bacteria | 699 |
| 147 | Ga0268266_10040819 | 3300028379 | Bacteria | 3956 |
| 148 | Ga0268264_10645307 | 3300028381 | Bacteria | 1047 |
| 149 | Ga0268264_10743960 | 3300028381 | Bacteria | 976 |
| 150 | Ga0307517_10125729 | 3300028786 | Bacteria | 1872 |
| 151 | Ga0307511_10069438 | 3300030521 | Bacteria | 2590 |
| 152 | Ga0316178_1074314 | 3300030735 | Bacteria | 21620 |
| 153 | Ga0307513_10026909 | 3300031456 | Bacteria | 6616 |
| 154 | Ga0307509_10154927 | 3300031507 | Bacteria | 2199 |
| 155 | Ga0307408_100043286 | 3300031548 | Bacteria | 3203 |
| 156 | Ga0307408_100062538 | 3300031548 | Bacteria | 2720 |
| 157 | Ga0307408_100146097 | 3300031548 | Bacteria | 1861 |
| 158 | Ga0307408_100339421 | 3300031548 | Bacteria | 1271 |
| 159 | Ga0307408_100759601 | 3300031548 | Bacteria | 876 |
| 160 | Ga0307408_100992266 | 3300031548 | Bacteria | 773 |
| 161 | Ga0307516_10652995 | 3300031730 | Bacteria | 707 |
| 162 | Ga0307405_10092853 | 3300031731 | Bacteria | 2003 |
| 163 | Ga0307405_10238874 | 3300031731 | Bacteria | 1344 |
| 164 | Ga0307405_10412334 | 3300031731 | Bacteria | 1061 |
| 165 | Ga0307405_10462843 | 3300031731 | Bacteria | 1008 |
| 166 | Ga0307413_10039463 | 3300031824 | Bacteria | 2746 |
| 167 | Ga0307410_10130051 | 3300031852 | Bacteria | 1848 |
| 168 | Ga0307410_10133193 | 3300031852 | Bacteria | 1828 |
| 169 | Ga0307410_10632905 | 3300031852 | Bacteria | 895 |
| 170 | Ga0307406_10039441 | 3300031901 | Bacteria | 2930 |
| 171 | Ga0307406_10401992 | 3300031901 | Bacteria | 1086 |
| 172 | Ga0307406_10702001 | 3300031901 | Bacteria | 845 |
| 173 | Ga0307407_10042278 | 3300031903 | Bacteria | 2554 |
| 174 | Ga0307412_10055008 | 3300031911 | Bacteria | 2645 |
| 175 | Ga0307412_10072804 | 3300031911 | Bacteria | 2349 |
| 176 | Ga0307412_10079840 | 3300031911 | Bacteria | 2258 |
| 177 | Ga0307412_10114202 | 3300031911 | Bacteria | 1933 |
| 178 | Ga0307412_10223493 | 3300031911 | Bacteria | 1445 |
| 179 | Ga0307412_10435193 | 3300031911 | Bacteria | 1076 |
| 180 | Ga0307412_10541563 | 3300031911 | Bacteria | 976 |
| 181 | Ga0307412_10556179 | 3300031911 | Bacteria | 964 |
| 182 | Ga0307412_11470721 | 3300031911 | Bacteria | 618 |
| 183 | Ga0307409_101208841 | 3300031995 | Bacteria | 779 |
| 184 | Ga0307416_100023954 | 3300032002 | Bacteria | 4443 |
| 185 | Ga0307416_100197817 | 3300032002 | Bacteria | 1903 |
| 186 | Ga0307416_100296603 | 3300032002 | Bacteria | 1604 |
| 187 | Ga0307416_100455895 | 3300032002 | Bacteria | 1332 |
| 188 | Ga0307416_100506890 | 3300032002 | Bacteria | 1272 |
| 189 | Ga0307416_100652117 | 3300032002 | Bacteria | 1137 |
| 190 | Ga0307414_10003389 | 3300032004 | Bacteria | 8514 |
| 191 | Ga0307414_10005872 | 3300032004 | Bacteria | 6791 |
| 192 | Ga0307414_10013889 | 3300032004 | Bacteria | 4809 |
| 193 | Ga0307414_10060347 | 3300032004 | Bacteria | 2681 |
| 194 | Ga0307414_10080013 | 3300032004 | Bacteria | 2388 |
| 195 | Ga0307414_10085351 | 3300032004 | Bacteria | 2325 |
| 196 | Ga0307414_10289001 | 3300032004 | Bacteria | 1381 |
| 197 | Ga0307414_10402495 | 3300032004 | Bacteria | 1189 |
| 198 | Ga0307414_10765296 | 3300032004 | Bacteria | 878 |
| 199 | Ga0307411_10028057 | 3300032005 | Bacteria | 3416 |
| 200 | Ga0307411_10065164 | 3300032005 | Bacteria | 2442 |
| 201 | Ga0307411_10117242 | 3300032005 | Bacteria | 1918 |
| 202 | Ga0307411_10558783 | 3300032005 | Bacteria | 977 |
| 203 | Ga0307411_11069895 | 3300032005 | Bacteria | 725 |
| 204 | Ga0307415_100165558 | 3300032126 | Bacteria | 1718 |
| 205 | Ga0307510_10024905 | 3300033180 | Bacteria | 6908 |
| 206 | Ga0307510_10046980 | 3300033180 | Bacteria | 4633 |
| 207 | Ga0373956_0003525 | 3300035119 | Bacteria | 6302 |
| 208 | Ga0373924_0398543 | 3300035410 | Bacteria | 615 |
| 209 | Ga0373935_0524595 | 3300035692 | Bacteria | 862 |
| 210 | Ga0373933_0031907 | 3300035724 | Bacteria | 3059 |
| 211 | Ga0373937_0034048 | 3300036401 | Bacteria | 4631 |
| 212 | Ga0395900_0135728 | 3300037418 | Bacteria | 2520 |
| 213 | Ga0395905_0001480 | 3300037471 | Bacteria | 28107 |
| 214 | Ga0395905_1103402 | 3300037471 | Bacteria | 697 |
| 215 | Ga0237819_02368 | 3300038705 | Bacteria | 3841 |
| 216 | Ga0400483_223733 | 3300039062 | Bacteria | 1201 |
| 217 | Ga0436361_0763530 | 3300039447 | Bacteria | 2724 |
| 218 | Ga0439438_000923 | 3300041405 | Bacteria | 13115 |
| 219 | Ga0439438_001061 | 3300041405 | Bacteria | 12247 |
| 220 | Ga0439438_010911 | 3300041405 | Bacteria | 2852 |
| 221 | Ga0439447_003511 | 3300041407 | Bacteria | 5564 |
| 222 | Ga0439447_045284 | 3300041407 | Bacteria | 1062 |
| 223 | Ga0439466_0004829 | 3300041411 | Bacteria | 5181 |
| 224 | Ga0439466_0031401 | 3300041411 | Bacteria | 1816 |
| 225 | Ga0439466_0099333 | 3300041411 | Bacteria | 908 |
| 226 | Ga0451789_0899180 | 3300041443 | Bacteria | 627 |
| 227 | Ga0451841_0453392 | 3300041498 | Bacteria | 1455 |
| 228 | Ga0439437_000022 | 3300042000 | Bacteria | 12184 |
| 229 | Ga0439445_0084717 | 3300042004 | Bacteria | 888 |
| 230 | Ga0439432_003835 | 3300042006 | Bacteria | 5543 |
| 231 | Ga0439451_000492 | 3300042009 | Bacteria | 7623 |
| 232 | Ga0439451_003515 | 3300042009 | Bacteria | 3178 |
| 233 | Ga0439452_000228 | 3300042010 | Bacteria | 39646 |
| 234 | Ga0439452_000887 | 3300042010 | Bacteria | 13768 |
| 235 | Ga0439452_005669 | 3300042010 | Bacteria | 3996 |
| 236 | Ga0439452_032686 | 3300042010 | Bacteria | 1269 |
| 237 | Ga0439455_0121919 | 3300042012 | Bacteria | 731 |
| 238 | Ga0439456_000846 | 3300042013 | Bacteria | 6187 |
| 239 | Ga0439456_015178 | 3300042013 | Bacteria | 1608 |
| 240 | Ga0439456_016896 | 3300042013 | Bacteria | 1528 |
| 241 | Ga0439463_061554 | 3300042016 | Bacteria | 959 |
| 242 | Ga0450911_000109 | 3300042115 | Bacteria | 34092 |
| 243 | Ga0450911_000586 | 3300042115 | Bacteria | 11210 |
| 244 | Ga0450911_000664 | 3300042115 | Bacteria | 10293 |
| 245 | Ga0450911_001017 | 3300042115 | Bacteria | 7151 |
| 246 | Ga0450911_018217 | 3300042115 | Bacteria | 922 |
| 247 | Ga0450922_001334 | 3300042124 | Bacteria | 2435 |
| 248 | Ga0450890_002436 | 3300042127 | Bacteria | 2561 |
| 249 | Ga0450900_024871 | 3300042136 | Bacteria | 851 |
| 250 | Ga0450902_002639 | 3300042137 | Bacteria | 2550 |
| 251 | Ga0450902_012270 | 3300042137 | Bacteria | 1369 |
| 252 | Ga0450902_020192 | 3300042137 | Bacteria | 1097 |
| 253 | Ga0450903_002399 | 3300042138 | Bacteria | 3339 |
| 254 | Ga0450904_000351 | 3300042139 | Bacteria | 9603 |
| 255 | Ga0450904_004766 | 3300042139 | Bacteria | 1397 |
| 256 | Ga0450906_000113 | 3300042145 | Bacteria | 14042 |
| 257 | Ga0450906_007555 | 3300042145 | Bacteria | 2142 |
| 258 | Ga0450907_034413 | 3300042146 | Bacteria | 864 |
| 259 | Ga0450910_003593 | 3300042147 | Bacteria | 2064 |
| 260 | Ga0450908_010450 | 3300042184 | Bacteria | 1712 |
| 261 | Ga0450909_000292 | 3300042185 | Bacteria | 6160 |
| 262 | Ga0439434_0034399 | 3300042435 | Bacteria | 1547 |
| 263 | Ga0439464_0020000 | 3300042439 | Bacteria | 1831 |
| 264 | Ga0450916_000745 | 3300042530 | Bacteria | 3003 |
| 265 | Ga0450918_003338 | 3300042531 | Bacteria | 2983 |
| 266 | Ga0450918_028788 | 3300042531 | Bacteria | 978 |
| 267 | Ga0439440_0007444 | 3300042993 | Bacteria | 2224 |
| 268 | Ga0466957_0579549 | 3300044842 | Bacteria | 784 |
| 269 | Ga0451576_0499717 | 3300045051 | Bacteria | 1278 |
| 270 | Ga0451576_1447878 | 3300045051 | Bacteria | 714 |
| 271 | Ga0466967_0626043 | 3300045976 | Bacteria | 1063 |
| 272 | Ga0495617_005747 | 3300046452 | Bacteria | 4380 |
| 273 | Ga0495617_026777 | 3300046452 | Bacteria | 1941 |
| 274 | Ga0495617_048235 | 3300046452 | Bacteria | 1417 |
| 275 | Ga0495617_140815 | 3300046452 | Bacteria | 770 |
| 276 | Ga0495617_141361 | 3300046452 | Bacteria | 768 |
| 277 | Ga0495627_000294 | 3300046453 | Bacteria | 49457 |
| 278 | Ga0495627_001723 | 3300046453 | Bacteria | 11931 |
| 279 | Ga0495627_028962 | 3300046453 | Bacteria | 1765 |
| 280 | Ga0495627_081888 | 3300046453 | Bacteria | 935 |
| 281 | Ga0495592_0183625 | 3300046454 | Bacteria | 1423 |
| 282 | Ga0495590_0001607 | 3300046457 | Bacteria | 9664 |
| 283 | Ga0495590_0004330 | 3300046457 | Bacteria | 5738 |
| 284 | Ga0495590_0064064 | 3300046457 | Bacteria | 1286 |
| 285 | Ga0495590_0095853 | 3300046457 | Bacteria | 1052 |
| 286 | Ga0495591_000264 | 3300046458 | Bacteria | 49787 |
| 287 | Ga0495591_000779 | 3300046458 | Bacteria | 22757 |
| 288 | Ga0495591_001542 | 3300046458 | Bacteria | 14133 |
| 289 | Ga0495591_001583 | 3300046458 | Bacteria | 13825 |
| 290 | Ga0495591_006851 | 3300046458 | Bacteria | 4949 |
| 291 | Ga0495591_007918 | 3300046458 | Bacteria | 4430 |
| 292 | Ga0495591_018875 | 3300046458 | Bacteria | 2326 |
| 293 | Ga0495591_036133 | 3300046458 | Bacteria | 1440 |
| 294 | Ga0495591_042273 | 3300046458 | Bacteria | 1289 |
| 295 | Ga0495591_057609 | 3300046458 | Bacteria | 1041 |
| 296 | Ga0495638_0004020 | 3300046460 | Bacteria | 11286 |
| 297 | Ga0495638_0007343 | 3300046460 | Bacteria | 7910 |
| 298 | Ga0495638_0017011 | 3300046460 | Bacteria | 4859 |
| 299 | Ga0495638_0046463 | 3300046460 | Bacteria | 2727 |
| 300 | Ga0495638_0063009 | 3300046460 | Bacteria | 2287 |
| 301 | Ga0495638_0093210 | 3300046460 | Bacteria | 1811 |
| 302 | Ga0495638_0209299 | 3300046460 | Bacteria | 1096 |
| 303 | Ga0495650_0000252 | 3300046471 | Bacteria | 105475 |
| 304 | Ga0495650_0004225 | 3300046471 | Bacteria | 9946 |
| 305 | Ga0495650_0005746 | 3300046471 | Bacteria | 7922 |
| 306 | Ga0495650_0006190 | 3300046471 | Bacteria | 7513 |
| 307 | Ga0495650_0013627 | 3300046471 | Bacteria | 4287 |
| 308 | Ga0495650_0017220 | 3300046471 | Bacteria | 3628 |
| 309 | Ga0495650_0038328 | 3300046471 | Bacteria | 2077 |
| 310 | Ga0495650_0113758 | 3300046471 | Bacteria | 1002 |
| 311 | Ga0495605_0001812 | 3300046474 | Bacteria | 13680 |
| 312 | Ga0495605_0003840 | 3300046474 | Bacteria | 8913 |
| 313 | Ga0495605_0050564 | 3300046474 | Bacteria | 2027 |
| 314 | Ga0495605_0111437 | 3300046474 | Bacteria | 1248 |
| 315 | Ga0495605_0120391 | 3300046474 | Bacteria | 1190 |
| 316 | Ga0495584_0003081 | 3300046491 | Bacteria | 9267 |
| 317 | Ga0495584_0008042 | 3300046491 | Bacteria | 5482 |
| 318 | Ga0495584_0011758 | 3300046491 | Bacteria | 4475 |
| 319 | Ga0495584_0012361 | 3300046491 | Bacteria | 4357 |
| 320 | Ga0495584_0016505 | 3300046491 | Bacteria | 3765 |
| 321 | Ga0495584_0024704 | 3300046491 | Bacteria | 3047 |
| 322 | Ga0495584_0039118 | 3300046491 | Bacteria | 2396 |
| 323 | Ga0495584_0063013 | 3300046491 | Bacteria | 1863 |
| 324 | Ga0495584_0092976 | 3300046491 | Bacteria | 1521 |
| 325 | Ga0495584_0134190 | 3300046491 | Bacteria | 1256 |
| 326 | Ga0495584_0258107 | 3300046491 | Bacteria | 886 |
| 327 | Ga0495585_0001397 | 3300046492 | Bacteria | 19044 |
| 328 | Ga0495585_0003265 | 3300046492 | Bacteria | 11043 |
| 329 | Ga0495585_0003336 | 3300046492 | Bacteria | 10894 |
| 330 | Ga0495585_0010127 | 3300046492 | Bacteria | 5631 |
| 331 | Ga0495585_0014588 | 3300046492 | Bacteria | 4572 |
| 332 | Ga0495585_0037032 | 3300046492 | Bacteria | 2748 |
| 333 | Ga0495585_0057295 | 3300046492 | Bacteria | 2150 |
| 334 | Ga0495585_0058935 | 3300046492 | Bacteria | 2117 |
| 335 | Ga0495585_0218900 | 3300046492 | Bacteria | 961 |
| 336 | Ga0495596_0000004 | 3300046500 | Bacteria | 163832 |
| 337 | Ga0495596_0049580 | 3300046500 | Bacteria | 1646 |
| 338 | Ga0495596_0114882 | 3300046500 | Bacteria | 1045 |
| 339 | Ga0495607_0000234 | 3300046501 | Bacteria | 59488 |
| 340 | Ga0495607_0002691 | 3300046501 | Bacteria | 14180 |
| 341 | Ga0495607_0013818 | 3300046501 | Bacteria | 5276 |
| 342 | Ga0495607_0017981 | 3300046501 | Bacteria | 4518 |
| 343 | Ga0495607_0028312 | 3300046501 | Bacteria | 3459 |
| 344 | Ga0495607_0032571 | 3300046501 | Bacteria | 3179 |
| 345 | Ga0495607_0043439 | 3300046501 | Bacteria | 2657 |
| 346 | Ga0495607_0072888 | 3300046501 | Bacteria | 1910 |
| 347 | Ga0495607_0134096 | 3300046501 | Bacteria | 1284 |
| 348 | Ga0495607_0188745 | 3300046501 | Bacteria | 1028 |
| 349 | Ga0495607_0294622 | 3300046501 | Bacteria | 765 |
| 350 | Ga0495607_0294634 | 3300046501 | Bacteria | 765 |
| 351 | Ga0495583_0001199 | 3300046506 | Bacteria | 27850 |
| 352 | Ga0495583_0004374 | 3300046506 | Bacteria | 10173 |
| 353 | Ga0495583_0054324 | 3300046506 | Bacteria | 1814 |
| 354 | Ga0495606_0000027 | 3300046507 | Bacteria | 253573 |
| 355 | Ga0495606_0000167 | 3300046507 | Bacteria | 115739 |
| 356 | Ga0495606_0000432 | 3300046507 | Bacteria | 69645 |
| 357 | Ga0495606_0004330 | 3300046507 | Bacteria | 14273 |
| 358 | Ga0495606_0004584 | 3300046507 | Bacteria | 13708 |
| 359 | Ga0495606_0008054 | 3300046507 | Bacteria | 9247 |
| 360 | Ga0495606_0031869 | 3300046507 | Bacteria | 3659 |
| 361 | Ga0495606_0033966 | 3300046507 | Bacteria | 3508 |
| 362 | Ga0495606_0037407 | 3300046507 | Bacteria | 3297 |
| 363 | Ga0495606_0138700 | 3300046507 | Bacteria | 1438 |
| 364 | Ga0495606_0169322 | 3300046507 | Bacteria | 1268 |
| 365 | Ga0495606_0188470 | 3300046507 | Bacteria | 1184 |
| 366 | Ga0495606_0221842 | 3300046507 | Bacteria | 1064 |
| 367 | Ga0495606_0234503 | 3300046507 | Bacteria | 1026 |
| 368 | Ga0495610_0001754 | 3300046512 | Bacteria | 18984 |
| 369 | Ga0495610_0004292 | 3300046512 | Bacteria | 10605 |
| 370 | Ga0495610_0005652 | 3300046512 | Bacteria | 8814 |
| 371 | Ga0495610_0036818 | 3300046512 | Bacteria | 2497 |
| 372 | Ga0495610_0037611 | 3300046512 | Bacteria | 2461 |
| 373 | Ga0495610_0040776 | 3300046512 | Bacteria | 2336 |
| 374 | Ga0495610_0042341 | 3300046512 | Bacteria | 2278 |
| 375 | Ga0495610_0131779 | 3300046512 | Bacteria | 1084 |
| 376 | Ga0495610_0232050 | 3300046512 | Bacteria | 740 |
| 377 | Ga0495616_0002308 | 3300046513 | Bacteria | 12756 |
| 378 | Ga0495616_0003473 | 3300046513 | Bacteria | 10080 |
| 379 | Ga0495616_0010604 | 3300046513 | Bacteria | 5325 |
| 380 | Ga0495616_0012448 | 3300046513 | Bacteria | 4829 |
| 381 | Ga0495616_0018182 | 3300046513 | Bacteria | 3863 |
| 382 | Ga0495620_0002095 | 3300046515 | Bacteria | 11596 |
| 383 | Ga0495620_0003062 | 3300046515 | Bacteria | 9601 |
| 384 | Ga0495620_0003879 | 3300046515 | Bacteria | 8530 |
| 385 | Ga0495620_0004015 | 3300046515 | Bacteria | 8355 |
| 386 | Ga0495620_0004328 | 3300046515 | Bacteria | 8024 |
| 387 | Ga0495620_0062615 | 3300046515 | Bacteria | 1544 |
| 388 | Ga0495631_0000149 | 3300046518 | Bacteria | 47491 |
| 389 | Ga0495631_0002305 | 3300046518 | Bacteria | 10884 |
| 390 | Ga0495631_0004457 | 3300046518 | Bacteria | 7459 |
| 391 | Ga0495631_0076998 | 3300046518 | Bacteria | 1439 |
| 392 | Ga0495631_0129927 | 3300046518 | Bacteria | 1082 |
| 393 | Ga0495632_0030521 | 3300046519 | Bacteria | 2796 |
| 394 | Ga0495632_0034500 | 3300046519 | Bacteria | 2588 |
| 395 | Ga0495632_0036575 | 3300046519 | Bacteria | 2496 |
| 396 | Ga0495632_0056595 | 3300046519 | Bacteria | 1916 |
| 397 | Ga0495637_0000115 | 3300046520 | Bacteria | 58484 |
| 398 | Ga0495637_0000654 | 3300046520 | Bacteria | 24163 |
| 399 | Ga0495637_0001934 | 3300046520 | Bacteria | 11745 |
| 400 | Ga0495637_0002446 | 3300046520 | Bacteria | 10261 |
| 401 | Ga0495637_0004911 | 3300046520 | Bacteria | 6885 |
| 402 | Ga0495637_0010206 | 3300046520 | Bacteria | 4551 |
| 403 | Ga0495637_0010283 | 3300046520 | Bacteria | 4533 |
| 404 | Ga0495637_0015761 | 3300046520 | Bacteria | 3541 |
| 405 | Ga0495637_0021681 | 3300046520 | Bacteria | 2942 |
| 406 | Ga0495637_0038394 | 3300046520 | Bacteria | 2073 |
| 407 | Ga0495637_0055376 | 3300046520 | Bacteria | 1644 |
| 408 | Ga0495637_0119874 | 3300046520 | Bacteria | 1013 |
| 409 | Ga0495643_0000017 | 3300046522 | Bacteria | 313381 |
| 410 | Ga0495643_0002097 | 3300046522 | Bacteria | 16505 |
| 411 | Ga0495643_0002834 | 3300046522 | Bacteria | 13196 |
| 412 | Ga0495643_0008137 | 3300046522 | Bacteria | 6675 |
| 413 | Ga0495643_0012757 | 3300046522 | Bacteria | 5056 |
| 414 | Ga0495643_0095018 | 3300046522 | Bacteria | 1534 |
| 415 | Ga0495643_0210009 | 3300046522 | Bacteria | 929 |
| 416 | Ga0495643_0210615 | 3300046522 | Bacteria | 928 |
| 417 | Ga0495643_0212589 | 3300046522 | Bacteria | 922 |
| 418 | Ga0495644_0005006 | 3300046523 | Bacteria | 5186 |
| 419 | Ga0495644_0014553 | 3300046523 | Bacteria | 3012 |
| 420 | Ga0495644_0042611 | 3300046523 | Bacteria | 1709 |
| 421 | Ga0495648_0000984 | 3300046524 | Bacteria | 29405 |
| 422 | Ga0495648_0002891 | 3300046524 | Bacteria | 15445 |
| 423 | Ga0495648_0005805 | 3300046524 | Bacteria | 10172 |
| 424 | Ga0495648_0007492 | 3300046524 | Bacteria | 8730 |
| 425 | Ga0495648_0026103 | 3300046524 | Bacteria | 3938 |
| 426 | Ga0495648_0045096 | 3300046524 | Bacteria | 2745 |
| 427 | Ga0495648_0069100 | 3300046524 | Bacteria | 2057 |
| 428 | Ga0495648_0076627 | 3300046524 | Bacteria | 1919 |
| 429 | Ga0495648_0116778 | 3300046524 | Bacteria | 1441 |
| 430 | Ga0495648_0169728 | 3300046524 | Bacteria | 1119 |
| 431 | Ga0495642_0002441 | 3300046528 | Bacteria | 7567 |
| 432 | Ga0495642_0236055 | 3300046528 | Bacteria | 799 |
| 433 | Ga0495652_0659055 | 3300046529 | Bacteria | 708 |
| 434 | Ga0495654_0000562 | 3300046530 | Bacteria | 29977 |
| 435 | Ga0495654_0002377 | 3300046530 | Bacteria | 12142 |
| 436 | Ga0495654_0003492 | 3300046530 | Bacteria | 9597 |
| 437 | Ga0495654_0006522 | 3300046530 | Bacteria | 6617 |
| 438 | Ga0495654_0007462 | 3300046530 | Bacteria | 6106 |
| 439 | Ga0495654_0041327 | 3300046530 | Bacteria | 2293 |
| 440 | Ga0495654_0098420 | 3300046530 | Bacteria | 1349 |
| 441 | Ga0495654_0112840 | 3300046530 | Bacteria | 1238 |
| 442 | Ga0495654_0119617 | 3300046530 | Bacteria | 1193 |
| 443 | Ga0495654_0140797 | 3300046530 | Bacteria | 1075 |
| 444 | Ga0495654_0183025 | 3300046530 | Bacteria | 906 |
| 445 | Ga0495609_0000167 | 3300046538 | Bacteria | 68911 |
| 446 | Ga0495609_0007889 | 3300046538 | Bacteria | 5261 |
| 447 | Ga0495609_0010937 | 3300046538 | Bacteria | 4334 |
| 448 | Ga0495609_0128818 | 3300046538 | Bacteria | 1084 |
| 449 | Ga0495597_0003183 | 3300046542 | Bacteria | 9806 |
| 450 | Ga0495597_0015167 | 3300046542 | Bacteria | 3650 |
| 451 | Ga0495597_0076975 | 3300046542 | Bacteria | 1430 |
| 452 | Ga0495622_0001087 | 3300046557 | Bacteria | 14206 |
| 453 | Ga0495622_0005194 | 3300046557 | Bacteria | 6035 |
| 454 | Ga0495622_0150388 | 3300046557 | Bacteria | 1054 |
| 455 | Ga0495633_0001003 | 3300046558 | Bacteria | 23142 |
| 456 | Ga0495633_0002568 | 3300046558 | Bacteria | 12719 |
| 457 | Ga0495633_0333178 | 3300046558 | Bacteria | 688 |
| 458 | Ga0495656_0359253 | 3300046615 | Bacteria | 756 |
| 459 | Ga0495668_0000001 | 3300046616 | Bacteria | 1013420 |
| 460 | Ga0495668_0000940 | 3300046616 | Bacteria | 32529 |
| 461 | Ga0495668_0003395 | 3300046616 | Bacteria | 11971 |
| 462 | Ga0495668_0023851 | 3300046616 | Bacteria | 3483 |
| 463 | Ga0495668_0066858 | 3300046616 | Bacteria | 1977 |
| 464 | Ga0495611_0000389 | 3300046648 | Bacteria | 27902 |
| 465 | Ga0495611_0002128 | 3300046648 | Bacteria | 9264 |
| 466 | Ga0495611_0100941 | 3300046648 | Bacteria | 1340 |
| 467 | Ga0495611_0115178 | 3300046648 | Bacteria | 1252 |
| 468 | Ga0495625_0000134 | 3300046660 | Bacteria | 115073 |
| 469 | Ga0495625_0001920 | 3300046660 | Bacteria | 23504 |
| 470 | Ga0495625_0011342 | 3300046660 | Bacteria | 7277 |
| 471 | Ga0495625_0023743 | 3300046660 | Bacteria | 4680 |
| 472 | Ga0495625_0041046 | 3300046660 | Bacteria | 3369 |
| 473 | Ga0495625_0043260 | 3300046660 | Bacteria | 3267 |
| 474 | Ga0495625_0093804 | 3300046660 | Bacteria | 2071 |
| 475 | Ga0495625_0146097 | 3300046660 | Bacteria | 1592 |
| 476 | Ga0495625_0174420 | 3300046660 | Bacteria | 1433 |
| 477 | Ga0495625_0205310 | 3300046660 | Bacteria | 1298 |
| 478 | Ga0495659_0022129 | 3300046664 | Bacteria | 2147 |
| 479 | Ga0495661_0000088 | 3300046665 | Bacteria | 111782 |
| 480 | Ga0495661_0008979 | 3300046665 | Bacteria | 6879 |
| 481 | Ga0495661_0066139 | 3300046665 | Bacteria | 2128 |
| 482 | Ga0495661_0071483 | 3300046665 | Bacteria | 2027 |
| 483 | Ga0495661_0107480 | 3300046665 | Bacteria | 1560 |
| 484 | Ga0495661_0149759 | 3300046665 | Bacteria | 1261 |
| 485 | Ga0495661_0161533 | 3300046665 | Bacteria | 1202 |
| 486 | Ga0495661_0187417 | 3300046665 | Bacteria | 1092 |
| 487 | Ga0495661_0216117 | 3300046665 | Bacteria | 995 |
| 488 | Ga0495661_0267606 | 3300046665 | Bacteria | 866 |
| 489 | Ga0495588_0174771 | 3300046674 | Bacteria | 1135 |
| 490 | Ga0495658_0070719 | 3300046683 | Bacteria | 2026 |
| 491 | Ga0495658_0113516 | 3300046683 | Bacteria | 1631 |
| 492 | Ga0495613_0149140 | 3300046689 | Bacteria | 1669 |
| 493 | Ga0495670_0001008 | 3300046691 | Bacteria | 13684 |
| 494 | Ga0495670_0001827 | 3300046691 | Bacteria | 10464 |
| 495 | Ga0495670_0034921 | 3300046691 | Bacteria | 2505 |
| 496 | Ga0495670_0125963 | 3300046691 | Bacteria | 1333 |
| 497 | Ga0495671_0000415 | 3300046692 | Bacteria | 34078 |
| 498 | Ga0495671_0008110 | 3300046692 | Bacteria | 5928 |
| 499 | Ga0495671_0032798 | 3300046692 | Bacteria | 2649 |
| 500 | Ga0495671_0038716 | 3300046692 | Bacteria | 2409 |
| 501 | Ga0495671_0058186 | 3300046692 | Bacteria | 1912 |
| 502 | Ga0495671_0101086 | 3300046692 | Bacteria | 1409 |
| 503 | Ga0495671_0216479 | 3300046692 | Bacteria | 927 |
| 504 | Ga0495649_0002749 | 3300046694 | Bacteria | 12244 |
| 505 | Ga0495649_0003541 | 3300046694 | Bacteria | 10493 |
| 506 | Ga0495649_0015332 | 3300046694 | Bacteria | 4363 |
| 507 | Ga0495649_0024472 | 3300046694 | Bacteria | 3366 |
| 508 | Ga0495649_0051679 | 3300046694 | Bacteria | 2228 |
| 509 | Ga0495649_0073950 | 3300046694 | Bacteria | 1825 |
| 510 | Ga0495649_0076099 | 3300046694 | Bacteria | 1797 |
| 511 | Ga0495649_0091165 | 3300046694 | Bacteria | 1625 |
| 512 | Ga0495649_0101904 | 3300046694 | Bacteria | 1525 |
| 513 | Ga0495589_0001040 | 3300046794 | Bacteria | 16709 |
| 514 | Ga0495589_0027780 | 3300046794 | Bacteria | 2859 |
| 515 | Ga0495589_0039648 | 3300046794 | Bacteria | 2353 |
| 516 | Ga0495589_0089435 | 3300046794 | Bacteria | 1495 |
| 517 | Ga0495589_0140742 | 3300046794 | Bacteria | 1155 |
| 518 | Ga0495589_0347368 | 3300046794 | Bacteria | 684 |
| 519 | Ga0495660_0002844 | 3300046810 | Bacteria | 10874 |
| 520 | Ga0495660_0031049 | 3300046810 | Bacteria | 3006 |
| 521 | Ga0495660_0038328 | 3300046810 | Bacteria | 2664 |
| 522 | Ga0495660_0042187 | 3300046810 | Bacteria | 2521 |
| 523 | Ga0495660_0059247 | 3300046810 | Bacteria | 2060 |
| 524 | Ga0495660_0067709 | 3300046810 | Bacteria | 1901 |
| 525 | Ga0495660_0071356 | 3300046810 | Bacteria | 1841 |
| 526 | Ga0495660_0078911 | 3300046810 | Bacteria | 1729 |
| 527 | Ga0495660_0106128 | 3300046810 | Bacteria | 1439 |
| 528 | Ga0495660_0126678 | 3300046810 | Bacteria | 1285 |
| 529 | Ga0495660_0145568 | 3300046810 | Bacteria | 1174 |
| 530 | Ga0495660_0146266 | 3300046810 | Bacteria | 1171 |
| 531 | Ga0495660_0155903 | 3300046810 | Bacteria | 1124 |
| 532 | Ga0495660_0176292 | 3300046810 | Bacteria | 1038 |
| 533 | Ga0495581_0342779 | 3300047315 | Bacteria | 872 |
| 534 | Ga0495604_0089291 | 3300047317 | Bacteria | 2291 |
| 535 | Ga0495672_0003397 | 3300047320 | Bacteria | 13683 |
| 536 | Ga0495672_0005137 | 3300047320 | Bacteria | 10445 |
| 537 | Ga0495672_0110212 | 3300047320 | Bacteria | 1478 |
| 538 | Ga0495672_0135188 | 3300047320 | Bacteria | 1293 |
| 539 | Ga0495672_0195550 | 3300047320 | Bacteria | 1014 |
| 540 | Ga0495672_0196093 | 3300047320 | Bacteria | 1012 |
| 541 | Ga0495672_0222008 | 3300047320 | Bacteria | 932 |
| 542 | Ga0495676_0000018 | 3300047321 | Bacteria | 178380 |
| 543 | Ga0495676_0005024 | 3300047321 | Bacteria | 12131 |
| 544 | Ga0495680_0061105 | 3300047322 | Bacteria | 2900 |
| 545 | Ga0495683_0000217 | 3300047323 | Bacteria | 54243 |
| 546 | Ga0495683_0045859 | 3300047323 | Bacteria | 2195 |
| 547 | Ga0495683_0066167 | 3300047323 | Bacteria | 1781 |
| 548 | Ga0495683_0242211 | 3300047323 | Bacteria | 795 |
| 549 | Ga0495683_0244836 | 3300047323 | Bacteria | 789 |
| 550 | Ga0495679_001426 | 3300047446 | Bacteria | 13611 |
| 551 | Ga0495679_002236 | 3300047446 | Bacteria | 10052 |
| 552 | Ga0495679_008371 | 3300047446 | Bacteria | 4211 |
| 553 | Ga0495679_031744 | 3300047446 | Bacteria | 1701 |
| 554 | Ga0495685_010530 | 3300047447 | Bacteria | 3103 |
| 555 | Ga0495673_0001075 | 3300047469 | Bacteria | 23963 |
| 556 | Ga0495673_0002192 | 3300047469 | Bacteria | 14155 |
| 557 | Ga0495673_0003526 | 3300047469 | Bacteria | 10297 |
| 558 | Ga0495673_0004319 | 3300047469 | Bacteria | 8948 |
| 559 | Ga0495673_0007446 | 3300047469 | Bacteria | 6292 |
| 560 | Ga0495673_0033062 | 3300047469 | Bacteria | 2404 |
| 561 | Ga0495673_0056910 | 3300047469 | Bacteria | 1689 |
| 562 | Ga0495673_0077146 | 3300047469 | Bacteria | 1388 |
| 563 | Ga0495673_0212344 | 3300047469 | Bacteria | 719 |
| 564 | Ga0495681_0003361 | 3300047470 | Bacteria | 11135 |
| 565 | Ga0495681_0008798 | 3300047470 | Bacteria | 6286 |
| 566 | Ga0495681_0009250 | 3300047470 | Bacteria | 6091 |
| 567 | Ga0495681_0015123 | 3300047470 | Bacteria | 4379 |
| 568 | Ga0495681_0018432 | 3300047470 | Bacteria | 3846 |
| 569 | Ga0495681_0024628 | 3300047470 | Bacteria | 3163 |
| 570 | Ga0495681_0033755 | 3300047470 | Bacteria | 2557 |
| 571 | Ga0495681_0034021 | 3300047470 | Bacteria | 2543 |
| 572 | Ga0495681_0055225 | 3300047470 | Bacteria | 1852 |
| 573 | Ga0495681_0093808 | 3300047470 | Bacteria | 1321 |
| 574 | Ga0495681_0099802 | 3300047470 | Bacteria | 1270 |
| 575 | Ga0495686_0003379 | 3300047472 | Bacteria | 13896 |
| 576 | Ga0495686_0007931 | 3300047472 | Bacteria | 7881 |
| 577 | Ga0495686_0008555 | 3300047472 | Bacteria | 7497 |
| 578 | Ga0495686_0266678 | 3300047472 | Bacteria | 956 |
| 579 | Ga0495602_0008372 | 3300048088 | Bacteria | 10809 |
| 580 | Ga0495626_0000172 | 3300048091 | Bacteria | 79971 |
| 581 | Ga0495626_0000216 | 3300048091 | Bacteria | 68946 |
| 582 | Ga0495626_0001853 | 3300048091 | Bacteria | 15869 |
| 583 | Ga0495626_0007749 | 3300048091 | Bacteria | 5949 |
| 584 | Ga0495626_0011815 | 3300048091 | Bacteria | 4599 |
| 585 | Ga0495626_0064937 | 3300048091 | Bacteria | 1652 |
| 586 | Ga0495626_0069190 | 3300048091 | Bacteria | 1590 |
| 587 | Ga0495626_0075810 | 3300048091 | Bacteria | 1502 |
| 588 | Ga0495626_0103034 | 3300048091 | Bacteria | 1242 |
| 589 | Ga0496102_0020736 | 3300048905 | Bacteria | 5808 |
| 590 | Ga0496102_0090487 | 3300048905 | Bacteria | 2832 |
| 591 | Ga0496103_0337393 | 3300048906 | Bacteria | 969 |
| 592 | Ga0496104_0306694 | 3300048907 | Bacteria | 1500 |
| 593 | Ga0496106_0171427 | 3300048909 | Bacteria | 1720 |
| 594 | Ga0496107_0282353 | 3300048910 | Bacteria | 1236 |
| 595 | Ga0496108_0404994 | 3300048911 | Bacteria | 1191 |
| 596 | Ga0496109_0023680 | 3300048912 | Bacteria | 5451 |
| 597 | Ga0496109_0085340 | 3300048912 | Bacteria | 2914 |
| 598 | Ga0496110_0016404 | 3300048913 | Bacteria | 6183 |
| 599 | Ga0496112_0232886 | 3300048915 | Bacteria | 1796 |
| 600 | Ga0496116_0000936 | 3300048919 | Bacteria | 35925 |
| 601 | Ga0496116_0003902 | 3300048919 | Bacteria | 14533 |
| 602 | Ga0496116_0193619 | 3300048919 | Bacteria | 1073 |
| 603 | Ga0496118_0202442 | 3300048921 | Bacteria | 1174 |
| 604 | Ga0496121_0008363 | 3300048924 | Bacteria | 12211 |
| 605 | Ga0496121_0071244 | 3300048924 | Bacteria | 2796 |
| 606 | Ga0496122_0034067 | 3300048925 | Bacteria | 4175 |
| 607 | Ga0496123_0093014 | 3300048926 | Bacteria | 1782 |
| 608 | Ga0496124_0020565 | 3300048927 | Bacteria | 6093 |
| 609 | Ga0496124_0402695 | 3300048927 | Bacteria | 949 |
| 610 | Ga0496125_0094321 | 3300048928 | Bacteria | 2230 |
| 611 | Ga0496126_0568843 | 3300048929 | Bacteria | 897 |
| 612 | Ga0495678_002211 | 3300049459 | Bacteria | 13640 |
| 613 | Ga0495678_002245 | 3300049459 | Bacteria | 13452 |
| 614 | Ga0495678_002671 | 3300049459 | Bacteria | 11803 |
| 615 | Ga0495678_010990 | 3300049459 | Bacteria | 4357 |
| 616 | Ga0495678_020457 | 3300049459 | Bacteria | 2929 |
| 617 | Ga0495678_031180 | 3300049459 | Bacteria | 2225 |
| 618 | Ga0495678_067754 | 3300049459 | Bacteria | 1317 |
| 619 | Ga0495678_092940 | 3300049459 | Bacteria | 1058 |
| 620 | Ga0495678_115754 | 3300049459 | Bacteria | 907 |
| 621 | Ga0495682_0047811 | 3300049460 | Bacteria | 1560 |
| 622 | Ga0501031_0108655 | 3300049568 | Bacteria | 1811 |
| 623 | Ga0501032_0025564 | 3300049569 | Bacteria | 4069 |
| 624 | Ga0501034_0108480 | 3300049571 | Bacteria | 2767 |
| 625 | Ga0501036_0009156 | 3300049572 | Bacteria | 8141 |
| 626 | Ga0501038_0017779 | 3300049574 | Bacteria | 6425 |
| 627 | Ga0501039_0043147 | 3300049575 | Bacteria | 3484 |
| 628 | Ga0501039_0158740 | 3300049575 | Bacteria | 1777 |
| 629 | Ga0501043_0021833 | 3300049579 | Bacteria | 5020 |
| 630 | Ga0501043_0099213 | 3300049579 | Bacteria | 2289 |
| 631 | Ga0501046_0231046 | 3300049580 | Bacteria | 1367 |
| 632 | Ga0501047_0000598 | 3300049581 | Bacteria | 38369 |
| 633 | Ga0501048_0288221 | 3300049582 | Bacteria | 1168 |
| 634 | Ga0501067_0009501 | 3300049583 | Bacteria | 5386 |
| 635 | Ga0501068_0000042 | 3300049584 | Bacteria | 48007 |
| 636 | Ga0501069_0005495 | 3300049585 | Bacteria | 6596 |
| 637 | Ga0501070_0130393 | 3300049586 | Bacteria | 2077 |
| 638 | Ga0501072_0000004 | 3300049588 | Bacteria | 282897 |
| 639 | Ga0501073_0462574 | 3300049589 | Bacteria | 877 |
| 640 | Ga0501074_0003700 | 3300049590 | Bacteria | 10839 |
| 641 | Ga0501075_0572193 | 3300049591 | Bacteria | 862 |
| 642 | Ga0501076_0005826 | 3300049592 | Bacteria | 8889 |
| 643 | Ga0501077_0004746 | 3300049593 | Bacteria | 8264 |
| 644 | Ga0501240_003085 | 3300049673 | Bacteria | 1827 |
| 645 | Ga0501079_0011435 | 3300049741 | Bacteria | 6774 |
| 646 | Ga0501080_0024373 | 3300049742 | Bacteria | 5608 |
| 647 | Ga0501083_0004101 | 3300049744 | Bacteria | 10256 |
| 648 | Ga0501241_004867 | 3300049758 | Bacteria | 2508 |
| 649 | Ga0501262_017184 | 3300049759 | Bacteria | 963 |
| 650 | Ga0501269_002261 | 3300049766 | Bacteria | 2390 |
| 651 | Ga0501280_007577 | 3300049776 | Bacteria | 1517 |
| 652 | Ga0501035_0127922 | 3300049822 | Bacteria | 2216 |
| 653 | Ga0501035_0162760 | 3300049822 | Bacteria | 1931 |
| 654 | Ga0501035_0807838 | 3300049822 | Bacteria | 749 |
| 655 | Ga0501044_0032096 | 3300049823 | Bacteria | 5521 |
| 656 | Ga0501226_000006 | 3300049853 | Bacteria | 259153 |
| 657 | nmdc:mga00v17_441996_c1 | 3300050491 | Bacteria | 844 |
| 658 | nmdc:mga0rr50_77931_c1 | 3300050513 | Bacteria | 2548 |
| 659 | nmdc:mga08x19_509867_c1 | 3300050514 | Bacteria | 850 |
| 660 | Ga0500572_001081 | 3300053111 | Bacteria | 8023 |
| 661 | Ga0500592_005174 | 3300053116 | Bacteria | 2072 |
| 662 | Ga0500595_026562 | 3300053119 | Bacteria | 1994 |
| 663 | Ga0500568_0016977 | 3300053139 | Bacteria | 3222 |
| 664 | Ga0500627_0000149 | 3300053158 | Bacteria | 20586 |
| 665 | Ga0500649_155733 | 3300053722 | Bacteria | 812 |
| 666 | Ga0501084_0000552 | 3300054114 | Bacteria | 28547 |
| 667 | Ga0587083_0002115 | 3300059505 | Bacteria | 2408 |
| 668 | Ga0587088_015475 | 3300059508 | Bacteria | 1202 |
| 669 | Ga0587067_025154 | 3300059640 | Bacteria | 1057 |
| 670 | Ga0501082_0015460 | 3300060353 | Bacteria | 6568 |
| 671 | Ga0530510_0015841 | 3300061734 | Bacteria | 5330 |
| 672 | 2511252775 | 2511231004 | Bacteria | 6669789 |
| 673 | 2511267592 | 2511231006 | Bacteria | 6794709 |
| 674 | 2511271990 | 2511231007 | Bacteria | 6306603 |
| 675 | 2511280220 | 2511231008 | Bacteria | 6624100 |
| 676 | 2511292092 | 2511231010 | Bacteria | 6373152 |
| 677 | 2511327117 | 2511231016 | Bacteria | 6704427 |
| 678 | 2511354311 | 2511231021 | Bacteria | 7302637 |
| 679 | 2511365247 | 2511231022 | Bacteria | 6719296 |
| 680 | 2511371940 | 2511231023 | Bacteria | 6808468 |
| 681 | 2511416178 | 2511231031 | Bacteria | 6558529 |
| 682 | 2512324996 | 2512047018 | Bacteria | 6663241 |
| 683 | 2583791120 | 2582580891 | Bacteria | 6800976 |
| 684 | 2597856735 | 2597489887 | Bacteria | 6666321 |
| 685 | 2599483758 | 2599185185 | Bacteria | 6652270 |
| 686 | 2600365705 | 2600254931 | Bacteria | 6734225 |
| 687 | 2601801138 | 2600255318 | Bacteria | 6383414 |
| 688 | 2606073232 | 2603880185 | Bacteria | 6379190 |
| 689 | 2606126107 | 2603880199 | Bacteria | 6377649 |
| 690 | 2624479319 | 2623620443 | Bacteria | 6427864 |
| 691 | 2643822856 | 2643221560 | Bacteria | 4801179 |
| 692 | 2643832523 | 2643221563 | Bacteria | 4726935 |
| 693 | 2643841853 | 2643221565 | Bacteria | 6216018 |
| 694 | 2643934037 | 2643221585 | Bacteria | 5812563 |
| 695 | 2644026505 | 2643221603 | Bacteria | 6147767 |
| 696 | 2644053682 | 2643221608 | Bacteria | 4724829 |
| 697 | 2644220106 | 2643221639 | Bacteria | 6649903 |
| 698 | 2644261120 | 2643221646 | Bacteria | 6433402 |
| 699 | 2644315524 | 2643221656 | Bacteria | 5809961 |
| 700 | 2715751842 | 2713897148 | Bacteria | 5883533 |
| 701 | 2715754890 | 2713897149 | Bacteria | 6506249 |
| 702 | 2718633166 | 2718217725 | Bacteria | 5758958 |
| 703 | 2739053277 | 2738541337 | Bacteria | 6183410 |
| 704 | 2739285503 | 2738543020 | Bacteria | 5718238 |
| 705 | 2739290816 | 2738543021 | Bacteria | 5718241 |
| 706 | 2739314222 | 2738543025 | Bacteria | 6600348 |
| 707 | 2842806915 | 2842805378 | Bacteria | 5385175 |
| 708 | 2842832809 | 2842832357 | Bacteria | 5959113 |
| 709 | 2842848105 | 2842843487 | Bacteria | 6004777 |
| 710 | 2852654880 | 2852653556 | Bacteria | 4050083 |
| 711 | 2852681418 | 2852680915 | Bacteria | 4100189 |
| 712 | 2878031328 | 2878029506 | Bacteria | 6418441 |
| 713 | 2919064203 | 2919063839 | Bacteria | 6302690 |
| 714 | 2919386287 | 2919385768 | Bacteria | 5897293 |
| 715 | 2919457225 | 2919456309 | Bacteria | 6586567 |
| 716 | 2919491436 | 2919487758 | Bacteria | 5929766 |
| 717 | 2969306096 | 2969304461 | Bacteria | 6601805 |
| 718 | 2974292244 | 2974289157 | Bacteria | 6080362 |
| 719 | 2984290861 | 2984286254 | Bacteria | 6702062 |
| 720 | 2998141497 | 2998139840 | Bacteria | 6073514 |
| 721 | 3007400718 | 3007395558 | Bacteria | 6755444 |
| 722 | 3007512899 | 3007511990 | Bacteria | 6481491 |
| 723 | 3007618925 | 3007614139 | Bacteria | 6053559 |
| 724 | 3007620302 | 3007619802 | Bacteria | 6411688 |
| 725 | 3007723176 | 3007718800 | Bacteria | 5971527 |
| 726 | 3007856094 | 3007855910 | Bacteria | 5637581 |
| 727 | 3007863263 | 3007861166 | Bacteria | 6045338 |
| 728 | 8011352473 | 8011350971 | Bacteria | 6158957 |
| 729 | 8015689396 | 8015687852 | Bacteria | 6613826 |
| 730 | 8029999251 | 8029995093 | Bacteria | 5990776 |
| 731 | 8055772532 | 8055770955 | Bacteria | 6827675 |
| 732 | 8056122245 | 8056120720 | Bacteria | 5758328 |
| 733 | 8056156752 | 8056155041 | Bacteria | 6486948 |
| 734 | 8056169489 | 8056166840 | Bacteria | 5820959 |
| 735 | 8056181039 | 8056177738 | Bacteria | 6748268 |
| 736 | Ga0496126_0663298 | |||
| 737 | rootL2_10012056 | |||
| 738 | rootH1_10020558 | |||
| 739 | rootH1_10114129 | |||
| 740 | Ga0055536_1000041 | |||
| 741 | Ga0055536_1000042 | |||
| 742 | Ga0055536_1004420 | |||
| 743 | Ga0055536_1007529 | |||
| 744 | Ga0055530_10000063 | |||
| 745 | Ga0055530_10000174 | |||
| 746 | Ga0055530_10000411 | |||
| 747 | Ga0055530_10002068 | |||
| 748 | Ga0055530_10035526 | |||
| 749 | Ga0055540_1000278 | |||
| 750 | Ga0055540_1000318 | |||
| 751 | Ga0055531_10000412 | |||
| 752 | Ga0055531_10001746 | |||
| 753 | Ga0055531_10014294 | |||
| 754 | Ga0065165_1000806 | |||
| 755 | Ga0065714_10067840 | |||
| 756 | Ga0065714_10077559 | |||
| 757 | Ga0065714_10091407 | |||
| 758 | Ga0065704_10016922 | |||
| 759 | Ga0070683_100080622 | |||
| 760 | Ga0070683_100226489 | |||
| 761 | Ga0070670_100341714 | |||
| 762 | Ga0070689_100029810 | |||
| 763 | Ga0070669_100045051 | |||
| 764 | Ga0070669_100136641 | |||
| 765 | Ga0070659_100052719 | |||
| 766 | Ga0070713_100283654 | |||
| 767 | Ga0070711_100280486 | |||
| 768 | Ga0070694_100134776 | |||
| 769 | Ga0070708_100194289 | |||
| 770 | Ga0070678_100175672 | |||
| 771 | Ga0070662_100781482 | |||
| 772 | Ga0070681_10068669 | |||
| 773 | Ga0070706_100316838 | |||
| 774 | Ga0070707_100164803 | |||
| 775 | Ga0070699_100038092 | |||
| 776 | Ga0070679_100215314 | |||
| 777 | Ga0070697_100236948 | |||
| 778 | Ga0070695_100275938 | |||
| 779 | Ga0070696_100145438 | |||
| 780 | Ga0070665_100079480 | |||
| 781 | Ga0070665_100228216 | |||
| 782 | Ga0068857_100203152 | |||
| 783 | Ga0068857_100672582 | |||
| 784 | Ga0068856_100107692 | |||
| 785 | Ga0068858_100189143 | |||
| 786 | Ga0068858_100563001 | |||
| 787 | Ga0075363_100296188 | |||
| 788 | Ga0075364_10143619 | |||
| 789 | Ga0075364_10177054 | |||
| 790 | Ga0075432_10008785 | |||
| 791 | Ga0075432_10180657 | |||
| 792 | Ga0070715_10033756 | |||
| 793 | Ga0070715_10125265 | |||
| 794 | Ga0070716_100087497 | |||
| 795 | Ga0070712_100023860 | |||
| 796 | Ga0075370_10252695 | |||
| 797 | Ga0068871_100425571 | |||
| 798 | Ga0075436_100101982 | |||
| 799 | Ga0075435_100109957 | |||
| 800 | Ga0099794_10002724 | |||
| 801 | Ga0099794_10060371 | |||
| 802 | Ga0099795_10187977 | |||
| 803 | Ga0105251_10062978 | |||
| 804 | Ga0105244_10003184 | |||
| 805 | Ga0105244_10037103 | |||
| 806 | Ga0105244_10188655 | |||
| 807 | Ga0111539_10115694 | |||
| 808 | Ga0105243_10000162 | |||
| 809 | Ga0105239_10951413 | |||
| 810 | Ga0105246_10000155 | |||
| 811 | Ga0157345_1000143 | |||
| 812 | Ga0157373_10003502 | |||
| 813 | Ga0157373_10047355 | |||
| 814 | Ga0157371_10003729 | |||
| 815 | Ga0157370_10001776 | |||
| 816 | Ga0157370_10032589 | |||
| 817 | Ga0157370_10052312 | |||
| 818 | Ga0157370_10121765 | |||
| 819 | Ga0157369_10006367 | |||
| 820 | Ga0157369_10007063 | |||
| 821 | Ga0157369_10031677 | |||
| 822 | Ga0163162_10001228 | |||
| 823 | Ga0157372_10183550 | |||
| 824 | Ga0157372_10281290 | |||
| 825 | Ga0157375_10112993 | |||
| 826 | Ga0163163_10542602 | |||
| 827 | Ga0182008_10003253 | |||
| 828 | Ga0182006_1002922 | |||
| 829 | Ga0163161_10004436 | |||
| 830 | Ga0163161_10050043 | |||
| 831 | Ga0163161_10472340 | |||
| 832 | Ga0209148_1009265 | |||
| 833 | Ga0209675_1017541 | |||
| 834 | Ga0209676_1000016 | |||
| 835 | Ga0209676_1000021 | |||
| 836 | Ga0209676_1000033 | |||
| 837 | Ga0209676_1000084 | |||
| 838 | Ga0209676_1000259 | |||
| 839 | Ga0209676_1000678 | |||
| 840 | Ga0209676_1032689 | |||
| 841 | Ga0209676_1044287 | |||
| 842 | Ga0209025_1010159 | |||
| 843 | Ga0209025_1097914 | |||
| 844 | Ga0209050_1000036 | |||
| 845 | Ga0209050_1000104 | |||
| 846 | Ga0209050_1000107 | |||
| 847 | Ga0209051_1000043 | |||
| 848 | Ga0209051_1000090 | |||
| 849 | Ga0209257_1000098 | |||
| 850 | Ga0209257_1000120 | |||
| 851 | Ga0209257_1000174 | |||
| 852 | Ga0209257_1005689 | |||
| 853 | Ga0207696_1003232 | |||
| 854 | Ga0207696_1012217 | |||
| 855 | Ga0207655_1000297 | |||
| 856 | Ga0207655_1005351 | |||
| 857 | Ga0207655_1005951 | |||
| 858 | Ga0207713_1000904 | |||
| 859 | Ga0207684_10061541 | |||
| 860 | Ga0207684_10159060 | |||
| 861 | Ga0207693_10029957 | |||
| 862 | Ga0207663_10515519 | |||
| 863 | Ga0207660_10106363 | |||
| 864 | Ga0207652_10211914 | |||
| 865 | Ga0207646_10075203 | |||
| 866 | Ga0207681_10010392 | |||
| 867 | Ga0207681_10516310 | |||
| 868 | Ga0207690_10013933 | |||
| 869 | Ga0207706_10128430 | |||
| 870 | Ga0207706_10422077 | |||
| 871 | Ga0207709_10000053 | |||
| 872 | Ga0207670_10020423 | |||
| 873 | Ga0207665_10412055 | |||
| 874 | Ga0207667_10339602 | |||
| 875 | Ga0207703_10091429 | |||
| 876 | Ga0207702_10098651 | |||
| 877 | Ga0207674_10242343 | |||
| 878 | Ga0207683_10068188 | |||
| 879 | Ga0209281_1017534 | |||
| 880 | Ga0209588_1011457 | |||
| 881 | Ga0207428_10744364 | |||
| 882 | Ga0268266_10040819 | |||
| 883 | Ga0268264_10645307 | |||
| 884 | Ga0268264_10743960 | |||
| 885 | Ga0307517_10125729 | |||
| 886 | Ga0307511_10069438 | |||
| 887 | Ga0316178_1074314 | |||
| 888 | Ga0307513_10026909 | |||
| 889 | Ga0307509_10154927 | |||
| 890 | Ga0307408_100043286 | |||
| 891 | Ga0307408_100062538 | |||
| 892 | Ga0307408_100146097 | |||
| 893 | Ga0307408_100339421 | |||
| 894 | Ga0307408_100759601 | |||
| 895 | Ga0307408_100992266 | |||
| 896 | Ga0307516_10652995 | |||
| 897 | Ga0307405_10092853 | |||
| 898 | Ga0307405_10238874 | |||
| 899 | Ga0307405_10412334 | |||
| 900 | Ga0307405_10462843 | |||
| 901 | Ga0307413_10039463 | |||
| 902 | Ga0307410_10130051 | |||
| 903 | Ga0307410_10133193 | |||
| 904 | Ga0307410_10632905 | |||
| 905 | Ga0307406_10039441 | |||
| 906 | Ga0307406_10401992 | |||
| 907 | Ga0307406_10702001 | |||
| 908 | Ga0307407_10042278 | |||
| 909 | Ga0307412_10055008 | |||
| 910 | Ga0307412_10072804 | |||
| 911 | Ga0307412_10079840 | |||
| 912 | Ga0307412_10114202 | |||
| 913 | Ga0307412_10223493 | |||
| 914 | Ga0307412_10435193 | |||
| 915 | Ga0307412_10541563 | |||
| 916 | Ga0307412_10556179 | |||
| 917 | Ga0307412_11470721 | |||
| 918 | Ga0307409_101208841 | |||
| 919 | Ga0307416_100023954 | |||
| 920 | Ga0307416_100197817 | |||
| 921 | Ga0307416_100296603 | |||
| 922 | Ga0307416_100455895 | |||
| 923 | Ga0307416_100506890 | |||
| 924 | Ga0307416_100652117 | |||
| 925 | Ga0307414_10003389 | |||
| 926 | Ga0307414_10005872 | |||
| 927 | Ga0307414_10013889 | |||
| 928 | Ga0307414_10060347 | |||
| 929 | Ga0307414_10080013 | |||
| 930 | Ga0307414_10085351 | |||
| 931 | Ga0307414_10289001 | |||
| 932 | Ga0307414_10402495 | |||
| 933 | Ga0307414_10765296 | |||
| 934 | Ga0307411_10028057 | |||
| 935 | Ga0307411_10065164 | |||
| 936 | Ga0307411_10117242 | |||
| 937 | Ga0307411_10558783 | |||
| 938 | Ga0307411_11069895 | |||
| 939 | Ga0307415_100165558 | |||
| 940 | Ga0307510_10024905 | |||
| 941 | Ga0307510_10046980 | |||
| 942 | Ga0373956_0003525 | |||
| 943 | Ga0373924_0398543 | |||
| 944 | Ga0373935_0524595 | |||
| 945 | Ga0373933_0031907 | |||
| 946 | Ga0373937_0034048 | |||
| 947 | Ga0395900_0135728 | |||
| 948 | Ga0395905_0001480 | |||
| 949 | Ga0395905_1103402 | |||
| 950 | Ga0237819_02368 | |||
| 951 | Ga0400483_223733 | |||
| 952 | Ga0436361_0763530 | |||
| 953 | Ga0439438_000923 | |||
| 954 | Ga0439438_001061 | |||
| 955 | Ga0439438_010911 | |||
| 956 | Ga0439447_003511 | |||
| 957 | Ga0439447_045284 | |||
| 958 | Ga0439466_0004829 | |||
| 959 | Ga0439466_0031401 | |||
| 960 | Ga0439466_0099333 | |||
| 961 | Ga0451789_0899180 | |||
| 962 | Ga0451841_0453392 | |||
| 963 | Ga0439437_000022 | |||
| 964 | Ga0439445_0084717 | |||
| 965 | Ga0439432_003835 | |||
| 966 | Ga0439451_000492 | |||
| 967 | Ga0439451_003515 | |||
| 968 | Ga0439452_000228 | |||
| 969 | Ga0439452_000887 | |||
| 970 | Ga0439452_005669 | |||
| 971 | Ga0439452_032686 | |||
| 972 | Ga0439455_0121919 | |||
| 973 | Ga0439456_000846 | |||
| 974 | Ga0439456_015178 | |||
| 975 | Ga0439456_016896 | |||
| 976 | Ga0439463_061554 | |||
| 977 | Ga0450911_000109 | |||
| 978 | Ga0450911_000586 | |||
| 979 | Ga0450911_000664 | |||
| 980 | Ga0450911_001017 | |||
| 981 | Ga0450911_018217 | |||
| 982 | Ga0450922_001334 | |||
| 983 | Ga0450890_002436 | |||
| 984 | Ga0450900_024871 | |||
| 985 | Ga0450902_002639 | |||
| 986 | Ga0450902_012270 | |||
| 987 | Ga0450902_020192 | |||
| 988 | Ga0450903_002399 | |||
| 989 | Ga0450904_000351 | |||
| 990 | Ga0450904_004766 | |||
| 991 | Ga0450906_000113 | |||
| 992 | Ga0450906_007555 | |||
| 993 | Ga0450907_034413 | |||
| 994 | Ga0450910_003593 | |||
| 995 | Ga0450908_010450 | |||
| 996 | Ga0450909_000292 | |||
| 997 | Ga0439434_0034399 | |||
| 998 | Ga0439464_0020000 | |||
| 999 | Ga0450916_000745 | |||
| 1000 | Ga0450918_003338 | |||
| 1001 | Ga0450918_028788 | |||
| 1002 | Ga0439440_0007444 | |||
| 1003 | Ga0466957_0579549 | |||
| 1004 | Ga0451576_0499717 | |||
| 1005 | Ga0451576_1447878 | |||
| 1006 | Ga0466967_0626043 | |||
| 1007 | Ga0495617_005747 | |||
| 1008 | Ga0495617_026777 | |||
| 1009 | Ga0495617_048235 | |||
| 1010 | Ga0495617_140815 | |||
| 1011 | Ga0495617_141361 | |||
| 1012 | Ga0495627_000294 | |||
| 1013 | Ga0495627_001723 | |||
| 1014 | Ga0495627_028962 | |||
| 1015 | Ga0495627_081888 | |||
| 1016 | Ga0495592_0183625 | |||
| 1017 | Ga0495590_0001607 | |||
| 1018 | Ga0495590_0004330 | |||
| 1019 | Ga0495590_0064064 | |||
| 1020 | Ga0495590_0095853 | |||
| 1021 | Ga0495591_000264 | |||
| 1022 | Ga0495591_000779 | |||
| 1023 | Ga0495591_001542 | |||
| 1024 | Ga0495591_001583 | |||
| 1025 | Ga0495591_006851 | |||
| 1026 | Ga0495591_007918 | |||
| 1027 | Ga0495591_018875 | |||
| 1028 | Ga0495591_036133 | |||
| 1029 | Ga0495591_042273 | |||
| 1030 | Ga0495591_057609 | |||
| 1031 | Ga0495638_0004020 | |||
| 1032 | Ga0495638_0007343 | |||
| 1033 | Ga0495638_0017011 | |||
| 1034 | Ga0495638_0046463 | |||
| 1035 | Ga0495638_0063009 | |||
| 1036 | Ga0495638_0093210 | |||
| 1037 | Ga0495638_0209299 | |||
| 1038 | Ga0495650_0000252 | |||
| 1039 | Ga0495650_0004225 | |||
| 1040 | Ga0495650_0005746 | |||
| 1041 | Ga0495650_0006190 | |||
| 1042 | Ga0495650_0013627 | |||
| 1043 | Ga0495650_0017220 | |||
| 1044 | Ga0495650_0038328 | |||
| 1045 | Ga0495650_0113758 | |||
| 1046 | Ga0495605_0001812 | |||
| 1047 | Ga0495605_0003840 | |||
| 1048 | Ga0495605_0050564 | |||
| 1049 | Ga0495605_0111437 | |||
| 1050 | Ga0495605_0120391 | |||
| 1051 | Ga0495584_0003081 | |||
| 1052 | Ga0495584_0008042 | |||
| 1053 | Ga0495584_0011758 | |||
| 1054 | Ga0495584_0012361 | |||
| 1055 | Ga0495584_0016505 | |||
| 1056 | Ga0495584_0024704 | |||
| 1057 | Ga0495584_0039118 | |||
| 1058 | Ga0495584_0063013 | |||
| 1059 | Ga0495584_0092976 | |||
| 1060 | Ga0495584_0134190 | |||
| 1061 | Ga0495584_0258107 | |||
| 1062 | Ga0495585_0001397 | |||
| 1063 | Ga0495585_0003265 | |||
| 1064 | Ga0495585_0003336 | |||
| 1065 | Ga0495585_0010127 | |||
| 1066 | Ga0495585_0014588 | |||
| 1067 | Ga0495585_0037032 | |||
| 1068 | Ga0495585_0057295 | |||
| 1069 | Ga0495585_0058935 | |||
| 1070 | Ga0495585_0218900 | |||
| 1071 | Ga0495596_0000004 | |||
| 1072 | Ga0495596_0049580 | |||
| 1073 | Ga0495596_0114882 | |||
| 1074 | Ga0495607_0000234 | |||
| 1075 | Ga0495607_0002691 | |||
| 1076 | Ga0495607_0013818 | |||
| 1077 | Ga0495607_0017981 | |||
| 1078 | Ga0495607_0028312 | |||
| 1079 | Ga0495607_0032571 | |||
| 1080 | Ga0495607_0043439 | |||
| 1081 | Ga0495607_0072888 | |||
| 1082 | Ga0495607_0134096 | |||
| 1083 | Ga0495607_0188745 | |||
| 1084 | Ga0495607_0294622 | |||
| 1085 | Ga0495607_0294634 | |||
| 1086 | Ga0495583_0001199 | |||
| 1087 | Ga0495583_0004374 | |||
| 1088 | Ga0495583_0054324 | |||
| 1089 | Ga0495606_0000027 | |||
| 1090 | Ga0495606_0000167 | |||
| 1091 | Ga0495606_0000432 | |||
| 1092 | Ga0495606_0004330 | |||
| 1093 | Ga0495606_0004584 | |||
| 1094 | Ga0495606_0008054 | |||
| 1095 | Ga0495606_0031869 | |||
| 1096 | Ga0495606_0033966 | |||
| 1097 | Ga0495606_0037407 | |||
| 1098 | Ga0495606_0138700 | |||
| 1099 | Ga0495606_0169322 | |||
| 1100 | Ga0495606_0188470 | |||
| 1101 | Ga0495606_0221842 | |||
| 1102 | Ga0495606_0234503 | |||
| 1103 | Ga0495610_0001754 | |||
| 1104 | Ga0495610_0004292 | |||
| 1105 | Ga0495610_0005652 | |||
| 1106 | Ga0495610_0036818 | |||
| 1107 | Ga0495610_0037611 | |||
| 1108 | Ga0495610_0040776 | |||
| 1109 | Ga0495610_0042341 | |||
| 1110 | Ga0495610_0131779 | |||
| 1111 | Ga0495610_0232050 | |||
| 1112 | Ga0495616_0002308 | |||
| 1113 | Ga0495616_0003473 | |||
| 1114 | Ga0495616_0010604 | |||
| 1115 | Ga0495616_0012448 | |||
| 1116 | Ga0495616_0018182 | |||
| 1117 | Ga0495620_0002095 | |||
| 1118 | Ga0495620_0003062 | |||
| 1119 | Ga0495620_0003879 | |||
| 1120 | Ga0495620_0004015 | |||
| 1121 | Ga0495620_0004328 | |||
| 1122 | Ga0495620_0062615 | |||
| 1123 | Ga0495631_0000149 | |||
| 1124 | Ga0495631_0002305 | |||
| 1125 | Ga0495631_0004457 | |||
| 1126 | Ga0495631_0076998 | |||
| 1127 | Ga0495631_0129927 | |||
| 1128 | Ga0495632_0030521 | |||
| 1129 | Ga0495632_0034500 | |||
| 1130 | Ga0495632_0036575 | |||
| 1131 | Ga0495632_0056595 | |||
| 1132 | Ga0495637_0000115 | |||
| 1133 | Ga0495637_0000654 | |||
| 1134 | Ga0495637_0001934 | |||
| 1135 | Ga0495637_0002446 | |||
| 1136 | Ga0495637_0004911 | |||
| 1137 | Ga0495637_0010206 | |||
| 1138 | Ga0495637_0010283 | |||
| 1139 | Ga0495637_0015761 | |||
| 1140 | Ga0495637_0021681 | |||
| 1141 | Ga0495637_0038394 | |||
| 1142 | Ga0495637_0055376 | |||
| 1143 | Ga0495637_0119874 | |||
| 1144 | Ga0495643_0000017 | |||
| 1145 | Ga0495643_0002097 | |||
| 1146 | Ga0495643_0002834 | |||
| 1147 | Ga0495643_0008137 | |||
| 1148 | Ga0495643_0012757 | |||
| 1149 | Ga0495643_0095018 | |||
| 1150 | Ga0495643_0210009 | |||
| 1151 | Ga0495643_0210615 | |||
| 1152 | Ga0495643_0212589 | |||
| 1153 | Ga0495644_0005006 | |||
| 1154 | Ga0495644_0014553 | |||
| 1155 | Ga0495644_0042611 | |||
| 1156 | Ga0495648_0000984 | |||
| 1157 | Ga0495648_0002891 | |||
| 1158 | Ga0495648_0005805 | |||
| 1159 | Ga0495648_0007492 | |||
| 1160 | Ga0495648_0026103 | |||
| 1161 | Ga0495648_0045096 | |||
| 1162 | Ga0495648_0069100 | |||
| 1163 | Ga0495648_0076627 | |||
| 1164 | Ga0495648_0116778 | |||
| 1165 | Ga0495648_0169728 | |||
| 1166 | Ga0495642_0002441 | |||
| 1167 | Ga0495642_0236055 | |||
| 1168 | Ga0495652_0659055 | |||
| 1169 | Ga0495654_0000562 | |||
| 1170 | Ga0495654_0002377 | |||
| 1171 | Ga0495654_0003492 | |||
| 1172 | Ga0495654_0006522 | |||
| 1173 | Ga0495654_0007462 | |||
| 1174 | Ga0495654_0041327 | |||
| 1175 | Ga0495654_0098420 | |||
| 1176 | Ga0495654_0112840 | |||
| 1177 | Ga0495654_0119617 | |||
| 1178 | Ga0495654_0140797 | |||
| 1179 | Ga0495654_0183025 | |||
| 1180 | Ga0495609_0000167 | |||
| 1181 | Ga0495609_0007889 | |||
| 1182 | Ga0495609_0010937 | |||
| 1183 | Ga0495609_0128818 | |||
| 1184 | Ga0495597_0003183 | |||
| 1185 | Ga0495597_0015167 | |||
| 1186 | Ga0495597_0076975 | |||
| 1187 | Ga0495622_0001087 | |||
| 1188 | Ga0495622_0005194 | |||
| 1189 | Ga0495622_0150388 | |||
| 1190 | Ga0495633_0001003 | |||
| 1191 | Ga0495633_0002568 | |||
| 1192 | Ga0495633_0333178 | |||
| 1193 | Ga0495656_0359253 | |||
| 1194 | Ga0495668_0000001 | |||
| 1195 | Ga0495668_0000940 | |||
| 1196 | Ga0495668_0003395 | |||
| 1197 | Ga0495668_0023851 | |||
| 1198 | Ga0495668_0066858 | |||
| 1199 | Ga0495611_0000389 | |||
| 1200 | Ga0495611_0002128 | |||
| 1201 | Ga0495611_0100941 | |||
| 1202 | Ga0495611_0115178 | |||
| 1203 | Ga0495625_0000134 | |||
| 1204 | Ga0495625_0001920 | |||
| 1205 | Ga0495625_0011342 | |||
| 1206 | Ga0495625_0023743 | |||
| 1207 | Ga0495625_0041046 | |||
| 1208 | Ga0495625_0043260 | |||
| 1209 | Ga0495625_0093804 | |||
| 1210 | Ga0495625_0146097 | |||
| 1211 | Ga0495625_0174420 | |||
| 1212 | Ga0495625_0205310 | |||
| 1213 | Ga0495659_0022129 | |||
| 1214 | Ga0495661_0000088 | |||
| 1215 | Ga0495661_0008979 | |||
| 1216 | Ga0495661_0066139 | |||
| 1217 | Ga0495661_0071483 | |||
| 1218 | Ga0495661_0107480 | |||
| 1219 | Ga0495661_0149759 | |||
| 1220 | Ga0495661_0161533 | |||
| 1221 | Ga0495661_0187417 | |||
| 1222 | Ga0495661_0216117 | |||
| 1223 | Ga0495661_0267606 | |||
| 1224 | Ga0495588_0174771 | |||
| 1225 | Ga0495658_0070719 | |||
| 1226 | Ga0495658_0113516 | |||
| 1227 | Ga0495613_0149140 | |||
| 1228 | Ga0495670_0001008 | |||
| 1229 | Ga0495670_0001827 | |||
| 1230 | Ga0495670_0034921 | |||
| 1231 | Ga0495670_0125963 | |||
| 1232 | Ga0495671_0000415 | |||
| 1233 | Ga0495671_0008110 | |||
| 1234 | Ga0495671_0032798 | |||
| 1235 | Ga0495671_0038716 | |||
| 1236 | Ga0495671_0058186 | |||
| 1237 | Ga0495671_0101086 | |||
| 1238 | Ga0495671_0216479 | |||
| 1239 | Ga0495649_0002749 | |||
| 1240 | Ga0495649_0003541 | |||
| 1241 | Ga0495649_0015332 | |||
| 1242 | Ga0495649_0024472 | |||
| 1243 | Ga0495649_0051679 | |||
| 1244 | Ga0495649_0073950 | |||
| 1245 | Ga0495649_0076099 | |||
| 1246 | Ga0495649_0091165 | |||
| 1247 | Ga0495649_0101904 | |||
| 1248 | Ga0495589_0001040 | |||
| 1249 | Ga0495589_0027780 | |||
| 1250 | Ga0495589_0039648 | |||
| 1251 | Ga0495589_0089435 | |||
| 1252 | Ga0495589_0140742 | |||
| 1253 | Ga0495589_0347368 | |||
| 1254 | Ga0495660_0002844 | |||
| 1255 | Ga0495660_0031049 | |||
| 1256 | Ga0495660_0038328 | |||
| 1257 | Ga0495660_0042187 | |||
| 1258 | Ga0495660_0059247 | |||
| 1259 | Ga0495660_0067709 | |||
| 1260 | Ga0495660_0071356 | |||
| 1261 | Ga0495660_0078911 | |||
| 1262 | Ga0495660_0106128 | |||
| 1263 | Ga0495660_0126678 | |||
| 1264 | Ga0495660_0145568 | |||
| 1265 | Ga0495660_0146266 | |||
| 1266 | Ga0495660_0155903 | |||
| 1267 | Ga0495660_0176292 | |||
| 1268 | Ga0495581_0342779 | |||
| 1269 | Ga0495604_0089291 | |||
| 1270 | Ga0495672_0003397 | |||
| 1271 | Ga0495672_0005137 | |||
| 1272 | Ga0495672_0110212 | |||
| 1273 | Ga0495672_0135188 | |||
| 1274 | Ga0495672_0195550 | |||
| 1275 | Ga0495672_0196093 | |||
| 1276 | Ga0495672_0222008 | |||
| 1277 | Ga0495676_0000018 | |||
| 1278 | Ga0495676_0005024 | |||
| 1279 | Ga0495680_0061105 | |||
| 1280 | Ga0495683_0000217 | |||
| 1281 | Ga0495683_0045859 | |||
| 1282 | Ga0495683_0066167 | |||
| 1283 | Ga0495683_0242211 | |||
| 1284 | Ga0495683_0244836 | |||
| 1285 | Ga0495679_001426 | |||
| 1286 | Ga0495679_002236 | |||
| 1287 | Ga0495679_008371 | |||
| 1288 | Ga0495679_031744 | |||
| 1289 | Ga0495685_010530 | |||
| 1290 | Ga0495673_0001075 | |||
| 1291 | Ga0495673_0002192 | |||
| 1292 | Ga0495673_0003526 | |||
| 1293 | Ga0495673_0004319 | |||
| 1294 | Ga0495673_0007446 | |||
| 1295 | Ga0495673_0033062 | |||
| 1296 | Ga0495673_0056910 | |||
| 1297 | Ga0495673_0077146 | |||
| 1298 | Ga0495673_0212344 | |||
| 1299 | Ga0495681_0003361 | |||
| 1300 | Ga0495681_0008798 | |||
| 1301 | Ga0495681_0009250 | |||
| 1302 | Ga0495681_0015123 | |||
| 1303 | Ga0495681_0018432 | |||
| 1304 | Ga0495681_0024628 | |||
| 1305 | Ga0495681_0033755 | |||
| 1306 | Ga0495681_0034021 | |||
| 1307 | Ga0495681_0055225 | |||
| 1308 | Ga0495681_0093808 | |||
| 1309 | Ga0495681_0099802 | |||
| 1310 | Ga0495686_0003379 | |||
| 1311 | Ga0495686_0007931 | |||
| 1312 | Ga0495686_0008555 | |||
| 1313 | Ga0495686_0266678 | |||
| 1314 | Ga0495602_0008372 | |||
| 1315 | Ga0495626_0000172 | |||
| 1316 | Ga0495626_0000216 | |||
| 1317 | Ga0495626_0001853 | |||
| 1318 | Ga0495626_0007749 | |||
| 1319 | Ga0495626_0011815 | |||
| 1320 | Ga0495626_0064937 | |||
| 1321 | Ga0495626_0069190 | |||
| 1322 | Ga0495626_0075810 | |||
| 1323 | Ga0495626_0103034 | |||
| 1324 | Ga0496102_0020736 | |||
| 1325 | Ga0496102_0090487 | |||
| 1326 | Ga0496103_0337393 | |||
| 1327 | Ga0496104_0306694 | |||
| 1328 | Ga0496106_0171427 | |||
| 1329 | Ga0496107_0282353 | |||
| 1330 | Ga0496108_0404994 | |||
| 1331 | Ga0496109_0023680 | |||
| 1332 | Ga0496109_0085340 | |||
| 1333 | Ga0496110_0016404 | |||
| 1334 | Ga0496112_0232886 | |||
| 1335 | Ga0496116_0000936 | |||
| 1336 | Ga0496116_0003902 | |||
| 1337 | Ga0496116_0193619 | |||
| 1338 | Ga0496118_0202442 | |||
| 1339 | Ga0496121_0008363 | |||
| 1340 | Ga0496121_0071244 | |||
| 1341 | Ga0496122_0034067 | |||
| 1342 | Ga0496123_0093014 | |||
| 1343 | Ga0496124_0020565 | |||
| 1344 | Ga0496124_0402695 | |||
| 1345 | Ga0496125_0094321 | |||
| 1346 | Ga0496126_0568843 | |||
| 1347 | Ga0495678_002211 | |||
| 1348 | Ga0495678_002245 | |||
| 1349 | Ga0495678_002671 | |||
| 1350 | Ga0495678_010990 | |||
| 1351 | Ga0495678_020457 | |||
| 1352 | Ga0495678_031180 | |||
| 1353 | Ga0495678_067754 | |||
| 1354 | Ga0495678_092940 | |||
| 1355 | Ga0495678_115754 | |||
| 1356 | Ga0495682_0047811 | |||
| 1357 | Ga0501031_0108655 | |||
| 1358 | Ga0501032_0025564 | |||
| 1359 | Ga0501034_0108480 | |||
| 1360 | Ga0501036_0009156 | |||
| 1361 | Ga0501038_0017779 | |||
| 1362 | Ga0501039_0043147 | |||
| 1363 | Ga0501039_0158740 | |||
| 1364 | Ga0501043_0021833 | |||
| 1365 | Ga0501043_0099213 | |||
| 1366 | Ga0501046_0231046 | |||
| 1367 | Ga0501047_0000598 | |||
| 1368 | Ga0501048_0288221 | |||
| 1369 | Ga0501067_0009501 | |||
| 1370 | Ga0501068_0000042 | |||
| 1371 | Ga0501069_0005495 | |||
| 1372 | Ga0501070_0130393 | |||
| 1373 | Ga0501072_0000004 | |||
| 1374 | Ga0501073_0462574 | |||
| 1375 | Ga0501074_0003700 | |||
| 1376 | Ga0501075_0572193 | |||
| 1377 | Ga0501076_0005826 | |||
| 1378 | Ga0501077_0004746 | |||
| 1379 | Ga0501240_003085 | |||
| 1380 | Ga0501079_0011435 | |||
| 1381 | Ga0501080_0024373 | |||
| 1382 | Ga0501083_0004101 | |||
| 1383 | Ga0501241_004867 | |||
| 1384 | Ga0501262_017184 | |||
| 1385 | Ga0501269_002261 | |||
| 1386 | Ga0501280_007577 | |||
| 1387 | Ga0501035_0127922 | |||
| 1388 | Ga0501035_0162760 | |||
| 1389 | Ga0501035_0807838 | |||
| 1390 | Ga0501044_0032096 | |||
| 1391 | Ga0501226_000006 | |||
| 1392 | nmdc:mga00v17_441996_c1 | |||
| 1393 | nmdc:mga0rr50_77931_c1 | |||
| 1394 | nmdc:mga08x19_509867_c1 | |||
| 1395 | Ga0500572_001081 | |||
| 1396 | Ga0500592_005174 | |||
| 1397 | Ga0500595_026562 | |||
| 1398 | Ga0500568_0016977 | |||
| 1399 | Ga0500627_0000149 | |||
| 1400 | Ga0500649_155733 | |||
| 1401 | Ga0501084_0000552 | |||
| 1402 | Ga0587083_0002115 | |||
| 1403 | Ga0587088_015475 | |||
| 1404 | Ga0587067_025154 | |||
| 1405 | Ga0501082_0015460 | |||
| 1406 | Ga0530510_0015841 | |||
| 1407 | 2511252775 | |||
| 1408 | 2511267592 | |||
| 1409 | 2511271990 | |||
| 1410 | 2511280220 | |||
| 1411 | 2511292092 | |||
| 1412 | 2511327117 | |||
| 1413 | 2511354311 | |||
| 1414 | 2511365247 | |||
| 1415 | 2511371940 | |||
| 1416 | 2511416178 | |||
| 1417 | 2512324996 | |||
| 1418 | 2583791120 | |||
| 1419 | 2597856735 | |||
| 1420 | 2599483758 | |||
| 1421 | 2600365705 | |||
| 1422 | 2601801138 | |||
| 1423 | 2606073232 | |||
| 1424 | 2606126107 | |||
| 1425 | 2624479319 | |||
| 1426 | 2643822856 | |||
| 1427 | 2643832523 | |||
| 1428 | 2643841853 | |||
| 1429 | 2643934037 | |||
| 1430 | 2644026505 | |||
| 1431 | 2644053682 | |||
| 1432 | 2644220106 | |||
| 1433 | 2644261120 | |||
| 1434 | 2644315524 | |||
| 1435 | 2715751842 | |||
| 1436 | 2715754890 | |||
| 1437 | 2718633166 | |||
| 1438 | 2739053277 | |||
| 1439 | 2739285503 | |||
| 1440 | 2739290816 | |||
| 1441 | 2739314222 | |||
| 1442 | 2842806915 | |||
| 1443 | 2842832809 | |||
| 1444 | 2842848105 | |||
| 1445 | 2852654880 | |||
| 1446 | 2852681418 | |||
| 1447 | 2878031328 | |||
| 1448 | 2919064203 | |||
| 1449 | 2919386287 | |||
| 1450 | 2919457225 | |||
| 1451 | 2919491436 | |||
| 1452 | 2969306096 | |||
| 1453 | 2974292244 | |||
| 1454 | 2984290861 | |||
| 1455 | 2998141497 | |||
| 1456 | 3007400718 | |||
| 1457 | 3007512899 | |||
| 1458 | 3007618925 | |||
| 1459 | 3007620302 | |||
| 1460 | 3007723176 | |||
| 1461 | 3007856094 | |||
| 1462 | 3007863263 | |||
| 1463 | 8011352473 | |||
| 1464 | 8015689396 | |||
| 1465 | 8029999251 | |||
| 1466 | 8055772532 | |||
| 1467 | 8056122245 | |||
| 1468 | 8056156752 | |||
| 1469 | 8056169489 | |||
| 1470 | 8056181039 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4n71-assembly3.cif.gz_D | x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz | 0.8268 | 29 | 179 |
| 4mln-assembly1.cif.gz_A | crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid | 0.8191 | 29 | 180 |
| 4n71-assembly4.cif.gz_E | x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz | 0.819 | 29 | 179 |
| 4n6w-assembly1.cif.gz_A | x-ray crystal structure of citrate-bound phnz | 0.8124 | 29 | 180 |
| 4mln-assembly2.cif.gz_B | crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid | 0.7958 | 29 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4mlnB00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.7958 | 29 | 180 | 1.10.3210.10 |
| 4mlnB00 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.6741 | 29 | 180 | 1.10.3210.10 |
| af_A0A1D6P1M6_55_306_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5964 | 14 | 179 | 1.10.3210.10 |
| af_P9WN29_336_562_1.10.3090.10 | Mainly Alpha;Orthogonal Bundle;cca-adding enzyme, domain 2;cca-adding enzyme, domain 2 | 0.5741 | 57 | 174 | 1.10.3090.10 |
| af_Q9QXN4_37_285_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5737 | 22 | 184 | 1.10.3210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E5TDX1-F1-model_v4 | deleted | 0.994 | 2 | 190 |
|
| AF-A0A848QJA5-F1-model_v4 | HD domain-containing protein | 0.9938 | 1 | 186 |
|
| AF-A0A2U0VKN6-F1-model_v4 | deleted | 0.9932 | 2 | 188 |
|
| AF-A0A0K6HUR8-F1-model_v4 | deleted | 0.9921 | 1 | 191 |
|
| AF-A0A7Y1TB96-F1-model_v4 | HD domain-containing protein | 0.9914 | 10 | 176 |
|