F478236

General Info

Members Datasets Scaffolds Average Seq Length
735 386 651 155

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2862290372|2862294501
Length 158
Sequence IASNTRVDLAELLDFVRPRHRAVLLTRRTDGGPQASPLTLGVDDSGRLVMSTYPERAKTRNAKRDEQVSVLVLSGGTSRTESGGEWNGPWVQVDGTAEVLDVPDSVEPLVEYFRNISGEHPDWDEYRAAMVKQGKSLIRVTPERWGPIATGGFPARLA

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2643221548 Streptomyces sp. Root55 Isolate Unclassified
7 2643221578 Streptomyces sp. Root63 Isolate Unclassified
8 2643221647 Streptomyces sp. Root369 Isolate Unclassified
9 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
10 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
11 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
12 2643221714 Streptomyces sp. Root264 Isolate Unclassified
13 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
14 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
15 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
16 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
17 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
18 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
19 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
20 2808606448 Streptomyces sp. 193411 Isolate Unclassified
21 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
22 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
23 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
24 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
25 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
26 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
27 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
28 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
29 2862574272 Streptomyces sp. AcE210 Isolate Nodule
30 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
31 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
32 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
33 2867369537 Streptomyces sp. Z26 Isolate Unclassified
34 2867428634 Streptomyces sp. RP5T Isolate Unclassified
35 2867475112 Streptomyces sp. TM32 Isolate Unclassified
36 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
37 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
38 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
39 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
40 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
41 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
42 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
43 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
44 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
45 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
46 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
47 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
48 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
49 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
50 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
51 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
52 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
53 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
54 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
55 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
56 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
57 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
58 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
59 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
60 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
61 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
62 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
63 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
64 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
65 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
66 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
67 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
68 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
69 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
70 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
71 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
72 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
73 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
74 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
75 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
76 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
77 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
78 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
79 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
82 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
83 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
84 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
85 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
86 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
87 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
88 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
89 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
90 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
91 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
113 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
141 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
146 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
147 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
152 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
153 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
161 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
170 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
173 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
174 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
175 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
178 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
181 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
182 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
183 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
184 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
185 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
186 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
187 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
188 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
189 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
190 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
191 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
192 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
193 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
194 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
195 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
198 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
213 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
226 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
249 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
282 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
283 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
284 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
285 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
286 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
287 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
288 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
293 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
296 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
297 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
298 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
301 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
317 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
326 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
332 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
335 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
336 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
337 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
338 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
339 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
340 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
341 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
342 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
343 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
344 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
345 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
346 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
347 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
348 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
349 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
350 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
351 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
352 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
353 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
354 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
357 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
358 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
359 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
360 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
361 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
362 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
363 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
364 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
365 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
366 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
367 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
368 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
369 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
370 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
371 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
372 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
373 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
374 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
375 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
376 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
377 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
378 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
379 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
380 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
381 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
382 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
383 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
384 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
385 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
386 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.76
Metatranscriptomes 0.68
Isolates 11.56

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 7.62
Nodule 0.82
Rhizoplane 1.36
Rhizosphere 77.01
Stem 0
Stem Tuber 0
Unclassified 12.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10022997 3300001989 Bacteria 2207
2 JGI24737J22298_10070152 3300001990 Bacteria 1047
3 JGI24735J21928_10045118 3300002067 Bacteria 1280
4 JGI24738J21930_10047408 3300002075 Bacteria 874
5 JGI25153J46596_10049885 3300003215 Bacteria 1211
6 rootH1_10033732 3300003316 Bacteria 1987
7 rootH1_10033732 3300003323 Bacteria 1356
8 rootH1_10033733 3300003316 Bacteria 4211
9 rootL2_10041240 3300003322 Bacteria 3617
10 rootL2_10210732 3300003322 Bacteria 2074
11 rootH1_10123303 3300003323 Bacteria 2946
12 rootH1_10152422 3300003323 Bacteria 2197
13 JGI25160J50197_1047075 3300003354 Bacteria 941
14 Ga0006562J51391_1050546 3300003578 Bacteria 5140
15 Ga0006562J51391_1050549 3300003578 Bacteria 900
16 Ga0006562J51391_1061896 3300003578 Bacteria 2485
17 Ga0070659_100618232 3300005366 Bacteria 932
18 Ga0070678_100978085 3300005456 Bacteria 777
19 Ga0070681_10359612 3300005458 Bacteria 1366
20 Ga0068853_100104923 3300005539 Bacteria 2503
21 Ga0068853_101139383 3300005539 Bacteria 752
22 Ga0070665_100304078 3300005548 Bacteria 1598
23 Ga0070665_100330676 3300005548 Bacteria 1528
24 Ga0068855_100023062 3300005563 Bacteria 7459
25 Ga0070664_100072581 3300005564 Bacteria 2952
26 Ga0068857_100269982 3300005577 Bacteria 1563
27 Ga0068856_100010663 3300005614 Bacteria 8929
28 Ga0068856_100415826 3300005614 Bacteria 1365
29 Ga0070702_100991800 3300005615 Bacteria 664
30 Ga0068852_100001014 3300005616 Bacteria 18540
31 Ga0081455_10365355 3300005937 Bacteria 1013
32 Ga0075363_100076247 3300006048 Bacteria 1828
33 Ga0075363_100087882 3300006048 Bacteria 1708
34 Ga0075363_100201209 3300006048 Bacteria 1138
35 Ga0075370_10084253 3300006353 Bacteria 1830
36 Ga0099826_10388104 3300006948 Bacteria 682
37 Ga0105250_10175887 3300009092 Bacteria 897
38 Ga0105240_10076356 3300009093 Bacteria 4130
39 Ga0105240_10907819 3300009093 Bacteria 947
40 Ga0105245_10241199 3300009098 Bacteria 1752
41 Ga0105245_10328955 3300009098 Bacteria 1508
42 Ga0105243_10956558 3300009148 Bacteria 856
43 Ga0105243_12657826 3300009148 Bacteria 541
44 Ga0105241_10001341 3300009174 Bacteria 18679
45 Ga0105242_10517223 3300009176 Bacteria 1138
46 Ga0105248_10106466 3300009177 Bacteria 3162
47 Ga0105238_10709397 3300009551 Bacteria 1018
48 Ga0105249_11659376 3300009553 Bacteria 712
49 Ga0105239_10014936 3300010375 Bacteria 8608
50 Ga0105239_11253092 3300010375 Bacteria 855
51 Ga0105239_11323169 3300010375 Bacteria 831
52 Ga0105239_11665290 3300010375 Bacteria 738
53 Ga0105239_12481449 3300010375 Bacteria 604
54 Ga0105246_10000030 3300011119 Bacteria 52202
55 Ga0105246_10135778 3300011119 Bacteria 1843
56 Ga0105246_10476239 3300011119 Bacteria 1055
57 Ga0157369_10065387 3300013105 Bacteria 3913
58 Ga0157374_10365857 3300013296 Bacteria 1435
59 Ga0157372_10102885 3300013307 Bacteria 3263
60 Ga0157375_12561578 3300013308 Bacteria 609
61 Ga0157380_10600838 3300014326 Bacteria 1088
62 Ga0182008_10002267 3300014497 Bacteria 12145
63 Ga0157376_10944088 3300014969 Bacteria 883
64 Ga0182007_10004465 3300015262 Bacteria 6339
65 Ga0183367_1008 3300015688 Bacteria 490626
66 Ga0224712_10045281 3300022467 Bacteria 1682
67 Ga0224712_10241416 3300022467 Bacteria 832
68 Ga0209758_1008765 3300025297 Bacteria 6450
69 Ga0207426_1001637 3300025302 Bacteria 17519
70 Ga0207426_1003477 3300025302 Bacteria 8511
71 Ga0207426_1004228 3300025302 Bacteria 7135
72 Ga0207426_1010421 3300025302 Bacteria 3605
73 Ga0207426_1018541 3300025302 Bacteria 2450
74 Ga0207680_10540608 3300025903 Bacteria 831
75 Ga0207647_10015752 3300025904 Bacteria 5175
76 Ga0207654_10009813 3300025911 Bacteria 4869
77 Ga0207695_10004099 3300025913 Bacteria 20031
78 Ga0207671_10000128 3300025914 Bacteria 117836
79 Ga0207694_10207057 3300025924 Bacteria 1597
80 Ga0207687_10049131 3300025927 Bacteria 2932
81 Ga0207687_10076420 3300025927 Bacteria 2405
82 Ga0207706_10090638 3300025933 Bacteria 2688
83 Ga0207709_10962978 3300025935 Bacteria 696
84 Ga0207711_10279927 3300025941 Bacteria 1536
85 Ga0207679_10025198 3300025945 Bacteria 4088
86 Ga0207667_10055281 3300025949 Bacteria 4173
87 Ga0207640_10379866 3300025981 Bacteria 1144
88 Ga0207703_10277085 3300026035 Bacteria 1522
89 Ga0207639_10085880 3300026041 Bacteria 2504
90 Ga0207639_10176724 3300026041 Bacteria 1813
91 Ga0207678_10023248 3300026067 Bacteria 5421
92 Ga0207708_10312671 3300026075 Bacteria 1280
93 Ga0207702_10249966 3300026078 Bacteria 1665
94 Ga0207702_10269079 3300026078 Bacteria 1607
95 Ga0207674_10947892 3300026116 Bacteria 829
96 Ga0207675_100068085 3300026118 Bacteria 3328
97 Ga0207683_11356060 3300026121 Bacteria 658
98 Ga0207698_10349870 3300026142 Bacteria 1395
99 Ga0209371_1013135 3300027312 Bacteria 2348
100 Ga0209282_1270904 3300027666 Bacteria 738
101 Ga0209813_10024039 3300027866 Bacteria 1738
102 Ga0268266_10179042 3300028379 Bacteria 1929
103 Ga0268266_10279799 3300028379 Bacteria 1551
104 Ga0268266_11488576 3300028379 Bacteria 652
105 Ga0307515_10000928 3300028794 Bacteria 67239
106 Ga0307515_10437980 3300028794 Bacteria 924
107 Ga0307515_10581538 3300028794 Bacteria 730
108 Ga0268256_1014405 3300030500 Bacteria 2348
109 Ga0307511_10000945 3300030521 Bacteria 30807
110 Ga0307511_10057234 3300030521 Bacteria 3035
111 Ga0307511_10205780 3300030521 Bacteria 1013
112 Ga0307511_10248197 3300030521 Bacteria 859
113 Ga0307512_10012951 3300030522 Bacteria 7840
114 Ga0307512_10240452 3300030522 Bacteria 917
115 Ga0316181_1127688 3300030744 Bacteria 630
116 Ga0307513_10003927 3300031456 Bacteria 19997
117 Ga0307513_10072221 3300031456 Bacteria 3598
118 Ga0307513_10116156 3300031456 Bacteria 2656
119 Ga0307509_10022630 3300031507 Bacteria 7079
120 Ga0307509_10076738 3300031507 Bacteria 3466
121 Ga0307509_10252668 3300031507 Bacteria 1545
122 Ga0307509_10605991 3300031507 Bacteria 767
123 Ga0307408_102085221 3300031548 Bacteria 546
124 Ga0307508_10002378 3300031616 Bacteria 19910
125 Ga0307508_10022735 3300031616 Bacteria 5699
126 Ga0307508_10047622 3300031616 Bacteria 3821
127 Ga0307508_10077737 3300031616 Bacteria 2897
128 Ga0307508_10079919 3300031616 Bacteria 2851
129 Ga0307508_10198007 3300031616 Bacteria 1610
130 Ga0307508_10724499 3300031616 Bacteria 606
131 Ga0307514_10018627 3300031649 Bacteria 5691
132 Ga0307514_10208235 3300031649 Bacteria 1218
133 Ga0307514_10238643 3300031649 Bacteria 1092
134 Ga0307514_10345239 3300031649 Bacteria 798
135 Ga0307514_10349345 3300031649 Bacteria 789
136 Ga0307514_10356189 3300031649 Bacteria 776
137 Ga0316575_10051119 3300031665 Bacteria 1646
138 Ga0307516_10006477 3300031730 Bacteria 13711
139 Ga0307516_10144310 3300031730 Bacteria 2147
140 Ga0307516_10240442 3300031730 Bacteria 1509
141 Ga0307516_10356750 3300031730 Bacteria 1127
142 Ga0307518_10058932 3300031838 Bacteria 2788
143 Ga0307518_10175432 3300031838 Bacteria 1455
144 Ga0307518_10271488 3300031838 Bacteria 1058
145 Ga0307410_10067358 3300031852 Bacteria 2470
146 Ga0307410_10275437 3300031852 Bacteria 1318
147 Ga0307409_100037687 3300031995 Bacteria 3567
148 Ga0307409_100119570 3300031995 Bacteria 2228
149 Ga0307416_101709543 3300032002 Bacteria 734
150 Ga0307411_10634545 3300032005 Bacteria 923
151 Ga0307507_10017128 3300033179 Bacteria 8353
152 Ga0307507_10028020 3300033179 Bacteria 6016
153 Ga0307510_10041179 3300033180 Bacteria 5056
154 Ga0307510_10085353 3300033180 Bacteria 3034
155 Ga0307510_10121601 3300033180 Bacteria 2313
156 Ga0307510_10219680 3300033180 Bacteria 1413
157 Ga0307510_10494631 3300033180 Bacteria 665
158 Ga0395899_0261655 3300037312 Bacteria 1183
159 Ga0395899_0580091 3300037312 Bacteria 717
160 Ga0395900_0179671 3300037418 Bacteria 2151
161 Ga0395900_0424277 3300037418 Bacteria 1290
162 Ga0395898_0001397 3300037466 Bacteria 34434
163 Ga0395898_0003880 3300037466 Bacteria 16509
164 Ga0395898_0073658 3300037466 Bacteria 3299
165 Ga0395905_0365510 3300037471 Bacteria 1336
166 Ga0395901_0078391 3300038443 Bacteria 3449
167 Ga0395901_0096424 3300038443 Bacteria 3099
168 Ga0395901_0105186 3300038443 Bacteria 2962
169 Ga0439436_0003058 3300041404 Bacteria 5077
170 Ga0439436_0004048 3300041404 Bacteria 4493
171 Ga0439439_0008564 3300041406 Bacteria 2419
172 Ga0439439_0066166 3300041406 Bacteria 964
173 Ga0451789_1138150 3300041443 Bacteria 658
174 Ga0451797_0889241 3300041453 Bacteria 791
175 Ga0451807_2473932 3300041486 Bacteria 740
176 Ga0451837_0989560 3300041494 Bacteria 1198
177 Ga0451841_0983366 3300041498 Bacteria 509
178 Ga0451847_0832006 3300041503 Bacteria 705
179 Ga0451851_0290026 3300041507 Bacteria 911
180 Ga0451851_1377664 3300041507 Bacteria 847
181 Ga0451853_0777276 3300041512 Bacteria 2380
182 Ga0451853_2561483 3300041512 Bacteria 2314
183 Ga0439433_0000565 3300041999 Bacteria 7019
184 Ga0439433_0023848 3300041999 Bacteria 1377
185 Ga0439442_009075 3300042002 Bacteria 2011
186 Ga0439442_011672 3300042002 Bacteria 1791
187 Ga0439448_0002231 3300042005 Bacteria 5235
188 Ga0439432_021300 3300042006 Bacteria 2151
189 Ga0439449_0000841 3300042007 Bacteria 11909
190 Ga0439449_0084120 3300042007 Bacteria 1174
191 Ga0439457_001497 3300042014 Bacteria 7001
192 Ga0439462_0000959 3300042015 Bacteria 6127
193 Ga0450890_010016 3300042127 Bacteria 1218
194 Ga0450894_000065 3300042131 Bacteria 16610
195 Ga0450895_005044 3300042132 Bacteria 1057
196 Ga0450896_001817 3300042133 Bacteria 2696
197 Ga0450898_005535 3300042134 Bacteria 1912
198 Ga0450899_000511 3300042135 Bacteria 4391
199 Ga0450900_004000 3300042136 Bacteria 1672
200 Ga0450903_000670 3300042138 Bacteria 6896
201 Ga0450904_013758 3300042139 Bacteria 806
202 Ga0450906_000844 3300042145 Bacteria 6751
203 Ga0439458_0000517 3300042157 Bacteria 9922
204 Ga0450908_032289 3300042184 Bacteria 908
205 Ga0439464_0012340 3300042439 Bacteria 2275
206 Ga0466969_0005631 3300044656 Bacteria 6661
207 Ga0466969_0073532 3300044656 Bacteria 1640
208 Ga0466972_0001060 3300044658 Bacteria 13194
209 Ga0466972_0069299 3300044658 Bacteria 1684
210 Ga0466972_0081032 3300044658 Bacteria 1545
211 Ga0466972_0295908 3300044658 Bacteria 756
212 Ga0466965_0000312 3300044683 Bacteria 16288
213 Ga0466965_0014405 3300044683 Bacteria 3742
214 Ga0466965_0241500 3300044683 Bacteria 967
215 Ga0466966_0001162 3300044684 Bacteria 16927
216 Ga0466966_0002783 3300044684 Bacteria 11495
217 Ga0466961_0002591 3300044693 Bacteria 11217
218 Ga0466961_0005840 3300044693 Bacteria 7798
219 Ga0466961_0034399 3300044693 Bacteria 3253
220 Ga0466961_0035125 3300044693 Bacteria 3219
221 Ga0466961_0062799 3300044693 Bacteria 2360
222 Ga0466963_0003115 3300044694 Bacteria 9398
223 Ga0466963_0165305 3300044694 Bacteria 1541
224 Ga0466964_0008956 3300044706 Bacteria 3765
225 Ga0466964_0039907 3300044706 Bacteria 1893
226 Ga0466964_0392880 3300044706 Bacteria 723
227 Ga0466971_0000277 3300044719 Bacteria 19725
228 Ga0466971_0015939 3300044719 Bacteria 3312
229 Ga0466968_0087204 3300044735 Bacteria 1378
230 Ga0466970_0000443 3300044765 Bacteria 20304
231 Ga0466970_0006602 3300044765 Bacteria 5804
232 Ga0466970_0016652 3300044765 Bacteria 3793
233 Ga0466970_0057196 3300044765 Bacteria 2085
234 Ga0466957_0001357 3300044842 Bacteria 12776
235 Ga0466960_0266483 3300044901 Bacteria 956
236 Ga0466959_0019009 3300045049 Bacteria 5049
237 Ga0466958_0118783 3300045836 Bacteria 1654
238 Ga0466958_0136775 3300045836 Bacteria 1541
239 Ga0466967_0004534 3300045976 Bacteria 9396
240 Ga0466967_0006993 3300045976 Bacteria 8074
241 Ga0466967_0016389 3300045976 Bacteria 5843
242 Ga0466967_0030987 3300045976 Bacteria 4496
243 Ga0466967_0210293 3300045976 Bacteria 1845
244 Ga0466967_0883424 3300045976 Bacteria 889
245 Ga0495617_007941 3300046452 Bacteria 3669
246 Ga0495627_099664 3300046453 Bacteria 830
247 Ga0495592_0009032 3300046454 Bacteria 7491
248 Ga0495592_0086204 3300046454 Bacteria 2262
249 Ga0495592_0159822 3300046454 Bacteria 1551
250 Ga0495603_0000701 3300046455 Bacteria 18948
251 Ga0495603_0002941 3300046455 Bacteria 10074
252 Ga0495603_0004561 3300046455 Bacteria 8266
253 Ga0495603_0007883 3300046455 Bacteria 6422
254 Ga0495603_0025037 3300046455 Bacteria 3609
255 Ga0495603_0046323 3300046455 Bacteria 2591
256 Ga0495603_0627013 3300046455 Bacteria 615
257 Ga0495629_0000808 3300046459 Bacteria 25349
258 Ga0495629_0008474 3300046459 Bacteria 7569
259 Ga0495629_0013998 3300046459 Bacteria 5781
260 Ga0495629_0015401 3300046459 Bacteria 5492
261 Ga0495629_0016632 3300046459 Bacteria 5279
262 Ga0495629_0030931 3300046459 Bacteria 3792
263 Ga0495629_0085598 3300046459 Bacteria 2199
264 Ga0495629_0137419 3300046459 Bacteria 1701
265 Ga0495629_0317301 3300046459 Bacteria 1066
266 Ga0495638_0110084 3300046460 Bacteria 1637
267 Ga0495638_0175704 3300046460 Bacteria 1225
268 Ga0495638_0249774 3300046460 Bacteria 978
269 Ga0495641_0186225 3300046461 Bacteria 930
270 Ga0495641_0314772 3300046461 Bacteria 706
271 Ga0495651_0001478 3300046462 Bacteria 18178
272 Ga0495651_0101094 3300046462 Bacteria 2146
273 Ga0495605_0005776 3300046474 Bacteria 7163
274 Ga0495605_0028277 3300046474 Bacteria 2895
275 Ga0495662_0000395 3300046476 Bacteria 19477
276 Ga0495662_0009266 3300046476 Bacteria 4829
277 Ga0495662_0049855 3300046476 Bacteria 2020
278 Ga0495664_0004484 3300046477 Bacteria 7641
279 Ga0495664_0061773 3300046477 Bacteria 2230
280 Ga0495585_0007936 3300046492 Bacteria 6453
281 Ga0495585_0088060 3300046492 Bacteria 1675
282 Ga0495585_0164620 3300046492 Bacteria 1149
283 Ga0495585_0281423 3300046492 Bacteria 822
284 Ga0495594_0005254 3300046499 Bacteria 6657
285 Ga0495594_0012424 3300046499 Bacteria 4435
286 Ga0495594_0016252 3300046499 Bacteria 3919
287 Ga0495594_0033179 3300046499 Bacteria 2805
288 Ga0495594_0069923 3300046499 Bacteria 1950
289 Ga0495594_0132329 3300046499 Bacteria 1413
290 Ga0495594_0231446 3300046499 Bacteria 1053
291 Ga0495594_0284825 3300046499 Bacteria 941
292 Ga0495596_0049344 3300046500 Bacteria 1650
293 Ga0495607_0069566 3300046501 Bacteria 1969
294 Ga0495607_0095114 3300046501 Bacteria 1606
295 Ga0495583_0060370 3300046506 Bacteria 1695
296 Ga0495583_0095732 3300046506 Bacteria 1273
297 Ga0495583_0171396 3300046506 Bacteria 891
298 Ga0495606_0013342 3300046507 Bacteria 6502
299 Ga0495608_0528453 3300046511 Bacteria 712
300 Ga0495610_0012935 3300046512 Bacteria 4988
301 Ga0495616_0002920 3300046513 Bacteria 11131
302 Ga0495616_0334252 3300046513 Bacteria 634
303 Ga0495618_0041048 3300046514 Bacteria 2913
304 Ga0495618_0118360 3300046514 Bacteria 1696
305 Ga0495620_0005708 3300046515 Bacteria 6928
306 Ga0495620_0021552 3300046515 Bacteria 3127
307 Ga0495620_0057291 3300046515 Bacteria 1636
308 Ga0495628_0006091 3300046516 Bacteria 10548
309 Ga0495628_0037203 3300046516 Bacteria 3902
310 Ga0495628_0287576 3300046516 Bacteria 1219
311 Ga0495630_0076146 3300046517 Bacteria 2528
312 Ga0495630_0140144 3300046517 Bacteria 1839
313 Ga0495631_0005953 3300046518 Bacteria 6343
314 Ga0495631_0150477 3300046518 Bacteria 999
315 Ga0495632_0025647 3300046519 Bacteria 3115
316 Ga0495632_0169047 3300046519 Bacteria 1005
317 Ga0495637_0131564 3300046520 Bacteria 955
318 Ga0495643_0008008 3300046522 Bacteria 6738
319 Ga0495643_0008270 3300046522 Bacteria 6606
320 Ga0495644_0114281 3300046523 Bacteria 1025
321 Ga0495648_0104392 3300046524 Bacteria 1556
322 Ga0495648_0219270 3300046524 Bacteria 939
323 Ga0495648_0267686 3300046524 Bacteria 816
324 Ga0495666_0086076 3300046526 Bacteria 1484
325 Ga0495666_0488619 3300046526 Bacteria 550
326 Ga0495642_0076710 3300046528 Bacteria 1403
327 Ga0495642_0204514 3300046528 Bacteria 861
328 Ga0495652_0002292 3300046529 Bacteria 19970
329 Ga0495652_0018776 3300046529 Bacteria 6162
330 Ga0495652_0226270 3300046529 Bacteria 1402
331 Ga0495652_0690736 3300046529 Bacteria 687
332 Ga0495654_0039808 3300046530 Bacteria 2345
333 Ga0495640_0005132 3300046533 Bacteria 10410
334 Ga0495640_0170785 3300046533 Bacteria 1389
335 Ga0495586_0041897 3300046535 Bacteria 2466
336 Ga0495586_0114791 3300046535 Bacteria 1501
337 Ga0495609_0014264 3300046538 Bacteria 3740
338 Ga0495609_0037075 3300046538 Bacteria 2200
339 Ga0495597_0065595 3300046542 Bacteria 1574
340 Ga0495645_0017508 3300046543 Bacteria 5133
341 Ga0495645_0156268 3300046543 Bacteria 1580
342 Ga0495622_0007310 3300046557 Bacteria 5127
343 Ga0495622_0024271 3300046557 Bacteria 2831
344 Ga0495633_0033065 3300046558 Bacteria 2495
345 Ga0495667_0144260 3300046559 Bacteria 1534
346 Ga0495667_0229274 3300046559 Bacteria 1184
347 Ga0495656_0553821 3300046615 Bacteria 613
348 Ga0495668_0017571 3300046616 Bacteria 4145
349 Ga0495668_0024591 3300046616 Bacteria 3425
350 Ga0495634_0027789 3300046642 Bacteria 3933
351 Ga0495634_0036930 3300046642 Bacteria 3339
352 Ga0495611_0047056 3300046648 Bacteria 1935
353 Ga0495611_0228764 3300046648 Bacteria 864
354 Ga0495625_0027694 3300046660 Bacteria 4259
355 Ga0495625_0043869 3300046660 Bacteria 3240
356 Ga0495625_0139786 3300046660 Bacteria 1634
357 Ga0495625_0174059 3300046660 Bacteria 1435
358 Ga0495625_0411778 3300046660 Bacteria 842
359 Ga0495635_0000602 3300046663 Bacteria 23157
360 Ga0495635_0205053 3300046663 Bacteria 1337
361 Ga0495635_0224614 3300046663 Bacteria 1269
362 Ga0495661_0012661 3300046665 Bacteria 5693
363 Ga0495661_0123762 3300046665 Bacteria 1425
364 Ga0495588_0001017 3300046674 Bacteria 12195
365 Ga0495588_0001932 3300046674 Bacteria 8853
366 Ga0495588_0080786 3300046674 Bacteria 1697
367 Ga0495588_0393200 3300046674 Bacteria 728
368 Ga0495657_0002328 3300046675 Bacteria 15995
369 Ga0495657_0029544 3300046675 Bacteria 3844
370 Ga0495657_0072892 3300046675 Bacteria 2238
371 Ga0495657_0289018 3300046675 Bacteria 979
372 Ga0495623_0513047 3300046679 Bacteria 631
373 Ga0495646_0000580 3300046680 Bacteria 19850
374 Ga0495646_0063836 3300046680 Bacteria 2185
375 Ga0495658_0087961 3300046683 Bacteria 1835
376 Ga0495658_0103622 3300046683 Bacteria 1702
377 Ga0495613_0001160 3300046689 Bacteria 20120
378 Ga0495613_0004327 3300046689 Bacteria 10633
379 Ga0495613_0017915 3300046689 Bacteria 5280
380 Ga0495613_0208155 3300046689 Bacteria 1376
381 Ga0495613_0254240 3300046689 Bacteria 1225
382 Ga0495613_0391034 3300046689 Bacteria 950
383 Ga0495613_0452794 3300046689 Bacteria 869
384 Ga0495613_0644312 3300046689 Bacteria 701
385 Ga0495624_0124203 3300046690 Bacteria 1584
386 Ga0495624_0432879 3300046690 Bacteria 788
387 Ga0495670_0000768 3300046691 Bacteria 15390
388 Ga0495670_0066409 3300046691 Bacteria 1820
389 Ga0495670_0106878 3300046691 Bacteria 1446
390 Ga0495670_0452614 3300046691 Bacteria 695
391 Ga0495671_0007931 3300046692 Bacteria 6007
392 Ga0495671_0058976 3300046692 Bacteria 1898
393 Ga0495671_0178769 3300046692 Bacteria 1031
394 Ga0495649_0024808 3300046694 Bacteria 3343
395 Ga0495649_0041202 3300046694 Bacteria 2526
396 Ga0495649_0174306 3300046694 Bacteria 1124
397 Ga0495589_0010936 3300046794 Bacteria 4714
398 Ga0495589_0015889 3300046794 Bacteria 3870
399 Ga0495589_0072839 3300046794 Bacteria 1677
400 Ga0495589_0110063 3300046794 Bacteria 1330
401 Ga0495589_0119531 3300046794 Bacteria 1269
402 Ga0495589_0121734 3300046794 Bacteria 1256
403 Ga0495600_0004676 3300046809 Bacteria 8205
404 Ga0495600_0191492 3300046809 Bacteria 1315
405 Ga0495600_0268036 3300046809 Bacteria 1083
406 Ga0495660_0025579 3300046810 Bacteria 3351
407 Ga0495660_0116713 3300046810 Bacteria 1355
408 Ga0495660_0123697 3300046810 Bacteria 1305
409 Ga0495581_0017554 3300047315 Bacteria 4156
410 Ga0495581_0038486 3300047315 Bacteria 2768
411 Ga0495581_0340649 3300047315 Bacteria 875
412 Ga0495581_0387340 3300047315 Bacteria 816
413 Ga0495581_0389546 3300047315 Bacteria 813
414 Ga0495604_0000226 3300047317 Bacteria 50983
415 Ga0495604_0002227 3300047317 Bacteria 15528
416 Ga0495604_0017363 3300047317 Bacteria 5760
417 Ga0495604_0073508 3300047317 Bacteria 2580
418 Ga0495604_0206185 3300047317 Bacteria 1360
419 Ga0495604_0409596 3300047317 Bacteria 892
420 Ga0495636_0004207 3300047318 Bacteria 5653
421 Ga0495636_0036488 3300047318 Bacteria 2028
422 Ga0495636_0041026 3300047318 Bacteria 1920
423 Ga0495636_0063937 3300047318 Bacteria 1560
424 Ga0495636_0296473 3300047318 Bacteria 756
425 Ga0495674_0041092 3300047319 Bacteria 4133
426 Ga0495674_0296435 3300047319 Bacteria 1321
427 Ga0495676_0002383 3300047321 Bacteria 16681
428 Ga0495676_0010778 3300047321 Bacteria 8272
429 Ga0495676_0016617 3300047321 Bacteria 6521
430 Ga0495676_0018192 3300047321 Bacteria 6198
431 Ga0495676_0024429 3300047321 Bacteria 5231
432 Ga0495676_0060795 3300047321 Bacteria 2958
433 Ga0495676_0114621 3300047321 Bacteria 1971
434 Ga0495676_0337533 3300047321 Bacteria 1009
435 Ga0495676_0950478 3300047321 Bacteria 549
436 Ga0495676_0991646 3300047321 Bacteria 536
437 Ga0495680_0014470 3300047322 Bacteria 6831
438 Ga0495683_0012497 3300047323 Bacteria 4456
439 Ga0495683_0069893 3300047323 Bacteria 1725
440 Ga0495683_0162249 3300047323 Bacteria 1033
441 Ga0495683_0428736 3300047323 Bacteria 545
442 Ga0495687_004621 3300047443 Bacteria 9199
443 Ga0495687_009644 3300047443 Bacteria 5375
444 Ga0495687_019701 3300047443 Bacteria 3302
445 Ga0495687_028005 3300047443 Bacteria 2627
446 Ga0495687_029674 3300047443 Bacteria 2526
447 Ga0495687_059001 3300047443 Bacteria 1590
448 Ga0495687_097942 3300047443 Bacteria 1107
449 Ga0495675_0031721 3300047444 Bacteria 3373
450 Ga0495675_0043171 3300047444 Bacteria 2873
451 Ga0495675_0044461 3300047444 Bacteria 2829
452 Ga0495675_0101791 3300047444 Bacteria 1797
453 Ga0495677_0040808 3300047445 Bacteria 1697
454 Ga0495677_0319884 3300047445 Bacteria 611
455 Ga0495679_116447 3300047446 Bacteria 733
456 Ga0495685_000778 3300047447 Bacteria 9737
457 Ga0495685_004500 3300047447 Bacteria 4509
458 Ga0495685_008344 3300047447 Bacteria 3438
459 Ga0495685_014206 3300047447 Bacteria 2705
460 Ga0495685_017916 3300047447 Bacteria 2427
461 Ga0495685_033159 3300047447 Bacteria 1774
462 Ga0495685_081222 3300047447 Bacteria 1079
463 Ga0495673_0158595 3300047469 Bacteria 870
464 Ga0495681_0004063 3300047470 Bacteria 10066
465 Ga0495681_0009575 3300047470 Bacteria 5951
466 Ga0495681_0049976 3300047470 Bacteria 1974
467 Ga0495681_0074063 3300047470 Bacteria 1536
468 Ga0495681_0123531 3300047470 Bacteria 1108
469 Ga0495684_0101024 3300047471 Bacteria 2181
470 Ga0495686_0014932 3300047472 Bacteria 5327
471 Ga0495686_0054549 3300047472 Bacteria 2502
472 Ga0495686_0124692 3300047472 Bacteria 1532
473 Ga0495593_0003706 3300047673 Bacteria 9125
474 Ga0495593_0034713 3300047673 Bacteria 2741
475 Ga0495593_0275466 3300047673 Bacteria 842
476 Ga0495602_0018549 3300048088 Bacteria 6943
477 Ga0495602_0632923 3300048088 Bacteria 732
478 Ga0495614_0000762 3300048089 Bacteria 13654
479 Ga0495614_0032643 3300048089 Bacteria 2240
480 Ga0495614_0052465 3300048089 Bacteria 1747
481 Ga0495614_0113128 3300048089 Bacteria 1192
482 Ga0495614_0131186 3300048089 Bacteria 1109
483 Ga0495626_0013046 3300048091 Bacteria 4333
484 Ga0496100_0551341 3300048903 Bacteria 892
485 Ga0496102_0258527 3300048905 Bacteria 1642
486 Ga0496109_0027221 3300048912 Bacteria 5103
487 Ga0496110_0187678 3300048913 Bacteria 1877
488 Ga0496113_0813276 3300048916 Bacteria 742
489 Ga0496113_0886114 3300048916 Bacteria 706
490 Ga0496124_0798252 3300048927 Bacteria 585
491 Ga0495678_043912 3300049459 Bacteria 1771
492 Ga0495682_0140059 3300049460 Bacteria 864
493 Ga0501031_0028807 3300049568 Bacteria 3619
494 Ga0501031_0047522 3300049568 Bacteria 2798
495 Ga0501031_0048382 3300049568 Bacteria 2771
496 Ga0501031_0100282 3300049568 Bacteria 1889
497 Ga0501031_0162913 3300049568 Bacteria 1458
498 Ga0501031_0591754 3300049568 Bacteria 714
499 Ga0501031_0663043 3300049568 Bacteria 670
500 Ga0501032_0004893 3300049569 Bacteria 10026
501 Ga0501032_0019445 3300049569 Bacteria 4752
502 Ga0501032_0019559 3300049569 Bacteria 4735
503 Ga0501032_0031825 3300049569 Bacteria 3616
504 Ga0501032_0046785 3300049569 Bacteria 2923
505 Ga0501033_0002071 3300049570 Bacteria 17426
506 Ga0501033_0012983 3300049570 Bacteria 6353
507 Ga0501033_0140986 3300049570 Bacteria 1742
508 Ga0501033_0203535 3300049570 Bacteria 1413
509 Ga0501033_0454388 3300049570 Bacteria 889
510 Ga0501033_0630213 3300049570 Bacteria 733
511 Ga0501034_0007488 3300049571 Bacteria 11611
512 Ga0501034_0027409 3300049571 Bacteria 5794
513 Ga0501034_0027444 3300049571 Bacteria 5791
514 Ga0501034_0104840 3300049571 Bacteria 2820
515 Ga0501034_0160144 3300049571 Bacteria 2222
516 Ga0501034_0240338 3300049571 Bacteria 1757
517 Ga0501034_1252451 3300049571 Bacteria 619
518 Ga0501036_0029018 3300049572 Bacteria 4676
519 Ga0501036_0071114 3300049572 Bacteria 2941
520 Ga0501036_0110506 3300049572 Bacteria 2322
521 Ga0501036_0152940 3300049572 Bacteria 1946
522 Ga0501037_0008710 3300049573 Bacteria 7436
523 Ga0501037_0037533 3300049573 Bacteria 3572
524 Ga0501037_0041679 3300049573 Bacteria 3376
525 Ga0501037_0051209 3300049573 Bacteria 3020
526 Ga0501037_0261434 3300049573 Bacteria 1209
527 Ga0501037_0304226 3300049573 Bacteria 1106
528 Ga0501038_0004798 3300049574 Bacteria 12563
529 Ga0501038_0010841 3300049574 Bacteria 8328
530 Ga0501038_0054508 3300049574 Bacteria 3439
531 Ga0501038_0068534 3300049574 Bacteria 3015
532 Ga0501038_0270448 3300049574 Bacteria 1340
533 Ga0501038_0554041 3300049574 Bacteria 874
534 Ga0501038_0752872 3300049574 Bacteria 726
535 Ga0501039_0008768 3300049575 Bacteria 7705
536 Ga0501039_0123269 3300049575 Bacteria 2031
537 Ga0501039_0512505 3300049575 Bacteria 942
538 Ga0501039_0515784 3300049575 Bacteria 938
539 Ga0501040_0032809 3300049576 Bacteria 3514
540 Ga0501041_0016821 3300049577 Bacteria 4352
541 Ga0501042_0046275 3300049578 Bacteria 3101
542 Ga0501042_0437498 3300049578 Bacteria 948
543 Ga0501042_0734049 3300049578 Bacteria 718
544 Ga0501043_0006511 3300049579 Bacteria 9370
545 Ga0501043_0008928 3300049579 Bacteria 7890
546 Ga0501043_0027864 3300049579 Bacteria 4434
547 Ga0501043_0065798 3300049579 Bacteria 2846
548 Ga0501043_0142473 3300049579 Bacteria 1876
549 Ga0501043_0190454 3300049579 Bacteria 1595
550 Ga0501043_0475831 3300049579 Bacteria 936
551 Ga0501046_0111282 3300049580 Bacteria 2091
552 Ga0501046_0134751 3300049580 Bacteria 1871
553 Ga0501047_0002783 3300049581 Bacteria 16617
554 Ga0501047_0011970 3300049581 Bacteria 8209
555 Ga0501047_0030243 3300049581 Bacteria 5221
556 Ga0501047_0033911 3300049581 Bacteria 4927
557 Ga0501047_0118676 3300049581 Bacteria 2527
558 Ga0501047_0169834 3300049581 Bacteria 2050
559 Ga0501047_0189979 3300049581 Bacteria 1917
560 Ga0501047_0255805 3300049581 Bacteria 1599
561 Ga0501047_0490974 3300049581 Bacteria 1055
562 Ga0501048_0035095 3300049582 Bacteria 3612
563 Ga0501048_0037511 3300049582 Bacteria 3480
564 Ga0501067_0010603 3300049583 Bacteria 5099
565 Ga0501068_0074920 3300049584 Bacteria 2069
566 Ga0501069_0004549 3300049585 Bacteria 7170
567 Ga0501070_0049737 3300049586 Bacteria 3480
568 Ga0501070_0183686 3300049586 Bacteria 1720
569 Ga0501070_0213894 3300049586 Bacteria 1582
570 Ga0501070_1324685 3300049586 Bacteria 549
571 Ga0501071_0013450 3300049587 Bacteria 5577
572 Ga0501072_0005819 3300049588 Bacteria 9390
573 Ga0501073_0009815 3300049589 Bacteria 7045
574 Ga0501073_0125795 3300049589 Bacteria 1777
575 Ga0501074_0325926 3300049590 Bacteria 1090
576 Ga0501077_0054792 3300049593 Bacteria 2532
577 Ga0501079_0008914 3300049741 Bacteria 7595
578 Ga0501080_0043441 3300049742 Bacteria 4185
579 Ga0501080_0046620 3300049742 Bacteria 4034
580 Ga0501083_0007078 3300049744 Bacteria 7962
581 Ga0501035_0035114 3300049822 Bacteria 4551
582 Ga0501035_0048356 3300049822 Bacteria 3815
583 Ga0501035_0179042 3300049822 Bacteria 1827
584 Ga0501035_0227105 3300049822 Bacteria 1592
585 Ga0501035_0250020 3300049822 Bacteria 1506
586 Ga0501035_0334895 3300049822 Bacteria 1269
587 Ga0501035_0602242 3300049822 Bacteria 895
588 Ga0501044_0010468 3300049823 Bacteria 10063
589 Ga0501044_0011729 3300049823 Bacteria 9492
590 Ga0501044_0011825 3300049823 Bacteria 9456
591 Ga0501044_0045099 3300049823 Bacteria 4571
592 Ga0501044_0064552 3300049823 Bacteria 3737
593 Ga0501044_0078050 3300049823 Bacteria 3356
594 Ga0501044_0122272 3300049823 Bacteria 2602
595 Ga0501044_0174836 3300049823 Bacteria 2117
596 Ga0501044_0186816 3300049823 Bacteria 2036
597 Ga0501044_0448254 3300049823 Bacteria 1197
598 Ga0501044_0509651 3300049823 Bacteria 1103
599 Ga0501045_0017787 3300049824 Bacteria 5048
600 Ga0501045_0118231 3300049824 Bacteria 1967
601 Ga0501045_0174387 3300049824 Bacteria 1602
602 nmdc:mga03n38_14218_c1 3300050490 Bacteria 3044
603 nmdc:mga03n38_166880_c1 3300050490 Bacteria 1118
604 nmdc:mga06z11_12423_c1 3300050494 Bacteria 3704
605 nmdc:mga07m45_152927_c1 3300050496 Bacteria 1338
606 Ga0495601_0190628 3300053077 Bacteria 1340
607 Ga0500578_0074757 3300053086 Bacteria 2158
608 Ga0500578_0101155 3300053086 Bacteria 1824
609 Ga0500643_157121 3300053087 Bacteria 610
610 Ga0500583_0138571 3300053092 Bacteria 1208
611 Ga0500566_0186833 3300053094 Bacteria 1058
612 Ga0500640_020336 3300053095 Bacteria 2852
613 Ga0500641_0203838 3300053096 Bacteria 843
614 Ga0500641_0313674 3300053096 Bacteria 640
615 Ga0500654_129155 3300053099 Bacteria 963
616 Ga0500660_144907 3300053100 Bacteria 935
617 Ga0500553_214185 3300053101 Bacteria 638
618 Ga0500556_0180274 3300053104 Bacteria 835
619 Ga0500557_178373 3300053105 Bacteria 691
620 Ga0500560_003059 3300053107 Bacteria 3317
621 Ga0500560_004466 3300053107 Bacteria 2981
622 Ga0500560_035928 3300053107 Bacteria 1528
623 Ga0500569_084559 3300053109 Bacteria 1019
624 Ga0500572_046699 3300053111 Bacteria 1277
625 Ga0500614_066134 3300053123 Bacteria 982
626 Ga0500614_100091 3300053123 Bacteria 835
627 Ga0500628_091356 3300053129 Bacteria 793
628 Ga0500652_050659 3300053131 Bacteria 1694
629 Ga0500658_0014745 3300053134 Bacteria 2894
630 Ga0500561_0102750 3300053137 Bacteria 857
631 Ga0500568_0267803 3300053139 Bacteria 621
632 Ga0500573_0033239 3300053140 Bacteria 2977
633 Ga0500573_0052189 3300053140 Bacteria 2351
634 Ga0500573_0306925 3300053140 Bacteria 790
635 Ga0500588_0080447 3300053146 Bacteria 1089
636 Ga0500589_325700 3300053147 Bacteria 535
637 Ga0500600_0004613 3300053149 Bacteria 8101
638 Ga0500600_0122439 3300053149 Bacteria 1338
639 Ga0500616_0012533 3300053153 Bacteria 4958
640 Ga0500633_0019571 3300053160 Bacteria 2026
641 Ga0500633_0118032 3300053160 Bacteria 986
642 Ga0500634_0096496 3300053161 Bacteria 1488
643 Ga0500636_0304403 3300053177 Bacteria 783
644 Ga0500656_008315 3300053732 Bacteria 1098
645 Ga0500587_012775 3300053739 Bacteria 1058
646 Ga0501084_0006017 3300054114 Bacteria 9975
647 Ga0501082_0174901 3300060353 Bacteria 1867
648 Ga0466962_0000163 3300061719 Bacteria 28323
649 Ga0466962_0011589 3300061719 Bacteria 4246
650 Ga0466962_0249241 3300061719 Bacteria 872
651 Ga0530510_0296286 3300061734 Bacteria 1210

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300010375 Ga0105239_11253092 Ga0105239_112530921 146
2 3300049586 Ga0501070_1324685 Ga0501070_1324685_85_534 146
3 iso_pu_bacteria 2862290372 2862294501 149
4 iso_pu_bacteria 2877676314 2877680759 149
5 iso_pu_bacteria 2984576629 2984576915 149
6 iso_pu_bacteria 2990256926 2990258662 149
7 iso_pu_bacteria 3006321560 3006325610 149
8 iso_pu_bacteria 8054609563 8054610322 149
9 iso_pu_bacteria 8056207758 8056210357 149
10 iso_pu_bacteria 2863404153 2863404226 150
11 iso_pu_bacteria 2867369537 2867370525 150
12 3300005548 Ga0070665_100304078 Ga0070665_1003040782 151
13 3300028379 Ga0268266_11488576 Ga0268266_114885762 151
14 iso_pu_bacteria 2643221548 2643763057 151
15 iso_pu_bacteria 2643221682 2644464085 151
16 iso_pu_bacteria 2767802112 2768646205 151
17 iso_pu_bacteria 2862705112 2862709410 151
18 iso_pu_bacteria 2867346516 2867350585 151
19 iso_pu_bacteria 2867428634 2867433671 151
20 iso_pu_bacteria 2919446982 2919450529 151
21 iso_pu_bacteria 2990044586 2990049137 151
22 iso_pu_bacteria 3006393351 3006397422 151
23 iso_pu_bacteria 8008485437 8008489956 151
24 iso_pu_bacteria 8008574985 8008578592 151
25 iso_pu_bacteria 8025524527 8025529311 151
26 3300041498 Ga0451841_0983366 Ga0451841_0983366_31_489 152
27 iso_pu_bacteria 2547132111 2547405984 152
28 iso_pu_bacteria 2582581312 2585300259 152
29 iso_pu_bacteria 2582581313 2585311016 152
30 iso_pu_bacteria 2582581314 2585314449 152
31 iso_pu_bacteria 2616644814 2616700252 152
32 iso_pu_bacteria 2643221578 2643900037 152
33 iso_pu_bacteria 2643221647 2644262970 152
34 iso_pu_bacteria 2643221673 2644405739 152
35 iso_pu_bacteria 2643221678 2644443193 152
36 iso_pu_bacteria 2643221714 2644626992 152
37 iso_pu_bacteria 2784132148 2784588922 152
38 iso_pu_bacteria 2784746768 2785369872 152
39 iso_pu_bacteria 2786546132 2786670952 152
40 iso_pu_bacteria 2791355406 2793980905 152
41 iso_pu_bacteria 2808606359 2808842366 152
42 iso_pu_bacteria 2808606375 2808920890 152
43 iso_pu_bacteria 2808606448 2809232541 152
44 iso_pu_bacteria 2811994879 2812357736 152
45 iso_pu_bacteria 2811994917 2812480223 152
46 iso_pu_bacteria 2818991463 2819697219 152
47 iso_pu_bacteria 2852635781 2852637141 152
48 iso_pu_bacteria 2862281513 2862285988 152
49 iso_pu_bacteria 2862382967 2862389625 152
50 iso_pu_bacteria 2862507626 2862508027 152
51 iso_pu_bacteria 2862574272 2862578925 152
52 iso_pu_bacteria 2867475112 2867481258 152
53 iso_pu_bacteria 2875391855 2875395277 152
54 iso_pu_bacteria 2912715099 2912719496 152
55 iso_pu_bacteria 2912723979 2912731346 152
56 iso_pu_bacteria 2912757875 2912761186 152
57 iso_pu_bacteria 2919468124 2919471957 152
58 iso_pu_bacteria 2946045630 2946049612 152
59 iso_pu_bacteria 2946064051 2946068135 152
60 iso_pu_bacteria 2946072368 2946076225 152
61 iso_pu_bacteria 2947224130 2947228804 152
62 iso_pu_bacteria 2954002825 2954006731 152
63 iso_pu_bacteria 2954380949 2954385865 152
64 iso_pu_bacteria 2954673503 2954677278 152
65 iso_pu_bacteria 2954682443 2954686874 152
66 iso_pu_bacteria 2954691527 2954696524 152
67 iso_pu_bacteria 2954701450 2954705762 152
68 iso_pu_bacteria 2954711539 2954715886 152
69 iso_pu_bacteria 2954721474 2954725808 152
70 iso_pu_bacteria 2954731030 2954735994 152
71 iso_pu_bacteria 2954740390 2954744763 152
72 iso_pu_bacteria 2954749733 2954754836 152
73 iso_pu_bacteria 2954759201 2954763725 152
74 iso_pu_bacteria 2966598605 2966602031 152
75 iso_pu_bacteria 2990059506 2990064994 152
76 iso_pu_bacteria 2997600082 2997606688 152
77 iso_pu_bacteria 3006493962 3006499308 152
78 iso_pu_bacteria 8008558824 8008566921 152
79 iso_pu_bacteria 8023623736 8023624051 152
80 iso_pu_bacteria 8025530807 8025534277 152
81 iso_pu_bacteria 8033684223 8033689086 152
82 iso_pu_bacteria 8047893842 8047899714 152
83 iso_pu_bacteria 8048127548 8048129004 152
84 iso_pu_bacteria 8048356638 8048359217 152
85 iso_pu_bacteria 8048369669 8048376662 152
86 iso_pu_bacteria 8048379754 8048385715 152
87 iso_pu_bacteria 8048406513 8048409467 152
88 iso_pu_bacteria 8054160619 8054163569 152
89 iso_pu_bacteria 8056829672 8056833347 152
90 3300003316 rootH1_10033732 rootH1_100337324 153
91 3300003322 rootL2_10210732 rootL2_102107322 153
92 3300003323 rootH1_10152422 rootH1_101524222 153
93 3300005458 Ga0070681_10359612 Ga0070681_103596121 153
94 3300014969 Ga0157376_10944088 Ga0157376_109440881 153
95 3300022467 Ga0224712_10241416 Ga0224712_102414161 153
96 3300025935 Ga0207709_10962978 Ga0207709_109629781 153
97 3300028794 Ga0307515_10581538 Ga0307515_105815382 153
98 3300030521 Ga0307511_10248197 Ga0307511_102481971 153
99 3300031616 Ga0307508_10724499 Ga0307508_107244991 153
100 3300033180 Ga0307510_10494631 Ga0307510_104946311 153
101 3300041494 Ga0451837_0989560 Ga0451837_0989560_706_1167 153
102 3300046454 Ga0495592_0086204 Ga0495592_0086204_741_1202 153
103 3300046459 Ga0495629_0016632 Ga0495629_0016632_3587_4048 153
104 3300046459 Ga0495629_0317301 Ga0495629_0317301_235_696 153
105 3300046492 Ga0495585_0007936 Ga0495585_0007936_5730_6191 153
106 3300046492 Ga0495585_0088060 Ga0495585_0088060_441_902 153
107 3300046501 Ga0495607_0095114 Ga0495607_0095114_738_1199 153
108 3300046513 Ga0495616_0334252 Ga0495616_0334252_67_528 153
109 3300046515 Ga0495620_0057291 Ga0495620_0057291_1152_1613 153
110 3300046526 Ga0495666_0488619 Ga0495666_0488619_54_515 153
111 3300046528 Ga0495642_0204514 Ga0495642_0204514_130_591 153
112 3300046529 Ga0495652_0018776 Ga0495652_0018776_5148_5609 153
113 3300046533 Ga0495640_0005132 Ga0495640_0005132_7061_7522 153
114 3300046538 Ga0495609_0037075 Ga0495609_0037075_216_677 153
115 3300046642 Ga0495634_0036930 Ga0495634_0036930_501_962 153
116 3300046660 Ga0495625_0139786 Ga0495625_0139786_544_1005 153
117 3300046675 Ga0495657_0289018 Ga0495657_0289018_41_502 153
118 3300046689 Ga0495613_0391034 Ga0495613_0391034_459_920 153
119 3300046691 Ga0495670_0106878 Ga0495670_0106878_918_1379 153
120 3300046692 Ga0495671_0058976 Ga0495671_0058976_913_1374 153
121 3300046794 Ga0495589_0072839 Ga0495589_0072839_449_910 153
122 3300047317 Ga0495604_0017363 Ga0495604_0017363_5238_5699 153
123 3300047317 Ga0495604_0206185 Ga0495604_0206185_499_960 153
124 3300047318 Ga0495636_0296473 Ga0495636_0296473_130_591 153
125 3300047321 Ga0495676_0024429 Ga0495676_0024429_546_1007 153
126 3300047323 Ga0495683_0012497 Ga0495683_0012497_2722_3183 153
127 3300047447 Ga0495685_008344 Ga0495685_008344_789_1250 153
128 3300049568 Ga0501031_0028807 Ga0501031_0028807_1153_1614 153
129 3300049568 Ga0501031_0048382 Ga0501031_0048382_2218_2679 153
130 3300049568 Ga0501031_0162913 Ga0501031_0162913_802_1263 153
131 3300049569 Ga0501032_0004893 Ga0501032_0004893_2632_3093 153
132 3300049569 Ga0501032_0019559 Ga0501032_0019559_4264_4725 153
133 3300049569 Ga0501032_0031825 Ga0501032_0031825_2528_2989 153
134 3300049570 Ga0501033_0012983 Ga0501033_0012983_133_594 153
135 3300049570 Ga0501033_0630213 Ga0501033_0630213_184_645 153
136 3300049571 Ga0501034_0027444 Ga0501034_0027444_392_853 153
137 3300049571 Ga0501034_1252451 Ga0501034_1252451_92_553 153
138 3300049572 Ga0501036_0071114 Ga0501036_0071114_2392_2853 153
139 3300049572 Ga0501036_0110506 Ga0501036_0110506_615_1076 153
140 3300049573 Ga0501037_0008710 Ga0501037_0008710_2056_2517 153
141 3300049573 Ga0501037_0037533 Ga0501037_0037533_51_512 153
142 3300049573 Ga0501037_0051209 Ga0501037_0051209_472_933 153
143 3300049574 Ga0501038_0068534 Ga0501038_0068534_2023_2484 153
144 3300049574 Ga0501038_0752872 Ga0501038_0752872_17_478 153
145 3300049575 Ga0501039_0008768 Ga0501039_0008768_3100_3561 153
146 3300049575 Ga0501039_0123269 Ga0501039_0123269_1482_1943 153
147 3300049576 Ga0501040_0032809 Ga0501040_0032809_2520_2981 153
148 3300049577 Ga0501041_0016821 Ga0501041_0016821_2709_3170 153
149 3300049578 Ga0501042_0046275 Ga0501042_0046275_249_710 153
150 3300049578 Ga0501042_0437498 Ga0501042_0437498_457_918 153
151 3300049579 Ga0501043_0006511 Ga0501043_0006511_7912_8373 153
152 3300049579 Ga0501043_0027864 Ga0501043_0027864_3287_3748 153
153 3300049579 Ga0501043_0142473 Ga0501043_0142473_1213_1674 153
154 3300049580 Ga0501046_0111282 Ga0501046_0111282_392_853 153
155 3300049581 Ga0501047_0030243 Ga0501047_0030243_4006_4467 153
156 3300049581 Ga0501047_0118676 Ga0501047_0118676_820_1281 153
157 3300049581 Ga0501047_0169834 Ga0501047_0169834_599_1060 153
158 3300049581 Ga0501047_0189979 Ga0501047_0189979_842_1303 153
159 3300049581 Ga0501047_0490974 Ga0501047_0490974_35_496 153
160 3300049582 Ga0501048_0037511 Ga0501048_0037511_2006_2467 153
161 3300049583 Ga0501067_0010603 Ga0501067_0010603_4258_4719 153
162 3300049584 Ga0501068_0074920 Ga0501068_0074920_446_907 153
163 3300049585 Ga0501069_0004549 Ga0501069_0004549_6621_7082 153
164 3300049586 Ga0501070_0049737 Ga0501070_0049737_1014_1475 153
165 3300049586 Ga0501070_0183686 Ga0501070_0183686_629_1090 153
166 3300049587 Ga0501071_0013450 Ga0501071_0013450_5028_5489 153
167 3300049588 Ga0501072_0005819 Ga0501072_0005819_3717_4178 153
168 3300049589 Ga0501073_0009815 Ga0501073_0009815_4702_5163 153
169 3300049590 Ga0501074_0325926 Ga0501074_0325926_249_710 153
170 3300049593 Ga0501077_0054792 Ga0501077_0054792_1500_1961 153
171 3300049741 Ga0501079_0008914 Ga0501079_0008914_4743_5204 153
172 3300049742 Ga0501080_0046620 Ga0501080_0046620_1610_2071 153
173 3300049744 Ga0501083_0007078 Ga0501083_0007078_5141_5602 153
174 3300049822 Ga0501035_0035114 Ga0501035_0035114_1199_1660 153
175 3300049822 Ga0501035_0179042 Ga0501035_0179042_1124_1585 153
176 3300049822 Ga0501035_0250020 Ga0501035_0250020_266_727 153
177 3300049823 Ga0501044_0064552 Ga0501044_0064552_1611_2072 153
178 3300049823 Ga0501044_0122272 Ga0501044_0122272_1181_1642 153
179 3300049823 Ga0501044_0174836 Ga0501044_0174836_220_681 153
180 3300049823 Ga0501044_0186816 Ga0501044_0186816_1184_1645 153
181 3300049824 Ga0501045_0017787 Ga0501045_0017787_2520_2981 153
182 3300049824 Ga0501045_0118231 Ga0501045_0118231_1266_1727 153
183 3300054114 Ga0501084_0006017 Ga0501084_0006017_3066_3527 153
184 3300060353 Ga0501082_0174901 Ga0501082_0174901_376_837 153
185 3300061734 Ga0530510_0296286 Ga0530510_0296286_286_747 153
186 3300005366 Ga0070659_100618232 Ga0070659_1006182321 154
187 3300005456 Ga0070678_100978085 Ga0070678_1009780852 154
188 3300005539 Ga0068853_100104923 Ga0068853_1001049234 154
189 3300005563 Ga0068855_100023062 Ga0068855_1000230627 154
190 3300005577 Ga0068857_100269982 Ga0068857_1002699821 154
191 3300005614 Ga0068856_100010663 Ga0068856_1000106637 154
192 3300005615 Ga0070702_100991800 Ga0070702_1009918002 154
193 3300005616 Ga0068852_100001014 Ga0068852_10000101411 154
194 3300009093 Ga0105240_10076356 Ga0105240_100763565 154
195 3300009093 Ga0105240_10907819 Ga0105240_109078192 154
196 3300009174 Ga0105241_10001341 Ga0105241_1000134113 154
197 3300010375 Ga0105239_10014936 Ga0105239_100149363 154
198 3300010375 Ga0105239_11323169 Ga0105239_113231692 154
199 3300013308 Ga0157375_12561578 Ga0157375_125615781 154
200 3300014326 Ga0157380_10600838 Ga0157380_106008382 154
201 3300022467 Ga0224712_10045281 Ga0224712_100452812 154
202 3300025911 Ga0207654_10009813 Ga0207654_100098132 154
203 3300025913 Ga0207695_10004099 Ga0207695_100040993 154
204 3300025914 Ga0207671_10000128 Ga0207671_10000128108 154
205 3300025924 Ga0207694_10207057 Ga0207694_102070572 154
206 3300025949 Ga0207667_10055281 Ga0207667_100552813 154
207 3300025981 Ga0207640_10379866 Ga0207640_103798661 154
208 3300026041 Ga0207639_10085880 Ga0207639_100858804 154
209 3300026075 Ga0207708_10312671 Ga0207708_103126712 154
210 3300026078 Ga0207702_10249966 Ga0207702_102499662 154
211 3300026116 Ga0207674_10947892 Ga0207674_109478921 154
212 3300026118 Ga0207675_100068085 Ga0207675_1000680851 154
213 3300026121 Ga0207683_11356060 Ga0207683_113560602 154
214 3300026142 Ga0207698_10349870 Ga0207698_103498702 154
215 3300028379 Ga0268266_10179042 Ga0268266_101790422 154
216 3300031995 Ga0307409_100119570 Ga0307409_1001195703 154
217 3300032005 Ga0307411_10634545 Ga0307411_106345452 154
218 3300037312 Ga0395899_0580091 Ga0395899_0580091_204_668 154
219 3300037418 Ga0395900_0179671 Ga0395900_0179671_1239_1703 154
220 3300037466 Ga0395898_0001397 Ga0395898_0001397_13917_14381 154
221 3300038443 Ga0395901_0078391 Ga0395901_0078391_770_1234 154
222 3300041453 Ga0451797_0889241 Ga0451797_0889241_278_742 154
223 3300044656 Ga0466969_0005631 Ga0466969_0005631_2726_3190 154
224 3300044693 Ga0466961_0034399 Ga0466961_0034399_1678_2142 154
225 3300044693 Ga0466961_0062799 Ga0466961_0062799_1385_1849 154
226 3300044765 Ga0466970_0016652 Ga0466970_0016652_35_499 154
227 3300045836 Ga0466958_0136775 Ga0466958_0136775_878_1342 154
228 3300046462 Ga0495651_0001478 Ga0495651_0001478_17164_17628 154
229 3300046516 Ga0495628_0006091 Ga0495628_0006091_194_658 154
230 3300046529 Ga0495652_0002292 Ga0495652_0002292_18813_19277 154
231 3300046809 Ga0495600_0004676 Ga0495600_0004676_5462_5926 154
232 3300047315 Ga0495581_0389546 Ga0495581_0389546_261_725 154
233 3300047317 Ga0495604_0409596 Ga0495604_0409596_144_608 154
234 3300049568 Ga0501031_0047522 Ga0501031_0047522_1230_1694 154
235 3300049570 Ga0501033_0203535 Ga0501033_0203535_362_826 154
236 3300049571 Ga0501034_0027409 Ga0501034_0027409_1826_2290 154
237 3300049574 Ga0501038_0010841 Ga0501038_0010841_5902_6366 154
238 3300049575 Ga0501039_0512505 Ga0501039_0512505_14_478 154
239 3300049575 Ga0501039_0515784 Ga0501039_0515784_14_478 154
240 3300049579 Ga0501043_0008928 Ga0501043_0008928_2902_3366 154
241 3300049581 Ga0501047_0002783 Ga0501047_0002783_8112_8576 154
242 3300049823 Ga0501044_0011729 Ga0501044_0011729_6154_6618 154
243 3300053077 Ga0495601_0190628 Ga0495601_0190628_743_1207 154
244 3300053140 Ga0500573_0306925 Ga0500573_0306925_188_652 154
245 iso_pu_bacteria 2990088156 2990092272 154
246 3300005539 Ga0068853_101139383 Ga0068853_1011393831 155
247 3300009148 Ga0105243_12657826 Ga0105243_126578261 155
248 3300014497 Ga0182008_10002267 Ga0182008_100022675 155
249 3300015262 Ga0182007_10004465 Ga0182007_100044653 155
250 3300025927 Ga0207687_10076420 Ga0207687_100764202 155
251 3300026041 Ga0207639_10176724 Ga0207639_101767242 155
252 3300028794 Ga0307515_10000928 Ga0307515_1000092850 155
253 3300030521 Ga0307511_10000945 Ga0307511_1000094533 155
254 3300030521 Ga0307511_10057234 Ga0307511_100572342 155
255 3300030522 Ga0307512_10240452 Ga0307512_102404522 155
256 3300030744 Ga0316181_1127688 Ga0316181_11276881 155
257 3300031507 Ga0307509_10076738 Ga0307509_100767382 155
258 3300031507 Ga0307509_10252668 Ga0307509_102526682 155
259 3300031616 Ga0307508_10022735 Ga0307508_100227352 155
260 3300031616 Ga0307508_10198007 Ga0307508_101980072 155
261 3300031649 Ga0307514_10208235 Ga0307514_102082351 155
262 3300031665 Ga0316575_10051119 Ga0316575_100511193 155
263 3300031730 Ga0307516_10144310 Ga0307516_101443102 155
264 3300031838 Ga0307518_10271488 Ga0307518_102714881 155
265 3300033179 Ga0307507_10017128 Ga0307507_100171284 155
266 3300033179 Ga0307507_10028020 Ga0307507_100280205 155
267 3300033180 Ga0307510_10041179 Ga0307510_100411793 155
268 3300033180 Ga0307510_10121601 Ga0307510_101216013 155
269 3300033180 Ga0307510_10219680 Ga0307510_102196801 155
270 3300038443 Ga0395901_0096424 Ga0395901_0096424_1742_2209 155
271 3300041406 Ga0439439_0066166 Ga0439439_0066166_480_947 155
272 3300042007 Ga0439449_0084120 Ga0439449_0084120_556_1023 155
273 3300042131 Ga0450894_000065 Ga0450894_000065_2687_3157 155
274 3300042132 Ga0450895_005044 Ga0450895_005044_11_481 155
275 3300042133 Ga0450896_001817 Ga0450896_001817_926_1396 155
276 3300042134 Ga0450898_005535 Ga0450898_005535_301_771 155
277 3300042135 Ga0450899_000511 Ga0450899_000511_3876_4346 155
278 3300042139 Ga0450904_013758 Ga0450904_013758_87_557 155
279 3300042145 Ga0450906_000844 Ga0450906_000844_526_996 155
280 3300042184 Ga0450908_032289 Ga0450908_032289_323_793 155
281 3300045976 Ga0466967_0016389 Ga0466967_0016389_4588_5055 155
282 3300045976 Ga0466967_0883424 Ga0466967_0883424_316_786 155
283 3300046454 Ga0495592_0159822 Ga0495592_0159822_862_1329 155
284 3300046459 Ga0495629_0015401 Ga0495629_0015401_668_1135 155
285 3300046462 Ga0495651_0101094 Ga0495651_0101094_1450_1917 155
286 3300046476 Ga0495662_0000395 Ga0495662_0000395_6195_6662 155
287 3300046477 Ga0495664_0004484 Ga0495664_0004484_178_645 155
288 3300046514 Ga0495618_0041048 Ga0495618_0041048_2262_2729 155
289 3300046516 Ga0495628_0287576 Ga0495628_0287576_70_537 155
290 3300046517 Ga0495630_0076146 Ga0495630_0076146_1079_1546 155
291 3300046518 Ga0495631_0150477 Ga0495631_0150477_68_535 155
292 3300046524 Ga0495648_0219270 Ga0495648_0219270_12_479 155
293 3300046529 Ga0495652_0690736 Ga0495652_0690736_121_588 155
294 3300046533 Ga0495640_0170785 Ga0495640_0170785_894_1361 155
295 3300046535 Ga0495586_0041897 Ga0495586_0041897_1263_1730 155
296 3300046543 Ga0495645_0017508 Ga0495645_0017508_2251_2718 155
297 3300046559 Ga0495667_0144260 Ga0495667_0144260_983_1450 155
298 3300046642 Ga0495634_0027789 Ga0495634_0027789_1840_2307 155
299 3300046660 Ga0495625_0027694 Ga0495625_0027694_307_774 155
300 3300046663 Ga0495635_0000602 Ga0495635_0000602_21192_21659 155
301 3300046675 Ga0495657_0002328 Ga0495657_0002328_7156_7623 155
302 3300046680 Ga0495646_0000580 Ga0495646_0000580_16879_17346 155
303 3300046683 Ga0495658_0087961 Ga0495658_0087961_734_1201 155
304 3300046689 Ga0495613_0001160 Ga0495613_0001160_8449_8916 155
305 3300046692 Ga0495671_0007931 Ga0495671_0007931_2003_2470 155
306 3300047315 Ga0495581_0017554 Ga0495581_0017554_1870_2337 155
307 3300047317 Ga0495604_0000226 Ga0495604_0000226_45977_46444 155
308 3300047319 Ga0495674_0041092 Ga0495674_0041092_1560_2027 155
309 3300047321 Ga0495676_0018192 Ga0495676_0018192_311_778 155
310 3300047443 Ga0495687_028005 Ga0495687_028005_1270_1737 155
311 3300047444 Ga0495675_0043171 Ga0495675_0043171_1875_2342 155
312 3300047445 Ga0495677_0319884 Ga0495677_0319884_33_500 155
313 3300047470 Ga0495681_0004063 Ga0495681_0004063_2524_2991 155
314 3300047472 Ga0495686_0124692 Ga0495686_0124692_37_504 155
315 3300047673 Ga0495593_0003706 Ga0495593_0003706_3290_3757 155
316 3300048088 Ga0495602_0018549 Ga0495602_0018549_171_638 155
317 3300048089 Ga0495614_0032643 Ga0495614_0032643_1750_2217 155
318 3300048903 Ga0496100_0551341 Ga0496100_0551341_388_855 155
319 3300049568 Ga0501031_0591754 Ga0501031_0591754_75_542 155
320 3300049569 Ga0501032_0019445 Ga0501032_0019445_2495_2962 155
321 3300049571 Ga0501034_0104840 Ga0501034_0104840_1412_1879 155
322 3300049571 Ga0501034_0160144 Ga0501034_0160144_1119_1595 155
323 3300049572 Ga0501036_0152940 Ga0501036_0152940_623_1090 155
324 3300049573 Ga0501037_0041679 Ga0501037_0041679_2877_3353 155
325 3300049573 Ga0501037_0261434 Ga0501037_0261434_484_951 155
326 3300049574 Ga0501038_0004798 Ga0501038_0004798_5454_5921 155
327 3300049578 Ga0501042_0734049 Ga0501042_0734049_50_517 155
328 3300049579 Ga0501043_0190454 Ga0501043_0190454_194_661 155
329 3300049579 Ga0501043_0475831 Ga0501043_0475831_340_816 155
330 3300049580 Ga0501046_0134751 Ga0501046_0134751_1125_1601 155
331 3300049581 Ga0501047_0011970 Ga0501047_0011970_5432_5899 155
332 3300049581 Ga0501047_0255805 Ga0501047_0255805_351_827 155
333 3300049586 Ga0501070_0213894 Ga0501070_0213894_1035_1502 155
334 3300049589 Ga0501073_0125795 Ga0501073_0125795_659_1126 155
335 3300049742 Ga0501080_0043441 Ga0501080_0043441_2729_3196 155
336 3300049822 Ga0501035_0334895 Ga0501035_0334895_483_959 155
337 3300049822 Ga0501035_0602242 Ga0501035_0602242_16_483 155
338 3300049823 Ga0501044_0078050 Ga0501044_0078050_1031_1507 155
339 3300049823 Ga0501044_0448254 Ga0501044_0448254_301_768 155
340 3300049823 Ga0501044_0509651 Ga0501044_0509651_315_782 155
341 3300053095 Ga0500640_020336 Ga0500640_020336_937_1404 155
342 3300053107 Ga0500560_003059 Ga0500560_003059_2827_3294 155
343 3300053111 Ga0500572_046699 Ga0500572_046699_248_715 155
344 3300053123 Ga0500614_100091 Ga0500614_100091_31_498 155
345 3300053140 Ga0500573_0052189 Ga0500573_0052189_310_777 155
346 3300053160 Ga0500633_0118032 Ga0500633_0118032_468_935 155
347 3300001989 JGI24739J22299_10022997 JGI24739J22299_100229972 156
348 3300001990 JGI24737J22298_10070152 JGI24737J22298_100701522 156
349 3300002067 JGI24735J21928_10045118 JGI24735J21928_100451181 156
350 3300002075 JGI24738J21930_10047408 JGI24738J21930_100474081 156
351 3300003215 JGI25153J46596_10049885 JGI25153J46596_100498852 156
352 3300003316 rootH1_10033733 rootH1_100337332 156
353 3300003322 rootL2_10041240 rootL2_100412405 156
354 3300003323 rootH1_10123303 rootH1_101233033 156
355 3300003354 JGI25160J50197_1047075 JGI25160J50197_10470751 156
356 3300003578 Ga0006562J51391_1050546 Ga0006562J51391_10505464 156
357 3300003578 Ga0006562J51391_1050549 Ga0006562J51391_10505492 156
358 3300003578 Ga0006562J51391_1061896 Ga0006562J51391_10618962 156
359 3300005548 Ga0070665_100330676 Ga0070665_1003306762 156
360 3300005564 Ga0070664_100072581 Ga0070664_1000725813 156
361 3300005614 Ga0068856_100415826 Ga0068856_1004158262 156
362 3300005937 Ga0081455_10365355 Ga0081455_103653552 156
363 3300006048 Ga0075363_100076247 Ga0075363_1000762472 156
364 3300006048 Ga0075363_100087882 Ga0075363_1000878822 156
365 3300006048 Ga0075363_100201209 Ga0075363_1002012092 156
366 3300006353 Ga0075370_10084253 Ga0075370_100842532 156
367 3300006948 Ga0099826_10388104 Ga0099826_103881042 156
368 3300009092 Ga0105250_10175887 Ga0105250_101758871 156
369 3300009098 Ga0105245_10241199 Ga0105245_102411991 156
370 3300009098 Ga0105245_10328955 Ga0105245_103289552 156
371 3300009148 Ga0105243_10956558 Ga0105243_109565582 156
372 3300009176 Ga0105242_10517223 Ga0105242_105172232 156
373 3300009177 Ga0105248_10106466 Ga0105248_101064663 156
374 3300009551 Ga0105238_10709397 Ga0105238_107093972 156
375 3300009553 Ga0105249_11659376 Ga0105249_116593761 156
376 3300010375 Ga0105239_11665290 Ga0105239_116652902 156
377 3300010375 Ga0105239_12481449 Ga0105239_124814491 156
378 3300011119 Ga0105246_10000030 Ga0105246_100000308 156
379 3300011119 Ga0105246_10135778 Ga0105246_101357783 156
380 3300011119 Ga0105246_10476239 Ga0105246_104762391 156
381 3300013105 Ga0157369_10065387 Ga0157369_100653873 156
382 3300013296 Ga0157374_10365857 Ga0157374_103658571 156
383 3300013307 Ga0157372_10102885 Ga0157372_101028852 156
384 3300015688 Ga0183367_1008 Ga0183367_1008366 156
385 3300025297 Ga0209758_1008765 Ga0209758_10087655 156
386 3300025302 Ga0207426_1001637 Ga0207426_10016376 156
387 3300025302 Ga0207426_1003477 Ga0207426_10034778 156
388 3300025302 Ga0207426_1004228 Ga0207426_10042287 156
389 3300025302 Ga0207426_1010421 Ga0207426_10104212 156
390 3300025302 Ga0207426_1018541 Ga0207426_10185414 156
391 3300025903 Ga0207680_10540608 Ga0207680_105406082 156
392 3300025904 Ga0207647_10015752 Ga0207647_100157524 156
393 3300025927 Ga0207687_10049131 Ga0207687_100491312 156
394 3300025933 Ga0207706_10090638 Ga0207706_100906387 156
395 3300025941 Ga0207711_10279927 Ga0207711_102799272 156
396 3300025945 Ga0207679_10025198 Ga0207679_100251988 156
397 3300026035 Ga0207703_10277085 Ga0207703_102770852 156
398 3300026067 Ga0207678_10023248 Ga0207678_100232488 156
399 3300026078 Ga0207702_10269079 Ga0207702_102690792 156
400 3300027312 Ga0209371_1013135 Ga0209371_10131353 156
401 3300027666 Ga0209282_1270904 Ga0209282_12709042 156
402 3300027866 Ga0209813_10024039 Ga0209813_100240393 156
403 3300028379 Ga0268266_10279799 Ga0268266_102797992 156
404 3300028794 Ga0307515_10437980 Ga0307515_104379801 156
405 3300030500 Ga0268256_1014405 Ga0268256_10144051 156
406 3300030521 Ga0307511_10205780 Ga0307511_102057801 156
407 3300030522 Ga0307512_10012951 Ga0307512_100129516 156
408 3300031456 Ga0307513_10003927 Ga0307513_1000392715 156
409 3300031456 Ga0307513_10072221 Ga0307513_100722213 156
410 3300031456 Ga0307513_10116156 Ga0307513_101161562 156
411 3300031507 Ga0307509_10022630 Ga0307509_100226304 156
412 3300031507 Ga0307509_10605991 Ga0307509_106059912 156
413 3300031548 Ga0307408_102085221 Ga0307408_1020852211 156
414 3300031616 Ga0307508_10002378 Ga0307508_100023789 156
415 3300031616 Ga0307508_10047622 Ga0307508_100476222 156
416 3300031616 Ga0307508_10077737 Ga0307508_100777372 156
417 3300031616 Ga0307508_10079919 Ga0307508_100799192 156
418 3300031649 Ga0307514_10018627 Ga0307514_100186273 156
419 3300031649 Ga0307514_10238643 Ga0307514_102386432 156
420 3300031649 Ga0307514_10345239 Ga0307514_103452392 156
421 3300031649 Ga0307514_10349345 Ga0307514_103493451 156
422 3300031649 Ga0307514_10356189 Ga0307514_103561892 156
423 3300031730 Ga0307516_10006477 Ga0307516_1000647710 156
424 3300031730 Ga0307516_10240442 Ga0307516_102404422 156
425 3300031730 Ga0307516_10356750 Ga0307516_103567502 156
426 3300031838 Ga0307518_10058932 Ga0307518_100589324 156
427 3300031838 Ga0307518_10175432 Ga0307518_101754322 156
428 3300031852 Ga0307410_10067358 Ga0307410_100673583 156
429 3300031852 Ga0307410_10275437 Ga0307410_102754372 156
430 3300031995 Ga0307409_100037687 Ga0307409_1000376873 156
431 3300032002 Ga0307416_101709543 Ga0307416_1017095432 156
432 3300033180 Ga0307510_10085353 Ga0307510_100853531 156
433 3300037312 Ga0395899_0261655 Ga0395899_0261655_12_482 156
434 3300037418 Ga0395900_0424277 Ga0395900_0424277_19_489 156
435 3300037466 Ga0395898_0003880 Ga0395898_0003880_576_1046 156
436 3300037466 Ga0395898_0073658 Ga0395898_0073658_425_901 156
437 3300037471 Ga0395905_0365510 Ga0395905_0365510_826_1296 156
438 3300038443 Ga0395901_0105186 Ga0395901_0105186_652_1122 156
439 3300041404 Ga0439436_0003058 Ga0439436_0003058_3437_3907 156
440 3300041404 Ga0439436_0004048 Ga0439436_0004048_1768_2238 156
441 3300041406 Ga0439439_0008564 Ga0439439_0008564_1297_1767 156
442 3300041443 Ga0451789_1138150 Ga0451789_1138150_28_498 156
443 3300041486 Ga0451807_2473932 Ga0451807_2473932_234_707 156
444 3300041503 Ga0451847_0832006 Ga0451847_0832006_143_613 156
445 3300041507 Ga0451851_0290026 Ga0451851_0290026_125_595 156
446 3300041507 Ga0451851_1377664 Ga0451851_1377664_57_530 156
447 3300041512 Ga0451853_0777276 Ga0451853_0777276_868_1341 156
448 3300041512 Ga0451853_2561483 Ga0451853_2561483_1183_1653 156
449 3300041999 Ga0439433_0000565 Ga0439433_0000565_3858_4328 156
450 3300041999 Ga0439433_0023848 Ga0439433_0023848_96_566 156
451 3300042002 Ga0439442_009075 Ga0439442_009075_579_1049 156
452 3300042002 Ga0439442_011672 Ga0439442_011672_1297_1767 156
453 3300042005 Ga0439448_0002231 Ga0439448_0002231_3115_3585 156
454 3300042006 Ga0439432_021300 Ga0439432_021300_352_822 156
455 3300042007 Ga0439449_0000841 Ga0439449_0000841_7619_8089 156
456 3300042014 Ga0439457_001497 Ga0439457_001497_2027_2497 156
457 3300042015 Ga0439462_0000959 Ga0439462_0000959_2473_2943 156
458 3300042127 Ga0450890_010016 Ga0450890_010016_295_765 156
459 3300042136 Ga0450900_004000 Ga0450900_004000_707_1177 156
460 3300042138 Ga0450903_000670 Ga0450903_000670_1887_2357 156
461 3300042157 Ga0439458_0000517 Ga0439458_0000517_1490_1960 156
462 3300042439 Ga0439464_0012340 Ga0439464_0012340_690_1160 156
463 3300044656 Ga0466969_0073532 Ga0466969_0073532_1158_1628 156
464 3300044658 Ga0466972_0001060 Ga0466972_0001060_9849_10322 156
465 3300044658 Ga0466972_0069299 Ga0466972_0069299_750_1220 156
466 3300044658 Ga0466972_0081032 Ga0466972_0081032_95_568 156
467 3300044658 Ga0466972_0295908 Ga0466972_0295908_256_729 156
468 3300044683 Ga0466965_0000312 Ga0466965_0000312_7238_7708 156
469 3300044683 Ga0466965_0014405 Ga0466965_0014405_3180_3653 156
470 3300044683 Ga0466965_0241500 Ga0466965_0241500_31_504 156
471 3300044684 Ga0466966_0001162 Ga0466966_0001162_5092_5565 156
472 3300044684 Ga0466966_0002783 Ga0466966_0002783_7957_8427 156
473 3300044693 Ga0466961_0002591 Ga0466961_0002591_2140_2610 156
474 3300044693 Ga0466961_0005840 Ga0466961_0005840_140_613 156
475 3300044693 Ga0466961_0035125 Ga0466961_0035125_1199_1672 156
476 3300044694 Ga0466963_0003115 Ga0466963_0003115_1478_1954 156
477 3300044694 Ga0466963_0165305 Ga0466963_0165305_82_555 156
478 3300044706 Ga0466964_0008956 Ga0466964_0008956_138_608 156
479 3300044706 Ga0466964_0039907 Ga0466964_0039907_1083_1556 156
480 3300044706 Ga0466964_0392880 Ga0466964_0392880_64_537 156
481 3300044719 Ga0466971_0000277 Ga0466971_0000277_589_1059 156
482 3300044719 Ga0466971_0015939 Ga0466971_0015939_2645_3118 156
483 3300044735 Ga0466968_0087204 Ga0466968_0087204_157_630 156
484 3300044765 Ga0466970_0000443 Ga0466970_0000443_11139_11609 156
485 3300044765 Ga0466970_0006602 Ga0466970_0006602_1533_2003 156
486 3300044765 Ga0466970_0057196 Ga0466970_0057196_57_530 156
487 3300044842 Ga0466957_0001357 Ga0466957_0001357_3710_4180 156
488 3300044901 Ga0466960_0266483 Ga0466960_0266483_28_498 156
489 3300045049 Ga0466959_0019009 Ga0466959_0019009_2038_2508 156
490 3300045836 Ga0466958_0118783 Ga0466958_0118783_1143_1616 156
491 3300045976 Ga0466967_0004534 Ga0466967_0004534_2889_3359 156
492 3300045976 Ga0466967_0006993 Ga0466967_0006993_2075_2545 156
493 3300045976 Ga0466967_0030987 Ga0466967_0030987_2791_3264 156
494 3300045976 Ga0466967_0210293 Ga0466967_0210293_49_525 156
495 3300046452 Ga0495617_007941 Ga0495617_007941_1023_1493 156
496 3300046453 Ga0495627_099664 Ga0495627_099664_268_738 156
497 3300046454 Ga0495592_0009032 Ga0495592_0009032_6678_7148 156
498 3300046455 Ga0495603_0000701 Ga0495603_0000701_17627_18097 156
499 3300046455 Ga0495603_0002941 Ga0495603_0002941_3374_3844 156
500 3300046455 Ga0495603_0004561 Ga0495603_0004561_5732_6202 156
501 3300046455 Ga0495603_0007883 Ga0495603_0007883_1588_2058 156
502 3300046455 Ga0495603_0025037 Ga0495603_0025037_2972_3442 156
503 3300046455 Ga0495603_0046323 Ga0495603_0046323_248_718 156
504 3300046455 Ga0495603_0627013 Ga0495603_0627013_63_533 156
505 3300046459 Ga0495629_0000808 Ga0495629_0000808_23709_24179 156
506 3300046459 Ga0495629_0008474 Ga0495629_0008474_6938_7408 156
507 3300046459 Ga0495629_0013998 Ga0495629_0013998_4509_4979 156
508 3300046459 Ga0495629_0030931 Ga0495629_0030931_1936_2406 156
509 3300046459 Ga0495629_0085598 Ga0495629_0085598_863_1333 156
510 3300046459 Ga0495629_0137419 Ga0495629_0137419_1046_1516 156
511 3300046460 Ga0495638_0110084 Ga0495638_0110084_762_1232 156
512 3300046460 Ga0495638_0175704 Ga0495638_0175704_154_624 156
513 3300046460 Ga0495638_0249774 Ga0495638_0249774_383_853 156
514 3300046461 Ga0495641_0186225 Ga0495641_0186225_239_709 156
515 3300046461 Ga0495641_0314772 Ga0495641_0314772_81_551 156
516 3300046474 Ga0495605_0005776 Ga0495605_0005776_2584_3054 156
517 3300046474 Ga0495605_0028277 Ga0495605_0028277_520_990 156
518 3300046476 Ga0495662_0009266 Ga0495662_0009266_3607_4077 156
519 3300046476 Ga0495662_0049855 Ga0495662_0049855_1167_1637 156
520 3300046477 Ga0495664_0061773 Ga0495664_0061773_1033_1503 156
521 3300046492 Ga0495585_0164620 Ga0495585_0164620_317_787 156
522 3300046492 Ga0495585_0281423 Ga0495585_0281423_249_719 156
523 3300046499 Ga0495594_0005254 Ga0495594_0005254_851_1321 156
524 3300046499 Ga0495594_0012424 Ga0495594_0012424_382_852 156
525 3300046499 Ga0495594_0016252 Ga0495594_0016252_1480_1950 156
526 3300046499 Ga0495594_0033179 Ga0495594_0033179_119_589 156
527 3300046499 Ga0495594_0069923 Ga0495594_0069923_179_649 156
528 3300046499 Ga0495594_0132329 Ga0495594_0132329_291_761 156
529 3300046499 Ga0495594_0231446 Ga0495594_0231446_57_527 156
530 3300046499 Ga0495594_0284825 Ga0495594_0284825_370_840 156
531 3300046500 Ga0495596_0049344 Ga0495596_0049344_434_904 156
532 3300046501 Ga0495607_0069566 Ga0495607_0069566_291_761 156
533 3300046506 Ga0495583_0060370 Ga0495583_0060370_1161_1631 156
534 3300046506 Ga0495583_0095732 Ga0495583_0095732_344_814 156
535 3300046506 Ga0495583_0171396 Ga0495583_0171396_178_648 156
536 3300046507 Ga0495606_0013342 Ga0495606_0013342_2949_3419 156
537 3300046511 Ga0495608_0528453 Ga0495608_0528453_199_669 156
538 3300046512 Ga0495610_0012935 Ga0495610_0012935_1916_2386 156
539 3300046513 Ga0495616_0002920 Ga0495616_0002920_9704_10174 156
540 3300046514 Ga0495618_0118360 Ga0495618_0118360_372_842 156
541 3300046515 Ga0495620_0005708 Ga0495620_0005708_1588_2058 156
542 3300046515 Ga0495620_0021552 Ga0495620_0021552_164_634 156
543 3300046516 Ga0495628_0037203 Ga0495628_0037203_3288_3758 156
544 3300046517 Ga0495630_0140144 Ga0495630_0140144_135_608 156
545 3300046518 Ga0495631_0005953 Ga0495631_0005953_4081_4551 156
546 3300046519 Ga0495632_0025647 Ga0495632_0025647_950_1420 156
547 3300046519 Ga0495632_0169047 Ga0495632_0169047_15_485 156
548 3300046520 Ga0495637_0131564 Ga0495637_0131564_297_767 156
549 3300046522 Ga0495643_0008008 Ga0495643_0008008_338_808 156
550 3300046522 Ga0495643_0008270 Ga0495643_0008270_5869_6339 156
551 3300046523 Ga0495644_0114281 Ga0495644_0114281_544_1014 156
552 3300046524 Ga0495648_0104392 Ga0495648_0104392_529_999 156
553 3300046524 Ga0495648_0267686 Ga0495648_0267686_103_573 156
554 3300046526 Ga0495666_0086076 Ga0495666_0086076_880_1350 156
555 3300046528 Ga0495642_0076710 Ga0495642_0076710_163_633 156
556 3300046529 Ga0495652_0226270 Ga0495652_0226270_177_647 156
557 3300046530 Ga0495654_0039808 Ga0495654_0039808_863_1333 156
558 3300046535 Ga0495586_0114791 Ga0495586_0114791_938_1408 156
559 3300046538 Ga0495609_0014264 Ga0495609_0014264_2174_2644 156
560 3300046542 Ga0495597_0065595 Ga0495597_0065595_574_1044 156
561 3300046543 Ga0495645_0156268 Ga0495645_0156268_573_1043 156
562 3300046557 Ga0495622_0007310 Ga0495622_0007310_1291_1761 156
563 3300046557 Ga0495622_0024271 Ga0495622_0024271_1334_1804 156
564 3300046558 Ga0495633_0033065 Ga0495633_0033065_1161_1631 156
565 3300046559 Ga0495667_0229274 Ga0495667_0229274_212_682 156
566 3300046615 Ga0495656_0553821 Ga0495656_0553821_129_599 156
567 3300046616 Ga0495668_0017571 Ga0495668_0017571_2933_3403 156
568 3300046616 Ga0495668_0024591 Ga0495668_0024591_2550_3020 156
569 3300046648 Ga0495611_0047056 Ga0495611_0047056_948_1418 156
570 3300046648 Ga0495611_0228764 Ga0495611_0228764_217_687 156
571 3300046660 Ga0495625_0043869 Ga0495625_0043869_388_858 156
572 3300046660 Ga0495625_0174059 Ga0495625_0174059_275_745 156
573 3300046660 Ga0495625_0411778 Ga0495625_0411778_357_827 156
574 3300046663 Ga0495635_0205053 Ga0495635_0205053_61_531 156
575 3300046663 Ga0495635_0224614 Ga0495635_0224614_764_1234 156
576 3300046665 Ga0495661_0012661 Ga0495661_0012661_4952_5422 156
577 3300046665 Ga0495661_0123762 Ga0495661_0123762_470_940 156
578 3300046674 Ga0495588_0001017 Ga0495588_0001017_100_570 156
579 3300046674 Ga0495588_0001932 Ga0495588_0001932_905_1375 156
580 3300046674 Ga0495588_0080786 Ga0495588_0080786_723_1193 156
581 3300046674 Ga0495588_0393200 Ga0495588_0393200_235_705 156
582 3300046675 Ga0495657_0029544 Ga0495657_0029544_3176_3646 156
583 3300046675 Ga0495657_0072892 Ga0495657_0072892_72_542 156
584 3300046679 Ga0495623_0513047 Ga0495623_0513047_30_500 156
585 3300046680 Ga0495646_0063836 Ga0495646_0063836_43_513 156
586 3300046683 Ga0495658_0103622 Ga0495658_0103622_240_710 156
587 3300046689 Ga0495613_0004327 Ga0495613_0004327_5126_5596 156
588 3300046689 Ga0495613_0017915 Ga0495613_0017915_1912_2382 156
589 3300046689 Ga0495613_0208155 Ga0495613_0208155_151_621 156
590 3300046689 Ga0495613_0254240 Ga0495613_0254240_32_502 156
591 3300046689 Ga0495613_0452794 Ga0495613_0452794_384_854 156
592 3300046689 Ga0495613_0644312 Ga0495613_0644312_24_494 156
593 3300046690 Ga0495624_0124203 Ga0495624_0124203_299_769 156
594 3300046690 Ga0495624_0432879 Ga0495624_0432879_291_761 156
595 3300046691 Ga0495670_0000768 Ga0495670_0000768_5617_6087 156
596 3300046691 Ga0495670_0066409 Ga0495670_0066409_704_1174 156
597 3300046691 Ga0495670_0452614 Ga0495670_0452614_138_608 156
598 3300046692 Ga0495671_0178769 Ga0495671_0178769_407_877 156
599 3300046694 Ga0495649_0024808 Ga0495649_0024808_2549_3019 156
600 3300046694 Ga0495649_0041202 Ga0495649_0041202_999_1469 156
601 3300046694 Ga0495649_0174306 Ga0495649_0174306_586_1056 156
602 3300046794 Ga0495589_0010936 Ga0495589_0010936_686_1156 156
603 3300046794 Ga0495589_0015889 Ga0495589_0015889_2555_3025 156
604 3300046794 Ga0495589_0110063 Ga0495589_0110063_184_654 156
605 3300046794 Ga0495589_0119531 Ga0495589_0119531_750_1220 156
606 3300046794 Ga0495589_0121734 Ga0495589_0121734_654_1124 156
607 3300046809 Ga0495600_0191492 Ga0495600_0191492_615_1085 156
608 3300046809 Ga0495600_0268036 Ga0495600_0268036_552_1022 156
609 3300046810 Ga0495660_0025579 Ga0495660_0025579_2530_3000 156
610 3300046810 Ga0495660_0116713 Ga0495660_0116713_760_1230 156
611 3300046810 Ga0495660_0123697 Ga0495660_0123697_16_486 156
612 3300047315 Ga0495581_0038486 Ga0495581_0038486_2270_2740 156
613 3300047315 Ga0495581_0340649 Ga0495581_0340649_34_504 156
614 3300047315 Ga0495581_0387340 Ga0495581_0387340_28_498 156
615 3300047317 Ga0495604_0002227 Ga0495604_0002227_14923_15396 156
616 3300047317 Ga0495604_0073508 Ga0495604_0073508_549_1019 156
617 3300047318 Ga0495636_0004207 Ga0495636_0004207_4990_5460 156
618 3300047318 Ga0495636_0036488 Ga0495636_0036488_634_1104 156
619 3300047318 Ga0495636_0041026 Ga0495636_0041026_702_1172 156
620 3300047318 Ga0495636_0063937 Ga0495636_0063937_201_671 156
621 3300047319 Ga0495674_0296435 Ga0495674_0296435_731_1201 156
622 3300047321 Ga0495676_0002383 Ga0495676_0002383_852_1322 156
623 3300047321 Ga0495676_0010778 Ga0495676_0010778_2501_2971 156
624 3300047321 Ga0495676_0016617 Ga0495676_0016617_5753_6223 156
625 3300047321 Ga0495676_0060795 Ga0495676_0060795_2065_2535 156
626 3300047321 Ga0495676_0114621 Ga0495676_0114621_1203_1673 156
627 3300047321 Ga0495676_0337533 Ga0495676_0337533_291_761 156
628 3300047321 Ga0495676_0950478 Ga0495676_0950478_31_501 156
629 3300047321 Ga0495676_0991646 Ga0495676_0991646_12_482 156
630 3300047322 Ga0495680_0014470 Ga0495680_0014470_5497_5967 156
631 3300047323 Ga0495683_0069893 Ga0495683_0069893_1162_1632 156
632 3300047323 Ga0495683_0162249 Ga0495683_0162249_407_877 156
633 3300047323 Ga0495683_0428736 Ga0495683_0428736_52_522 156
634 3300047443 Ga0495687_004621 Ga0495687_004621_1205_1675 156
635 3300047443 Ga0495687_009644 Ga0495687_009644_2441_2911 156
636 3300047443 Ga0495687_019701 Ga0495687_019701_2559_3029 156
637 3300047443 Ga0495687_029674 Ga0495687_029674_1668_2138 156
638 3300047443 Ga0495687_059001 Ga0495687_059001_407_880 156
639 3300047443 Ga0495687_097942 Ga0495687_097942_515_985 156
640 3300047444 Ga0495675_0031721 Ga0495675_0031721_46_516 156
641 3300047444 Ga0495675_0044461 Ga0495675_0044461_1447_1917 156
642 3300047444 Ga0495675_0101791 Ga0495675_0101791_210_680 156
643 3300047445 Ga0495677_0040808 Ga0495677_0040808_697_1167 156
644 3300047446 Ga0495679_116447 Ga0495679_116447_164_634 156
645 3300047447 Ga0495685_000778 Ga0495685_000778_3306_3776 156
646 3300047447 Ga0495685_004500 Ga0495685_004500_1190_1660 156
647 3300047447 Ga0495685_014206 Ga0495685_014206_887_1357 156
648 3300047447 Ga0495685_017916 Ga0495685_017916_1421_1894 156
649 3300047447 Ga0495685_033159 Ga0495685_033159_714_1184 156
650 3300047447 Ga0495685_081222 Ga0495685_081222_485_955 156
651 3300047469 Ga0495673_0158595 Ga0495673_0158595_269_739 156
652 3300047470 Ga0495681_0009575 Ga0495681_0009575_2139_2609 156
653 3300047470 Ga0495681_0049976 Ga0495681_0049976_22_492 156
654 3300047470 Ga0495681_0074063 Ga0495681_0074063_965_1435 156
655 3300047470 Ga0495681_0123531 Ga0495681_0123531_191_664 156
656 3300047471 Ga0495684_0101024 Ga0495684_0101024_597_1067 156
657 3300047472 Ga0495686_0014932 Ga0495686_0014932_4742_5212 156
658 3300047472 Ga0495686_0054549 Ga0495686_0054549_1071_1544 156
659 3300047673 Ga0495593_0034713 Ga0495593_0034713_1359_1829 156
660 3300047673 Ga0495593_0275466 Ga0495593_0275466_212_682 156
661 3300048088 Ga0495602_0632923 Ga0495602_0632923_241_711 156
662 3300048089 Ga0495614_0000762 Ga0495614_0000762_4519_4989 156
663 3300048089 Ga0495614_0052465 Ga0495614_0052465_1143_1613 156
664 3300048089 Ga0495614_0113128 Ga0495614_0113128_691_1161 156
665 3300048089 Ga0495614_0131186 Ga0495614_0131186_123_593 156
666 3300048091 Ga0495626_0013046 Ga0495626_0013046_1698_2168 156
667 3300048905 Ga0496102_0258527 Ga0496102_0258527_159_629 156
668 3300048912 Ga0496109_0027221 Ga0496109_0027221_4559_5029 156
669 3300048913 Ga0496110_0187678 Ga0496110_0187678_79_549 156
670 3300048916 Ga0496113_0813276 Ga0496113_0813276_141_611 156
671 3300048916 Ga0496113_0886114 Ga0496113_0886114_157_630 156
672 3300048927 Ga0496124_0798252 Ga0496124_0798252_66_536 156
673 3300049459 Ga0495678_043912 Ga0495678_043912_718_1188 156
674 3300049460 Ga0495682_0140059 Ga0495682_0140059_237_707 156
675 3300049568 Ga0501031_0100282 Ga0501031_0100282_437_916 156
676 3300049568 Ga0501031_0663043 Ga0501031_0663043_141_614 156
677 3300049569 Ga0501032_0046785 Ga0501032_0046785_888_1367 156
678 3300049570 Ga0501033_0002071 Ga0501033_0002071_9030_9503 156
679 3300049570 Ga0501033_0140986 Ga0501033_0140986_1246_1725 156
680 3300049570 Ga0501033_0454388 Ga0501033_0454388_23_502 156
681 3300049571 Ga0501034_0007488 Ga0501034_0007488_2358_2837 156
682 3300049571 Ga0501034_0240338 Ga0501034_0240338_1000_1479 156
683 3300049572 Ga0501036_0029018 Ga0501036_0029018_966_1445 156
684 3300049573 Ga0501037_0304226 Ga0501037_0304226_77_556 156
685 3300049574 Ga0501038_0054508 Ga0501038_0054508_1404_1883 156
686 3300049574 Ga0501038_0270448 Ga0501038_0270448_252_731 156
687 3300049574 Ga0501038_0554041 Ga0501038_0554041_308_781 156
688 3300049579 Ga0501043_0065798 Ga0501043_0065798_2215_2694 156
689 3300049581 Ga0501047_0033911 Ga0501047_0033911_1674_2153 156
690 3300049582 Ga0501048_0035095 Ga0501048_0035095_997_1476 156
691 3300049822 Ga0501035_0048356 Ga0501035_0048356_981_1460 156
692 3300049822 Ga0501035_0227105 Ga0501035_0227105_495_968 156
693 3300049823 Ga0501044_0010468 Ga0501044_0010468_7628_8101 156
694 3300049823 Ga0501044_0011825 Ga0501044_0011825_6721_7191 156
695 3300049823 Ga0501044_0045099 Ga0501044_0045099_3705_4184 156
696 3300049824 Ga0501045_0174387 Ga0501045_0174387_159_638 156
697 3300050490 nmdc:mga03n38_14218_c1 nmdc:mga03n38_14218_c1_1616_2089 156
698 3300050490 nmdc:mga03n38_166880_c1 nmdc:mga03n38_166880_c1_323_796 156
699 3300050494 nmdc:mga06z11_12423_c1 nmdc:mga06z11_12423_c1_2226_2702 156
700 3300050496 nmdc:mga07m45_152927_c1 nmdc:mga07m45_152927_c1_284_757 156
701 3300053086 Ga0500578_0074757 Ga0500578_0074757_1433_1903 156
702 3300053086 Ga0500578_0101155 Ga0500578_0101155_604_1077 156
703 3300053087 Ga0500643_157121 Ga0500643_157121_125_595 156
704 3300053092 Ga0500583_0138571 Ga0500583_0138571_567_1037 156
705 3300053094 Ga0500566_0186833 Ga0500566_0186833_315_785 156
706 3300053096 Ga0500641_0203838 Ga0500641_0203838_46_519 156
707 3300053096 Ga0500641_0313674 Ga0500641_0313674_112_582 156
708 3300053099 Ga0500654_129155 Ga0500654_129155_90_560 156
709 3300053100 Ga0500660_144907 Ga0500660_144907_406_876 156
710 3300053101 Ga0500553_214185 Ga0500553_214185_12_482 156
711 3300053104 Ga0500556_0180274 Ga0500556_0180274_268_738 156
712 3300053105 Ga0500557_178373 Ga0500557_178373_32_502 156
713 3300053107 Ga0500560_004466 Ga0500560_004466_2451_2921 156
714 3300053107 Ga0500560_035928 Ga0500560_035928_568_1038 156
715 3300053109 Ga0500569_084559 Ga0500569_084559_479_949 156
716 3300053123 Ga0500614_066134 Ga0500614_066134_478_948 156
717 3300053129 Ga0500628_091356 Ga0500628_091356_67_537 156
718 3300053131 Ga0500652_050659 Ga0500652_050659_1103_1573 156
719 3300053134 Ga0500658_0014745 Ga0500658_0014745_11_481 156
720 3300053137 Ga0500561_0102750 Ga0500561_0102750_50_520 156
721 3300053139 Ga0500568_0267803 Ga0500568_0267803_121_594 156
722 3300053140 Ga0500573_0033239 Ga0500573_0033239_2456_2926 156
723 3300053146 Ga0500588_0080447 Ga0500588_0080447_17_487 156
724 3300053147 Ga0500589_325700 Ga0500589_325700_17_487 156
725 3300053149 Ga0500600_0004613 Ga0500600_0004613_3143_3613 156
726 3300053149 Ga0500600_0122439 Ga0500600_0122439_521_994 156
727 3300053153 Ga0500616_0012533 Ga0500616_0012533_2877_3347 156
728 3300053160 Ga0500633_0019571 Ga0500633_0019571_1027_1497 156
729 3300053161 Ga0500634_0096496 Ga0500634_0096496_635_1105 156
730 3300053177 Ga0500636_0304403 Ga0500636_0304403_277_747 156
731 3300053732 Ga0500656_008315 Ga0500656_008315_116_586 156
732 3300053739 Ga0500587_012775 Ga0500587_012775_258_728 156
733 3300061719 Ga0466962_0000163 Ga0466962_0000163_19255_19725 156
734 3300061719 Ga0466962_0011589 Ga0466962_0011589_3715_4188 156
735 3300061719 Ga0466962_0249241 Ga0466962_0249241_265_738 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

9

104

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wv4-assembly1.cif.gz_B x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.8275 24 140
1wv4-assembly1.cif.gz_A x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.7854 14 140
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.7843 10 146
1rfe-assembly1.cif.gz_A crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis 0.7834 4 143
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.7778 15 140
ID Description Score Start End Superfamily
1wv4B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8275 24 140 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.798 6 146 2.30.110.10
6eciG00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.785 6 146 2.30.110.10
2asfA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7809 14 146 2.30.110.10
af_O07754_2_147_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7804 11 146 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A1G9ERN7-F1-model_v4 PPOX class probable F420-dependent enzyme 0.997 1 153 GO:0005829
GO:0016627
GO:0070967
AF-A0A495L8T1-F1-model_v4 PPOX class probable F420-dependent enzyme 0.9949 1 151 GO:0005829
GO:0016627
GO:0070967
AF-A0A1I1ZE95-F1-model_v4 PPOX class probable F420-dependent enzyme 0.9915 1 153 GO:0005829
GO:0016627
GO:0070967
AF-A0A4Y3KWS0-F1-model_v4 PPOX class F420-dependent enzyme 0.9912 1 153 GO:0005829
GO:0016627
GO:0070967
AF-A0A1G9ERN7-F1-model_v4 PPOX class probable F420-dependent enzyme 0.9905 1 153 GO:0005829
GO:0016627
GO:0070967

Feature Viewer

pLDDT pTM Quality
93.03 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map