F478236
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 735 | 386 | 651 | 155 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2862290372|2862294501 |
| Length | 158 |
| Sequence | IASNTRVDLAELLDFVRPRHRAVLLTRRTDGGPQASPLTLGVDDSGRLVMSTYPERAKTRNAKRDEQVSVLVLSGGTSRTESGGEWNGPWVQVDGTAEVLDVPDSVEPLVEYFRNISGEHPDWDEYRAAMVKQGKSLIRVTPERWGPIATGGFPARLA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 3 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 4 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 5 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 6 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 7 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 8 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 9 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 10 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 11 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 12 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 13 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 14 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 15 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 16 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 17 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 18 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 19 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 20 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 21 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 22 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 23 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 24 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 25 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 26 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 27 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 28 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 29 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 30 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 31 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 32 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 33 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 34 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 35 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 36 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 37 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 38 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 39 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 40 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 41 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 42 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 43 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 44 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 45 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 46 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 47 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 48 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 49 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 50 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 51 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 52 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 53 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 54 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 55 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 56 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 57 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 58 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 59 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 60 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 61 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 62 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 63 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 64 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 65 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 66 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 67 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 68 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 69 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 70 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 71 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 72 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 73 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 74 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 75 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 76 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 77 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 78 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 79 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 83 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 85 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 87 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 88 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 90 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 91 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 113 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 114 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 141 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 144 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 146 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 147 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 148 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 149 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 152 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 153 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 154 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 155 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 156 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 161 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 162 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 163 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 164 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 165 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 168 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 169 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 173 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 174 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 175 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 178 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 179 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 180 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 181 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 182 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 183 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 184 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 185 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 186 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 187 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 188 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 189 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 190 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 191 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 192 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 193 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 194 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 195 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 196 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 197 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 198 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 199 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 205 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 206 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 207 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 208 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 209 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 295 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 296 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 298 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 299 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 300 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 333 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 334 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 337 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 338 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 339 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 340 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 341 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 342 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 344 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 345 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 346 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 347 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 348 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 349 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 350 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 351 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 352 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 353 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 355 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 356 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 357 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 358 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 359 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 360 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 361 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 362 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 363 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 365 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 366 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 369 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 370 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 371 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 372 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 373 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 374 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 375 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 376 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 377 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 378 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 379 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 380 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 381 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 382 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 383 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 384 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 385 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 386 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.76 |
| Metatranscriptomes | 0.68 |
| Isolates | 11.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 7.62 |
| Nodule | 0.82 |
| Rhizoplane | 1.36 |
| Rhizosphere | 77.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.93 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10022997 | 3300001989 | Bacteria | 2207 |
| 2 | JGI24737J22298_10070152 | 3300001990 | Bacteria | 1047 |
| 3 | JGI24735J21928_10045118 | 3300002067 | Bacteria | 1280 |
| 4 | JGI24738J21930_10047408 | 3300002075 | Bacteria | 874 |
| 5 | JGI25153J46596_10049885 | 3300003215 | Bacteria | 1211 |
| 6 | rootH1_10033732 | 3300003316 | Bacteria | 1987 |
| 7 | rootH1_10033732 | 3300003323 | Bacteria | 1356 |
| 8 | rootH1_10033733 | 3300003316 | Bacteria | 4211 |
| 9 | rootL2_10041240 | 3300003322 | Bacteria | 3617 |
| 10 | rootL2_10210732 | 3300003322 | Bacteria | 2074 |
| 11 | rootH1_10123303 | 3300003323 | Bacteria | 2946 |
| 12 | rootH1_10152422 | 3300003323 | Bacteria | 2197 |
| 13 | JGI25160J50197_1047075 | 3300003354 | Bacteria | 941 |
| 14 | Ga0006562J51391_1050546 | 3300003578 | Bacteria | 5140 |
| 15 | Ga0006562J51391_1050549 | 3300003578 | Bacteria | 900 |
| 16 | Ga0006562J51391_1061896 | 3300003578 | Bacteria | 2485 |
| 17 | Ga0070659_100618232 | 3300005366 | Bacteria | 932 |
| 18 | Ga0070678_100978085 | 3300005456 | Bacteria | 777 |
| 19 | Ga0070681_10359612 | 3300005458 | Bacteria | 1366 |
| 20 | Ga0068853_100104923 | 3300005539 | Bacteria | 2503 |
| 21 | Ga0068853_101139383 | 3300005539 | Bacteria | 752 |
| 22 | Ga0070665_100304078 | 3300005548 | Bacteria | 1598 |
| 23 | Ga0070665_100330676 | 3300005548 | Bacteria | 1528 |
| 24 | Ga0068855_100023062 | 3300005563 | Bacteria | 7459 |
| 25 | Ga0070664_100072581 | 3300005564 | Bacteria | 2952 |
| 26 | Ga0068857_100269982 | 3300005577 | Bacteria | 1563 |
| 27 | Ga0068856_100010663 | 3300005614 | Bacteria | 8929 |
| 28 | Ga0068856_100415826 | 3300005614 | Bacteria | 1365 |
| 29 | Ga0070702_100991800 | 3300005615 | Bacteria | 664 |
| 30 | Ga0068852_100001014 | 3300005616 | Bacteria | 18540 |
| 31 | Ga0081455_10365355 | 3300005937 | Bacteria | 1013 |
| 32 | Ga0075363_100076247 | 3300006048 | Bacteria | 1828 |
| 33 | Ga0075363_100087882 | 3300006048 | Bacteria | 1708 |
| 34 | Ga0075363_100201209 | 3300006048 | Bacteria | 1138 |
| 35 | Ga0075370_10084253 | 3300006353 | Bacteria | 1830 |
| 36 | Ga0099826_10388104 | 3300006948 | Bacteria | 682 |
| 37 | Ga0105250_10175887 | 3300009092 | Bacteria | 897 |
| 38 | Ga0105240_10076356 | 3300009093 | Bacteria | 4130 |
| 39 | Ga0105240_10907819 | 3300009093 | Bacteria | 947 |
| 40 | Ga0105245_10241199 | 3300009098 | Bacteria | 1752 |
| 41 | Ga0105245_10328955 | 3300009098 | Bacteria | 1508 |
| 42 | Ga0105243_10956558 | 3300009148 | Bacteria | 856 |
| 43 | Ga0105243_12657826 | 3300009148 | Bacteria | 541 |
| 44 | Ga0105241_10001341 | 3300009174 | Bacteria | 18679 |
| 45 | Ga0105242_10517223 | 3300009176 | Bacteria | 1138 |
| 46 | Ga0105248_10106466 | 3300009177 | Bacteria | 3162 |
| 47 | Ga0105238_10709397 | 3300009551 | Bacteria | 1018 |
| 48 | Ga0105249_11659376 | 3300009553 | Bacteria | 712 |
| 49 | Ga0105239_10014936 | 3300010375 | Bacteria | 8608 |
| 50 | Ga0105239_11253092 | 3300010375 | Bacteria | 855 |
| 51 | Ga0105239_11323169 | 3300010375 | Bacteria | 831 |
| 52 | Ga0105239_11665290 | 3300010375 | Bacteria | 738 |
| 53 | Ga0105239_12481449 | 3300010375 | Bacteria | 604 |
| 54 | Ga0105246_10000030 | 3300011119 | Bacteria | 52202 |
| 55 | Ga0105246_10135778 | 3300011119 | Bacteria | 1843 |
| 56 | Ga0105246_10476239 | 3300011119 | Bacteria | 1055 |
| 57 | Ga0157369_10065387 | 3300013105 | Bacteria | 3913 |
| 58 | Ga0157374_10365857 | 3300013296 | Bacteria | 1435 |
| 59 | Ga0157372_10102885 | 3300013307 | Bacteria | 3263 |
| 60 | Ga0157375_12561578 | 3300013308 | Bacteria | 609 |
| 61 | Ga0157380_10600838 | 3300014326 | Bacteria | 1088 |
| 62 | Ga0182008_10002267 | 3300014497 | Bacteria | 12145 |
| 63 | Ga0157376_10944088 | 3300014969 | Bacteria | 883 |
| 64 | Ga0182007_10004465 | 3300015262 | Bacteria | 6339 |
| 65 | Ga0183367_1008 | 3300015688 | Bacteria | 490626 |
| 66 | Ga0224712_10045281 | 3300022467 | Bacteria | 1682 |
| 67 | Ga0224712_10241416 | 3300022467 | Bacteria | 832 |
| 68 | Ga0209758_1008765 | 3300025297 | Bacteria | 6450 |
| 69 | Ga0207426_1001637 | 3300025302 | Bacteria | 17519 |
| 70 | Ga0207426_1003477 | 3300025302 | Bacteria | 8511 |
| 71 | Ga0207426_1004228 | 3300025302 | Bacteria | 7135 |
| 72 | Ga0207426_1010421 | 3300025302 | Bacteria | 3605 |
| 73 | Ga0207426_1018541 | 3300025302 | Bacteria | 2450 |
| 74 | Ga0207680_10540608 | 3300025903 | Bacteria | 831 |
| 75 | Ga0207647_10015752 | 3300025904 | Bacteria | 5175 |
| 76 | Ga0207654_10009813 | 3300025911 | Bacteria | 4869 |
| 77 | Ga0207695_10004099 | 3300025913 | Bacteria | 20031 |
| 78 | Ga0207671_10000128 | 3300025914 | Bacteria | 117836 |
| 79 | Ga0207694_10207057 | 3300025924 | Bacteria | 1597 |
| 80 | Ga0207687_10049131 | 3300025927 | Bacteria | 2932 |
| 81 | Ga0207687_10076420 | 3300025927 | Bacteria | 2405 |
| 82 | Ga0207706_10090638 | 3300025933 | Bacteria | 2688 |
| 83 | Ga0207709_10962978 | 3300025935 | Bacteria | 696 |
| 84 | Ga0207711_10279927 | 3300025941 | Bacteria | 1536 |
| 85 | Ga0207679_10025198 | 3300025945 | Bacteria | 4088 |
| 86 | Ga0207667_10055281 | 3300025949 | Bacteria | 4173 |
| 87 | Ga0207640_10379866 | 3300025981 | Bacteria | 1144 |
| 88 | Ga0207703_10277085 | 3300026035 | Bacteria | 1522 |
| 89 | Ga0207639_10085880 | 3300026041 | Bacteria | 2504 |
| 90 | Ga0207639_10176724 | 3300026041 | Bacteria | 1813 |
| 91 | Ga0207678_10023248 | 3300026067 | Bacteria | 5421 |
| 92 | Ga0207708_10312671 | 3300026075 | Bacteria | 1280 |
| 93 | Ga0207702_10249966 | 3300026078 | Bacteria | 1665 |
| 94 | Ga0207702_10269079 | 3300026078 | Bacteria | 1607 |
| 95 | Ga0207674_10947892 | 3300026116 | Bacteria | 829 |
| 96 | Ga0207675_100068085 | 3300026118 | Bacteria | 3328 |
| 97 | Ga0207683_11356060 | 3300026121 | Bacteria | 658 |
| 98 | Ga0207698_10349870 | 3300026142 | Bacteria | 1395 |
| 99 | Ga0209371_1013135 | 3300027312 | Bacteria | 2348 |
| 100 | Ga0209282_1270904 | 3300027666 | Bacteria | 738 |
| 101 | Ga0209813_10024039 | 3300027866 | Bacteria | 1738 |
| 102 | Ga0268266_10179042 | 3300028379 | Bacteria | 1929 |
| 103 | Ga0268266_10279799 | 3300028379 | Bacteria | 1551 |
| 104 | Ga0268266_11488576 | 3300028379 | Bacteria | 652 |
| 105 | Ga0307515_10000928 | 3300028794 | Bacteria | 67239 |
| 106 | Ga0307515_10437980 | 3300028794 | Bacteria | 924 |
| 107 | Ga0307515_10581538 | 3300028794 | Bacteria | 730 |
| 108 | Ga0268256_1014405 | 3300030500 | Bacteria | 2348 |
| 109 | Ga0307511_10000945 | 3300030521 | Bacteria | 30807 |
| 110 | Ga0307511_10057234 | 3300030521 | Bacteria | 3035 |
| 111 | Ga0307511_10205780 | 3300030521 | Bacteria | 1013 |
| 112 | Ga0307511_10248197 | 3300030521 | Bacteria | 859 |
| 113 | Ga0307512_10012951 | 3300030522 | Bacteria | 7840 |
| 114 | Ga0307512_10240452 | 3300030522 | Bacteria | 917 |
| 115 | Ga0316181_1127688 | 3300030744 | Bacteria | 630 |
| 116 | Ga0307513_10003927 | 3300031456 | Bacteria | 19997 |
| 117 | Ga0307513_10072221 | 3300031456 | Bacteria | 3598 |
| 118 | Ga0307513_10116156 | 3300031456 | Bacteria | 2656 |
| 119 | Ga0307509_10022630 | 3300031507 | Bacteria | 7079 |
| 120 | Ga0307509_10076738 | 3300031507 | Bacteria | 3466 |
| 121 | Ga0307509_10252668 | 3300031507 | Bacteria | 1545 |
| 122 | Ga0307509_10605991 | 3300031507 | Bacteria | 767 |
| 123 | Ga0307408_102085221 | 3300031548 | Bacteria | 546 |
| 124 | Ga0307508_10002378 | 3300031616 | Bacteria | 19910 |
| 125 | Ga0307508_10022735 | 3300031616 | Bacteria | 5699 |
| 126 | Ga0307508_10047622 | 3300031616 | Bacteria | 3821 |
| 127 | Ga0307508_10077737 | 3300031616 | Bacteria | 2897 |
| 128 | Ga0307508_10079919 | 3300031616 | Bacteria | 2851 |
| 129 | Ga0307508_10198007 | 3300031616 | Bacteria | 1610 |
| 130 | Ga0307508_10724499 | 3300031616 | Bacteria | 606 |
| 131 | Ga0307514_10018627 | 3300031649 | Bacteria | 5691 |
| 132 | Ga0307514_10208235 | 3300031649 | Bacteria | 1218 |
| 133 | Ga0307514_10238643 | 3300031649 | Bacteria | 1092 |
| 134 | Ga0307514_10345239 | 3300031649 | Bacteria | 798 |
| 135 | Ga0307514_10349345 | 3300031649 | Bacteria | 789 |
| 136 | Ga0307514_10356189 | 3300031649 | Bacteria | 776 |
| 137 | Ga0316575_10051119 | 3300031665 | Bacteria | 1646 |
| 138 | Ga0307516_10006477 | 3300031730 | Bacteria | 13711 |
| 139 | Ga0307516_10144310 | 3300031730 | Bacteria | 2147 |
| 140 | Ga0307516_10240442 | 3300031730 | Bacteria | 1509 |
| 141 | Ga0307516_10356750 | 3300031730 | Bacteria | 1127 |
| 142 | Ga0307518_10058932 | 3300031838 | Bacteria | 2788 |
| 143 | Ga0307518_10175432 | 3300031838 | Bacteria | 1455 |
| 144 | Ga0307518_10271488 | 3300031838 | Bacteria | 1058 |
| 145 | Ga0307410_10067358 | 3300031852 | Bacteria | 2470 |
| 146 | Ga0307410_10275437 | 3300031852 | Bacteria | 1318 |
| 147 | Ga0307409_100037687 | 3300031995 | Bacteria | 3567 |
| 148 | Ga0307409_100119570 | 3300031995 | Bacteria | 2228 |
| 149 | Ga0307416_101709543 | 3300032002 | Bacteria | 734 |
| 150 | Ga0307411_10634545 | 3300032005 | Bacteria | 923 |
| 151 | Ga0307507_10017128 | 3300033179 | Bacteria | 8353 |
| 152 | Ga0307507_10028020 | 3300033179 | Bacteria | 6016 |
| 153 | Ga0307510_10041179 | 3300033180 | Bacteria | 5056 |
| 154 | Ga0307510_10085353 | 3300033180 | Bacteria | 3034 |
| 155 | Ga0307510_10121601 | 3300033180 | Bacteria | 2313 |
| 156 | Ga0307510_10219680 | 3300033180 | Bacteria | 1413 |
| 157 | Ga0307510_10494631 | 3300033180 | Bacteria | 665 |
| 158 | Ga0395899_0261655 | 3300037312 | Bacteria | 1183 |
| 159 | Ga0395899_0580091 | 3300037312 | Bacteria | 717 |
| 160 | Ga0395900_0179671 | 3300037418 | Bacteria | 2151 |
| 161 | Ga0395900_0424277 | 3300037418 | Bacteria | 1290 |
| 162 | Ga0395898_0001397 | 3300037466 | Bacteria | 34434 |
| 163 | Ga0395898_0003880 | 3300037466 | Bacteria | 16509 |
| 164 | Ga0395898_0073658 | 3300037466 | Bacteria | 3299 |
| 165 | Ga0395905_0365510 | 3300037471 | Bacteria | 1336 |
| 166 | Ga0395901_0078391 | 3300038443 | Bacteria | 3449 |
| 167 | Ga0395901_0096424 | 3300038443 | Bacteria | 3099 |
| 168 | Ga0395901_0105186 | 3300038443 | Bacteria | 2962 |
| 169 | Ga0439436_0003058 | 3300041404 | Bacteria | 5077 |
| 170 | Ga0439436_0004048 | 3300041404 | Bacteria | 4493 |
| 171 | Ga0439439_0008564 | 3300041406 | Bacteria | 2419 |
| 172 | Ga0439439_0066166 | 3300041406 | Bacteria | 964 |
| 173 | Ga0451789_1138150 | 3300041443 | Bacteria | 658 |
| 174 | Ga0451797_0889241 | 3300041453 | Bacteria | 791 |
| 175 | Ga0451807_2473932 | 3300041486 | Bacteria | 740 |
| 176 | Ga0451837_0989560 | 3300041494 | Bacteria | 1198 |
| 177 | Ga0451841_0983366 | 3300041498 | Bacteria | 509 |
| 178 | Ga0451847_0832006 | 3300041503 | Bacteria | 705 |
| 179 | Ga0451851_0290026 | 3300041507 | Bacteria | 911 |
| 180 | Ga0451851_1377664 | 3300041507 | Bacteria | 847 |
| 181 | Ga0451853_0777276 | 3300041512 | Bacteria | 2380 |
| 182 | Ga0451853_2561483 | 3300041512 | Bacteria | 2314 |
| 183 | Ga0439433_0000565 | 3300041999 | Bacteria | 7019 |
| 184 | Ga0439433_0023848 | 3300041999 | Bacteria | 1377 |
| 185 | Ga0439442_009075 | 3300042002 | Bacteria | 2011 |
| 186 | Ga0439442_011672 | 3300042002 | Bacteria | 1791 |
| 187 | Ga0439448_0002231 | 3300042005 | Bacteria | 5235 |
| 188 | Ga0439432_021300 | 3300042006 | Bacteria | 2151 |
| 189 | Ga0439449_0000841 | 3300042007 | Bacteria | 11909 |
| 190 | Ga0439449_0084120 | 3300042007 | Bacteria | 1174 |
| 191 | Ga0439457_001497 | 3300042014 | Bacteria | 7001 |
| 192 | Ga0439462_0000959 | 3300042015 | Bacteria | 6127 |
| 193 | Ga0450890_010016 | 3300042127 | Bacteria | 1218 |
| 194 | Ga0450894_000065 | 3300042131 | Bacteria | 16610 |
| 195 | Ga0450895_005044 | 3300042132 | Bacteria | 1057 |
| 196 | Ga0450896_001817 | 3300042133 | Bacteria | 2696 |
| 197 | Ga0450898_005535 | 3300042134 | Bacteria | 1912 |
| 198 | Ga0450899_000511 | 3300042135 | Bacteria | 4391 |
| 199 | Ga0450900_004000 | 3300042136 | Bacteria | 1672 |
| 200 | Ga0450903_000670 | 3300042138 | Bacteria | 6896 |
| 201 | Ga0450904_013758 | 3300042139 | Bacteria | 806 |
| 202 | Ga0450906_000844 | 3300042145 | Bacteria | 6751 |
| 203 | Ga0439458_0000517 | 3300042157 | Bacteria | 9922 |
| 204 | Ga0450908_032289 | 3300042184 | Bacteria | 908 |
| 205 | Ga0439464_0012340 | 3300042439 | Bacteria | 2275 |
| 206 | Ga0466969_0005631 | 3300044656 | Bacteria | 6661 |
| 207 | Ga0466969_0073532 | 3300044656 | Bacteria | 1640 |
| 208 | Ga0466972_0001060 | 3300044658 | Bacteria | 13194 |
| 209 | Ga0466972_0069299 | 3300044658 | Bacteria | 1684 |
| 210 | Ga0466972_0081032 | 3300044658 | Bacteria | 1545 |
| 211 | Ga0466972_0295908 | 3300044658 | Bacteria | 756 |
| 212 | Ga0466965_0000312 | 3300044683 | Bacteria | 16288 |
| 213 | Ga0466965_0014405 | 3300044683 | Bacteria | 3742 |
| 214 | Ga0466965_0241500 | 3300044683 | Bacteria | 967 |
| 215 | Ga0466966_0001162 | 3300044684 | Bacteria | 16927 |
| 216 | Ga0466966_0002783 | 3300044684 | Bacteria | 11495 |
| 217 | Ga0466961_0002591 | 3300044693 | Bacteria | 11217 |
| 218 | Ga0466961_0005840 | 3300044693 | Bacteria | 7798 |
| 219 | Ga0466961_0034399 | 3300044693 | Bacteria | 3253 |
| 220 | Ga0466961_0035125 | 3300044693 | Bacteria | 3219 |
| 221 | Ga0466961_0062799 | 3300044693 | Bacteria | 2360 |
| 222 | Ga0466963_0003115 | 3300044694 | Bacteria | 9398 |
| 223 | Ga0466963_0165305 | 3300044694 | Bacteria | 1541 |
| 224 | Ga0466964_0008956 | 3300044706 | Bacteria | 3765 |
| 225 | Ga0466964_0039907 | 3300044706 | Bacteria | 1893 |
| 226 | Ga0466964_0392880 | 3300044706 | Bacteria | 723 |
| 227 | Ga0466971_0000277 | 3300044719 | Bacteria | 19725 |
| 228 | Ga0466971_0015939 | 3300044719 | Bacteria | 3312 |
| 229 | Ga0466968_0087204 | 3300044735 | Bacteria | 1378 |
| 230 | Ga0466970_0000443 | 3300044765 | Bacteria | 20304 |
| 231 | Ga0466970_0006602 | 3300044765 | Bacteria | 5804 |
| 232 | Ga0466970_0016652 | 3300044765 | Bacteria | 3793 |
| 233 | Ga0466970_0057196 | 3300044765 | Bacteria | 2085 |
| 234 | Ga0466957_0001357 | 3300044842 | Bacteria | 12776 |
| 235 | Ga0466960_0266483 | 3300044901 | Bacteria | 956 |
| 236 | Ga0466959_0019009 | 3300045049 | Bacteria | 5049 |
| 237 | Ga0466958_0118783 | 3300045836 | Bacteria | 1654 |
| 238 | Ga0466958_0136775 | 3300045836 | Bacteria | 1541 |
| 239 | Ga0466967_0004534 | 3300045976 | Bacteria | 9396 |
| 240 | Ga0466967_0006993 | 3300045976 | Bacteria | 8074 |
| 241 | Ga0466967_0016389 | 3300045976 | Bacteria | 5843 |
| 242 | Ga0466967_0030987 | 3300045976 | Bacteria | 4496 |
| 243 | Ga0466967_0210293 | 3300045976 | Bacteria | 1845 |
| 244 | Ga0466967_0883424 | 3300045976 | Bacteria | 889 |
| 245 | Ga0495617_007941 | 3300046452 | Bacteria | 3669 |
| 246 | Ga0495627_099664 | 3300046453 | Bacteria | 830 |
| 247 | Ga0495592_0009032 | 3300046454 | Bacteria | 7491 |
| 248 | Ga0495592_0086204 | 3300046454 | Bacteria | 2262 |
| 249 | Ga0495592_0159822 | 3300046454 | Bacteria | 1551 |
| 250 | Ga0495603_0000701 | 3300046455 | Bacteria | 18948 |
| 251 | Ga0495603_0002941 | 3300046455 | Bacteria | 10074 |
| 252 | Ga0495603_0004561 | 3300046455 | Bacteria | 8266 |
| 253 | Ga0495603_0007883 | 3300046455 | Bacteria | 6422 |
| 254 | Ga0495603_0025037 | 3300046455 | Bacteria | 3609 |
| 255 | Ga0495603_0046323 | 3300046455 | Bacteria | 2591 |
| 256 | Ga0495603_0627013 | 3300046455 | Bacteria | 615 |
| 257 | Ga0495629_0000808 | 3300046459 | Bacteria | 25349 |
| 258 | Ga0495629_0008474 | 3300046459 | Bacteria | 7569 |
| 259 | Ga0495629_0013998 | 3300046459 | Bacteria | 5781 |
| 260 | Ga0495629_0015401 | 3300046459 | Bacteria | 5492 |
| 261 | Ga0495629_0016632 | 3300046459 | Bacteria | 5279 |
| 262 | Ga0495629_0030931 | 3300046459 | Bacteria | 3792 |
| 263 | Ga0495629_0085598 | 3300046459 | Bacteria | 2199 |
| 264 | Ga0495629_0137419 | 3300046459 | Bacteria | 1701 |
| 265 | Ga0495629_0317301 | 3300046459 | Bacteria | 1066 |
| 266 | Ga0495638_0110084 | 3300046460 | Bacteria | 1637 |
| 267 | Ga0495638_0175704 | 3300046460 | Bacteria | 1225 |
| 268 | Ga0495638_0249774 | 3300046460 | Bacteria | 978 |
| 269 | Ga0495641_0186225 | 3300046461 | Bacteria | 930 |
| 270 | Ga0495641_0314772 | 3300046461 | Bacteria | 706 |
| 271 | Ga0495651_0001478 | 3300046462 | Bacteria | 18178 |
| 272 | Ga0495651_0101094 | 3300046462 | Bacteria | 2146 |
| 273 | Ga0495605_0005776 | 3300046474 | Bacteria | 7163 |
| 274 | Ga0495605_0028277 | 3300046474 | Bacteria | 2895 |
| 275 | Ga0495662_0000395 | 3300046476 | Bacteria | 19477 |
| 276 | Ga0495662_0009266 | 3300046476 | Bacteria | 4829 |
| 277 | Ga0495662_0049855 | 3300046476 | Bacteria | 2020 |
| 278 | Ga0495664_0004484 | 3300046477 | Bacteria | 7641 |
| 279 | Ga0495664_0061773 | 3300046477 | Bacteria | 2230 |
| 280 | Ga0495585_0007936 | 3300046492 | Bacteria | 6453 |
| 281 | Ga0495585_0088060 | 3300046492 | Bacteria | 1675 |
| 282 | Ga0495585_0164620 | 3300046492 | Bacteria | 1149 |
| 283 | Ga0495585_0281423 | 3300046492 | Bacteria | 822 |
| 284 | Ga0495594_0005254 | 3300046499 | Bacteria | 6657 |
| 285 | Ga0495594_0012424 | 3300046499 | Bacteria | 4435 |
| 286 | Ga0495594_0016252 | 3300046499 | Bacteria | 3919 |
| 287 | Ga0495594_0033179 | 3300046499 | Bacteria | 2805 |
| 288 | Ga0495594_0069923 | 3300046499 | Bacteria | 1950 |
| 289 | Ga0495594_0132329 | 3300046499 | Bacteria | 1413 |
| 290 | Ga0495594_0231446 | 3300046499 | Bacteria | 1053 |
| 291 | Ga0495594_0284825 | 3300046499 | Bacteria | 941 |
| 292 | Ga0495596_0049344 | 3300046500 | Bacteria | 1650 |
| 293 | Ga0495607_0069566 | 3300046501 | Bacteria | 1969 |
| 294 | Ga0495607_0095114 | 3300046501 | Bacteria | 1606 |
| 295 | Ga0495583_0060370 | 3300046506 | Bacteria | 1695 |
| 296 | Ga0495583_0095732 | 3300046506 | Bacteria | 1273 |
| 297 | Ga0495583_0171396 | 3300046506 | Bacteria | 891 |
| 298 | Ga0495606_0013342 | 3300046507 | Bacteria | 6502 |
| 299 | Ga0495608_0528453 | 3300046511 | Bacteria | 712 |
| 300 | Ga0495610_0012935 | 3300046512 | Bacteria | 4988 |
| 301 | Ga0495616_0002920 | 3300046513 | Bacteria | 11131 |
| 302 | Ga0495616_0334252 | 3300046513 | Bacteria | 634 |
| 303 | Ga0495618_0041048 | 3300046514 | Bacteria | 2913 |
| 304 | Ga0495618_0118360 | 3300046514 | Bacteria | 1696 |
| 305 | Ga0495620_0005708 | 3300046515 | Bacteria | 6928 |
| 306 | Ga0495620_0021552 | 3300046515 | Bacteria | 3127 |
| 307 | Ga0495620_0057291 | 3300046515 | Bacteria | 1636 |
| 308 | Ga0495628_0006091 | 3300046516 | Bacteria | 10548 |
| 309 | Ga0495628_0037203 | 3300046516 | Bacteria | 3902 |
| 310 | Ga0495628_0287576 | 3300046516 | Bacteria | 1219 |
| 311 | Ga0495630_0076146 | 3300046517 | Bacteria | 2528 |
| 312 | Ga0495630_0140144 | 3300046517 | Bacteria | 1839 |
| 313 | Ga0495631_0005953 | 3300046518 | Bacteria | 6343 |
| 314 | Ga0495631_0150477 | 3300046518 | Bacteria | 999 |
| 315 | Ga0495632_0025647 | 3300046519 | Bacteria | 3115 |
| 316 | Ga0495632_0169047 | 3300046519 | Bacteria | 1005 |
| 317 | Ga0495637_0131564 | 3300046520 | Bacteria | 955 |
| 318 | Ga0495643_0008008 | 3300046522 | Bacteria | 6738 |
| 319 | Ga0495643_0008270 | 3300046522 | Bacteria | 6606 |
| 320 | Ga0495644_0114281 | 3300046523 | Bacteria | 1025 |
| 321 | Ga0495648_0104392 | 3300046524 | Bacteria | 1556 |
| 322 | Ga0495648_0219270 | 3300046524 | Bacteria | 939 |
| 323 | Ga0495648_0267686 | 3300046524 | Bacteria | 816 |
| 324 | Ga0495666_0086076 | 3300046526 | Bacteria | 1484 |
| 325 | Ga0495666_0488619 | 3300046526 | Bacteria | 550 |
| 326 | Ga0495642_0076710 | 3300046528 | Bacteria | 1403 |
| 327 | Ga0495642_0204514 | 3300046528 | Bacteria | 861 |
| 328 | Ga0495652_0002292 | 3300046529 | Bacteria | 19970 |
| 329 | Ga0495652_0018776 | 3300046529 | Bacteria | 6162 |
| 330 | Ga0495652_0226270 | 3300046529 | Bacteria | 1402 |
| 331 | Ga0495652_0690736 | 3300046529 | Bacteria | 687 |
| 332 | Ga0495654_0039808 | 3300046530 | Bacteria | 2345 |
| 333 | Ga0495640_0005132 | 3300046533 | Bacteria | 10410 |
| 334 | Ga0495640_0170785 | 3300046533 | Bacteria | 1389 |
| 335 | Ga0495586_0041897 | 3300046535 | Bacteria | 2466 |
| 336 | Ga0495586_0114791 | 3300046535 | Bacteria | 1501 |
| 337 | Ga0495609_0014264 | 3300046538 | Bacteria | 3740 |
| 338 | Ga0495609_0037075 | 3300046538 | Bacteria | 2200 |
| 339 | Ga0495597_0065595 | 3300046542 | Bacteria | 1574 |
| 340 | Ga0495645_0017508 | 3300046543 | Bacteria | 5133 |
| 341 | Ga0495645_0156268 | 3300046543 | Bacteria | 1580 |
| 342 | Ga0495622_0007310 | 3300046557 | Bacteria | 5127 |
| 343 | Ga0495622_0024271 | 3300046557 | Bacteria | 2831 |
| 344 | Ga0495633_0033065 | 3300046558 | Bacteria | 2495 |
| 345 | Ga0495667_0144260 | 3300046559 | Bacteria | 1534 |
| 346 | Ga0495667_0229274 | 3300046559 | Bacteria | 1184 |
| 347 | Ga0495656_0553821 | 3300046615 | Bacteria | 613 |
| 348 | Ga0495668_0017571 | 3300046616 | Bacteria | 4145 |
| 349 | Ga0495668_0024591 | 3300046616 | Bacteria | 3425 |
| 350 | Ga0495634_0027789 | 3300046642 | Bacteria | 3933 |
| 351 | Ga0495634_0036930 | 3300046642 | Bacteria | 3339 |
| 352 | Ga0495611_0047056 | 3300046648 | Bacteria | 1935 |
| 353 | Ga0495611_0228764 | 3300046648 | Bacteria | 864 |
| 354 | Ga0495625_0027694 | 3300046660 | Bacteria | 4259 |
| 355 | Ga0495625_0043869 | 3300046660 | Bacteria | 3240 |
| 356 | Ga0495625_0139786 | 3300046660 | Bacteria | 1634 |
| 357 | Ga0495625_0174059 | 3300046660 | Bacteria | 1435 |
| 358 | Ga0495625_0411778 | 3300046660 | Bacteria | 842 |
| 359 | Ga0495635_0000602 | 3300046663 | Bacteria | 23157 |
| 360 | Ga0495635_0205053 | 3300046663 | Bacteria | 1337 |
| 361 | Ga0495635_0224614 | 3300046663 | Bacteria | 1269 |
| 362 | Ga0495661_0012661 | 3300046665 | Bacteria | 5693 |
| 363 | Ga0495661_0123762 | 3300046665 | Bacteria | 1425 |
| 364 | Ga0495588_0001017 | 3300046674 | Bacteria | 12195 |
| 365 | Ga0495588_0001932 | 3300046674 | Bacteria | 8853 |
| 366 | Ga0495588_0080786 | 3300046674 | Bacteria | 1697 |
| 367 | Ga0495588_0393200 | 3300046674 | Bacteria | 728 |
| 368 | Ga0495657_0002328 | 3300046675 | Bacteria | 15995 |
| 369 | Ga0495657_0029544 | 3300046675 | Bacteria | 3844 |
| 370 | Ga0495657_0072892 | 3300046675 | Bacteria | 2238 |
| 371 | Ga0495657_0289018 | 3300046675 | Bacteria | 979 |
| 372 | Ga0495623_0513047 | 3300046679 | Bacteria | 631 |
| 373 | Ga0495646_0000580 | 3300046680 | Bacteria | 19850 |
| 374 | Ga0495646_0063836 | 3300046680 | Bacteria | 2185 |
| 375 | Ga0495658_0087961 | 3300046683 | Bacteria | 1835 |
| 376 | Ga0495658_0103622 | 3300046683 | Bacteria | 1702 |
| 377 | Ga0495613_0001160 | 3300046689 | Bacteria | 20120 |
| 378 | Ga0495613_0004327 | 3300046689 | Bacteria | 10633 |
| 379 | Ga0495613_0017915 | 3300046689 | Bacteria | 5280 |
| 380 | Ga0495613_0208155 | 3300046689 | Bacteria | 1376 |
| 381 | Ga0495613_0254240 | 3300046689 | Bacteria | 1225 |
| 382 | Ga0495613_0391034 | 3300046689 | Bacteria | 950 |
| 383 | Ga0495613_0452794 | 3300046689 | Bacteria | 869 |
| 384 | Ga0495613_0644312 | 3300046689 | Bacteria | 701 |
| 385 | Ga0495624_0124203 | 3300046690 | Bacteria | 1584 |
| 386 | Ga0495624_0432879 | 3300046690 | Bacteria | 788 |
| 387 | Ga0495670_0000768 | 3300046691 | Bacteria | 15390 |
| 388 | Ga0495670_0066409 | 3300046691 | Bacteria | 1820 |
| 389 | Ga0495670_0106878 | 3300046691 | Bacteria | 1446 |
| 390 | Ga0495670_0452614 | 3300046691 | Bacteria | 695 |
| 391 | Ga0495671_0007931 | 3300046692 | Bacteria | 6007 |
| 392 | Ga0495671_0058976 | 3300046692 | Bacteria | 1898 |
| 393 | Ga0495671_0178769 | 3300046692 | Bacteria | 1031 |
| 394 | Ga0495649_0024808 | 3300046694 | Bacteria | 3343 |
| 395 | Ga0495649_0041202 | 3300046694 | Bacteria | 2526 |
| 396 | Ga0495649_0174306 | 3300046694 | Bacteria | 1124 |
| 397 | Ga0495589_0010936 | 3300046794 | Bacteria | 4714 |
| 398 | Ga0495589_0015889 | 3300046794 | Bacteria | 3870 |
| 399 | Ga0495589_0072839 | 3300046794 | Bacteria | 1677 |
| 400 | Ga0495589_0110063 | 3300046794 | Bacteria | 1330 |
| 401 | Ga0495589_0119531 | 3300046794 | Bacteria | 1269 |
| 402 | Ga0495589_0121734 | 3300046794 | Bacteria | 1256 |
| 403 | Ga0495600_0004676 | 3300046809 | Bacteria | 8205 |
| 404 | Ga0495600_0191492 | 3300046809 | Bacteria | 1315 |
| 405 | Ga0495600_0268036 | 3300046809 | Bacteria | 1083 |
| 406 | Ga0495660_0025579 | 3300046810 | Bacteria | 3351 |
| 407 | Ga0495660_0116713 | 3300046810 | Bacteria | 1355 |
| 408 | Ga0495660_0123697 | 3300046810 | Bacteria | 1305 |
| 409 | Ga0495581_0017554 | 3300047315 | Bacteria | 4156 |
| 410 | Ga0495581_0038486 | 3300047315 | Bacteria | 2768 |
| 411 | Ga0495581_0340649 | 3300047315 | Bacteria | 875 |
| 412 | Ga0495581_0387340 | 3300047315 | Bacteria | 816 |
| 413 | Ga0495581_0389546 | 3300047315 | Bacteria | 813 |
| 414 | Ga0495604_0000226 | 3300047317 | Bacteria | 50983 |
| 415 | Ga0495604_0002227 | 3300047317 | Bacteria | 15528 |
| 416 | Ga0495604_0017363 | 3300047317 | Bacteria | 5760 |
| 417 | Ga0495604_0073508 | 3300047317 | Bacteria | 2580 |
| 418 | Ga0495604_0206185 | 3300047317 | Bacteria | 1360 |
| 419 | Ga0495604_0409596 | 3300047317 | Bacteria | 892 |
| 420 | Ga0495636_0004207 | 3300047318 | Bacteria | 5653 |
| 421 | Ga0495636_0036488 | 3300047318 | Bacteria | 2028 |
| 422 | Ga0495636_0041026 | 3300047318 | Bacteria | 1920 |
| 423 | Ga0495636_0063937 | 3300047318 | Bacteria | 1560 |
| 424 | Ga0495636_0296473 | 3300047318 | Bacteria | 756 |
| 425 | Ga0495674_0041092 | 3300047319 | Bacteria | 4133 |
| 426 | Ga0495674_0296435 | 3300047319 | Bacteria | 1321 |
| 427 | Ga0495676_0002383 | 3300047321 | Bacteria | 16681 |
| 428 | Ga0495676_0010778 | 3300047321 | Bacteria | 8272 |
| 429 | Ga0495676_0016617 | 3300047321 | Bacteria | 6521 |
| 430 | Ga0495676_0018192 | 3300047321 | Bacteria | 6198 |
| 431 | Ga0495676_0024429 | 3300047321 | Bacteria | 5231 |
| 432 | Ga0495676_0060795 | 3300047321 | Bacteria | 2958 |
| 433 | Ga0495676_0114621 | 3300047321 | Bacteria | 1971 |
| 434 | Ga0495676_0337533 | 3300047321 | Bacteria | 1009 |
| 435 | Ga0495676_0950478 | 3300047321 | Bacteria | 549 |
| 436 | Ga0495676_0991646 | 3300047321 | Bacteria | 536 |
| 437 | Ga0495680_0014470 | 3300047322 | Bacteria | 6831 |
| 438 | Ga0495683_0012497 | 3300047323 | Bacteria | 4456 |
| 439 | Ga0495683_0069893 | 3300047323 | Bacteria | 1725 |
| 440 | Ga0495683_0162249 | 3300047323 | Bacteria | 1033 |
| 441 | Ga0495683_0428736 | 3300047323 | Bacteria | 545 |
| 442 | Ga0495687_004621 | 3300047443 | Bacteria | 9199 |
| 443 | Ga0495687_009644 | 3300047443 | Bacteria | 5375 |
| 444 | Ga0495687_019701 | 3300047443 | Bacteria | 3302 |
| 445 | Ga0495687_028005 | 3300047443 | Bacteria | 2627 |
| 446 | Ga0495687_029674 | 3300047443 | Bacteria | 2526 |
| 447 | Ga0495687_059001 | 3300047443 | Bacteria | 1590 |
| 448 | Ga0495687_097942 | 3300047443 | Bacteria | 1107 |
| 449 | Ga0495675_0031721 | 3300047444 | Bacteria | 3373 |
| 450 | Ga0495675_0043171 | 3300047444 | Bacteria | 2873 |
| 451 | Ga0495675_0044461 | 3300047444 | Bacteria | 2829 |
| 452 | Ga0495675_0101791 | 3300047444 | Bacteria | 1797 |
| 453 | Ga0495677_0040808 | 3300047445 | Bacteria | 1697 |
| 454 | Ga0495677_0319884 | 3300047445 | Bacteria | 611 |
| 455 | Ga0495679_116447 | 3300047446 | Bacteria | 733 |
| 456 | Ga0495685_000778 | 3300047447 | Bacteria | 9737 |
| 457 | Ga0495685_004500 | 3300047447 | Bacteria | 4509 |
| 458 | Ga0495685_008344 | 3300047447 | Bacteria | 3438 |
| 459 | Ga0495685_014206 | 3300047447 | Bacteria | 2705 |
| 460 | Ga0495685_017916 | 3300047447 | Bacteria | 2427 |
| 461 | Ga0495685_033159 | 3300047447 | Bacteria | 1774 |
| 462 | Ga0495685_081222 | 3300047447 | Bacteria | 1079 |
| 463 | Ga0495673_0158595 | 3300047469 | Bacteria | 870 |
| 464 | Ga0495681_0004063 | 3300047470 | Bacteria | 10066 |
| 465 | Ga0495681_0009575 | 3300047470 | Bacteria | 5951 |
| 466 | Ga0495681_0049976 | 3300047470 | Bacteria | 1974 |
| 467 | Ga0495681_0074063 | 3300047470 | Bacteria | 1536 |
| 468 | Ga0495681_0123531 | 3300047470 | Bacteria | 1108 |
| 469 | Ga0495684_0101024 | 3300047471 | Bacteria | 2181 |
| 470 | Ga0495686_0014932 | 3300047472 | Bacteria | 5327 |
| 471 | Ga0495686_0054549 | 3300047472 | Bacteria | 2502 |
| 472 | Ga0495686_0124692 | 3300047472 | Bacteria | 1532 |
| 473 | Ga0495593_0003706 | 3300047673 | Bacteria | 9125 |
| 474 | Ga0495593_0034713 | 3300047673 | Bacteria | 2741 |
| 475 | Ga0495593_0275466 | 3300047673 | Bacteria | 842 |
| 476 | Ga0495602_0018549 | 3300048088 | Bacteria | 6943 |
| 477 | Ga0495602_0632923 | 3300048088 | Bacteria | 732 |
| 478 | Ga0495614_0000762 | 3300048089 | Bacteria | 13654 |
| 479 | Ga0495614_0032643 | 3300048089 | Bacteria | 2240 |
| 480 | Ga0495614_0052465 | 3300048089 | Bacteria | 1747 |
| 481 | Ga0495614_0113128 | 3300048089 | Bacteria | 1192 |
| 482 | Ga0495614_0131186 | 3300048089 | Bacteria | 1109 |
| 483 | Ga0495626_0013046 | 3300048091 | Bacteria | 4333 |
| 484 | Ga0496100_0551341 | 3300048903 | Bacteria | 892 |
| 485 | Ga0496102_0258527 | 3300048905 | Bacteria | 1642 |
| 486 | Ga0496109_0027221 | 3300048912 | Bacteria | 5103 |
| 487 | Ga0496110_0187678 | 3300048913 | Bacteria | 1877 |
| 488 | Ga0496113_0813276 | 3300048916 | Bacteria | 742 |
| 489 | Ga0496113_0886114 | 3300048916 | Bacteria | 706 |
| 490 | Ga0496124_0798252 | 3300048927 | Bacteria | 585 |
| 491 | Ga0495678_043912 | 3300049459 | Bacteria | 1771 |
| 492 | Ga0495682_0140059 | 3300049460 | Bacteria | 864 |
| 493 | Ga0501031_0028807 | 3300049568 | Bacteria | 3619 |
| 494 | Ga0501031_0047522 | 3300049568 | Bacteria | 2798 |
| 495 | Ga0501031_0048382 | 3300049568 | Bacteria | 2771 |
| 496 | Ga0501031_0100282 | 3300049568 | Bacteria | 1889 |
| 497 | Ga0501031_0162913 | 3300049568 | Bacteria | 1458 |
| 498 | Ga0501031_0591754 | 3300049568 | Bacteria | 714 |
| 499 | Ga0501031_0663043 | 3300049568 | Bacteria | 670 |
| 500 | Ga0501032_0004893 | 3300049569 | Bacteria | 10026 |
| 501 | Ga0501032_0019445 | 3300049569 | Bacteria | 4752 |
| 502 | Ga0501032_0019559 | 3300049569 | Bacteria | 4735 |
| 503 | Ga0501032_0031825 | 3300049569 | Bacteria | 3616 |
| 504 | Ga0501032_0046785 | 3300049569 | Bacteria | 2923 |
| 505 | Ga0501033_0002071 | 3300049570 | Bacteria | 17426 |
| 506 | Ga0501033_0012983 | 3300049570 | Bacteria | 6353 |
| 507 | Ga0501033_0140986 | 3300049570 | Bacteria | 1742 |
| 508 | Ga0501033_0203535 | 3300049570 | Bacteria | 1413 |
| 509 | Ga0501033_0454388 | 3300049570 | Bacteria | 889 |
| 510 | Ga0501033_0630213 | 3300049570 | Bacteria | 733 |
| 511 | Ga0501034_0007488 | 3300049571 | Bacteria | 11611 |
| 512 | Ga0501034_0027409 | 3300049571 | Bacteria | 5794 |
| 513 | Ga0501034_0027444 | 3300049571 | Bacteria | 5791 |
| 514 | Ga0501034_0104840 | 3300049571 | Bacteria | 2820 |
| 515 | Ga0501034_0160144 | 3300049571 | Bacteria | 2222 |
| 516 | Ga0501034_0240338 | 3300049571 | Bacteria | 1757 |
| 517 | Ga0501034_1252451 | 3300049571 | Bacteria | 619 |
| 518 | Ga0501036_0029018 | 3300049572 | Bacteria | 4676 |
| 519 | Ga0501036_0071114 | 3300049572 | Bacteria | 2941 |
| 520 | Ga0501036_0110506 | 3300049572 | Bacteria | 2322 |
| 521 | Ga0501036_0152940 | 3300049572 | Bacteria | 1946 |
| 522 | Ga0501037_0008710 | 3300049573 | Bacteria | 7436 |
| 523 | Ga0501037_0037533 | 3300049573 | Bacteria | 3572 |
| 524 | Ga0501037_0041679 | 3300049573 | Bacteria | 3376 |
| 525 | Ga0501037_0051209 | 3300049573 | Bacteria | 3020 |
| 526 | Ga0501037_0261434 | 3300049573 | Bacteria | 1209 |
| 527 | Ga0501037_0304226 | 3300049573 | Bacteria | 1106 |
| 528 | Ga0501038_0004798 | 3300049574 | Bacteria | 12563 |
| 529 | Ga0501038_0010841 | 3300049574 | Bacteria | 8328 |
| 530 | Ga0501038_0054508 | 3300049574 | Bacteria | 3439 |
| 531 | Ga0501038_0068534 | 3300049574 | Bacteria | 3015 |
| 532 | Ga0501038_0270448 | 3300049574 | Bacteria | 1340 |
| 533 | Ga0501038_0554041 | 3300049574 | Bacteria | 874 |
| 534 | Ga0501038_0752872 | 3300049574 | Bacteria | 726 |
| 535 | Ga0501039_0008768 | 3300049575 | Bacteria | 7705 |
| 536 | Ga0501039_0123269 | 3300049575 | Bacteria | 2031 |
| 537 | Ga0501039_0512505 | 3300049575 | Bacteria | 942 |
| 538 | Ga0501039_0515784 | 3300049575 | Bacteria | 938 |
| 539 | Ga0501040_0032809 | 3300049576 | Bacteria | 3514 |
| 540 | Ga0501041_0016821 | 3300049577 | Bacteria | 4352 |
| 541 | Ga0501042_0046275 | 3300049578 | Bacteria | 3101 |
| 542 | Ga0501042_0437498 | 3300049578 | Bacteria | 948 |
| 543 | Ga0501042_0734049 | 3300049578 | Bacteria | 718 |
| 544 | Ga0501043_0006511 | 3300049579 | Bacteria | 9370 |
| 545 | Ga0501043_0008928 | 3300049579 | Bacteria | 7890 |
| 546 | Ga0501043_0027864 | 3300049579 | Bacteria | 4434 |
| 547 | Ga0501043_0065798 | 3300049579 | Bacteria | 2846 |
| 548 | Ga0501043_0142473 | 3300049579 | Bacteria | 1876 |
| 549 | Ga0501043_0190454 | 3300049579 | Bacteria | 1595 |
| 550 | Ga0501043_0475831 | 3300049579 | Bacteria | 936 |
| 551 | Ga0501046_0111282 | 3300049580 | Bacteria | 2091 |
| 552 | Ga0501046_0134751 | 3300049580 | Bacteria | 1871 |
| 553 | Ga0501047_0002783 | 3300049581 | Bacteria | 16617 |
| 554 | Ga0501047_0011970 | 3300049581 | Bacteria | 8209 |
| 555 | Ga0501047_0030243 | 3300049581 | Bacteria | 5221 |
| 556 | Ga0501047_0033911 | 3300049581 | Bacteria | 4927 |
| 557 | Ga0501047_0118676 | 3300049581 | Bacteria | 2527 |
| 558 | Ga0501047_0169834 | 3300049581 | Bacteria | 2050 |
| 559 | Ga0501047_0189979 | 3300049581 | Bacteria | 1917 |
| 560 | Ga0501047_0255805 | 3300049581 | Bacteria | 1599 |
| 561 | Ga0501047_0490974 | 3300049581 | Bacteria | 1055 |
| 562 | Ga0501048_0035095 | 3300049582 | Bacteria | 3612 |
| 563 | Ga0501048_0037511 | 3300049582 | Bacteria | 3480 |
| 564 | Ga0501067_0010603 | 3300049583 | Bacteria | 5099 |
| 565 | Ga0501068_0074920 | 3300049584 | Bacteria | 2069 |
| 566 | Ga0501069_0004549 | 3300049585 | Bacteria | 7170 |
| 567 | Ga0501070_0049737 | 3300049586 | Bacteria | 3480 |
| 568 | Ga0501070_0183686 | 3300049586 | Bacteria | 1720 |
| 569 | Ga0501070_0213894 | 3300049586 | Bacteria | 1582 |
| 570 | Ga0501070_1324685 | 3300049586 | Bacteria | 549 |
| 571 | Ga0501071_0013450 | 3300049587 | Bacteria | 5577 |
| 572 | Ga0501072_0005819 | 3300049588 | Bacteria | 9390 |
| 573 | Ga0501073_0009815 | 3300049589 | Bacteria | 7045 |
| 574 | Ga0501073_0125795 | 3300049589 | Bacteria | 1777 |
| 575 | Ga0501074_0325926 | 3300049590 | Bacteria | 1090 |
| 576 | Ga0501077_0054792 | 3300049593 | Bacteria | 2532 |
| 577 | Ga0501079_0008914 | 3300049741 | Bacteria | 7595 |
| 578 | Ga0501080_0043441 | 3300049742 | Bacteria | 4185 |
| 579 | Ga0501080_0046620 | 3300049742 | Bacteria | 4034 |
| 580 | Ga0501083_0007078 | 3300049744 | Bacteria | 7962 |
| 581 | Ga0501035_0035114 | 3300049822 | Bacteria | 4551 |
| 582 | Ga0501035_0048356 | 3300049822 | Bacteria | 3815 |
| 583 | Ga0501035_0179042 | 3300049822 | Bacteria | 1827 |
| 584 | Ga0501035_0227105 | 3300049822 | Bacteria | 1592 |
| 585 | Ga0501035_0250020 | 3300049822 | Bacteria | 1506 |
| 586 | Ga0501035_0334895 | 3300049822 | Bacteria | 1269 |
| 587 | Ga0501035_0602242 | 3300049822 | Bacteria | 895 |
| 588 | Ga0501044_0010468 | 3300049823 | Bacteria | 10063 |
| 589 | Ga0501044_0011729 | 3300049823 | Bacteria | 9492 |
| 590 | Ga0501044_0011825 | 3300049823 | Bacteria | 9456 |
| 591 | Ga0501044_0045099 | 3300049823 | Bacteria | 4571 |
| 592 | Ga0501044_0064552 | 3300049823 | Bacteria | 3737 |
| 593 | Ga0501044_0078050 | 3300049823 | Bacteria | 3356 |
| 594 | Ga0501044_0122272 | 3300049823 | Bacteria | 2602 |
| 595 | Ga0501044_0174836 | 3300049823 | Bacteria | 2117 |
| 596 | Ga0501044_0186816 | 3300049823 | Bacteria | 2036 |
| 597 | Ga0501044_0448254 | 3300049823 | Bacteria | 1197 |
| 598 | Ga0501044_0509651 | 3300049823 | Bacteria | 1103 |
| 599 | Ga0501045_0017787 | 3300049824 | Bacteria | 5048 |
| 600 | Ga0501045_0118231 | 3300049824 | Bacteria | 1967 |
| 601 | Ga0501045_0174387 | 3300049824 | Bacteria | 1602 |
| 602 | nmdc:mga03n38_14218_c1 | 3300050490 | Bacteria | 3044 |
| 603 | nmdc:mga03n38_166880_c1 | 3300050490 | Bacteria | 1118 |
| 604 | nmdc:mga06z11_12423_c1 | 3300050494 | Bacteria | 3704 |
| 605 | nmdc:mga07m45_152927_c1 | 3300050496 | Bacteria | 1338 |
| 606 | Ga0495601_0190628 | 3300053077 | Bacteria | 1340 |
| 607 | Ga0500578_0074757 | 3300053086 | Bacteria | 2158 |
| 608 | Ga0500578_0101155 | 3300053086 | Bacteria | 1824 |
| 609 | Ga0500643_157121 | 3300053087 | Bacteria | 610 |
| 610 | Ga0500583_0138571 | 3300053092 | Bacteria | 1208 |
| 611 | Ga0500566_0186833 | 3300053094 | Bacteria | 1058 |
| 612 | Ga0500640_020336 | 3300053095 | Bacteria | 2852 |
| 613 | Ga0500641_0203838 | 3300053096 | Bacteria | 843 |
| 614 | Ga0500641_0313674 | 3300053096 | Bacteria | 640 |
| 615 | Ga0500654_129155 | 3300053099 | Bacteria | 963 |
| 616 | Ga0500660_144907 | 3300053100 | Bacteria | 935 |
| 617 | Ga0500553_214185 | 3300053101 | Bacteria | 638 |
| 618 | Ga0500556_0180274 | 3300053104 | Bacteria | 835 |
| 619 | Ga0500557_178373 | 3300053105 | Bacteria | 691 |
| 620 | Ga0500560_003059 | 3300053107 | Bacteria | 3317 |
| 621 | Ga0500560_004466 | 3300053107 | Bacteria | 2981 |
| 622 | Ga0500560_035928 | 3300053107 | Bacteria | 1528 |
| 623 | Ga0500569_084559 | 3300053109 | Bacteria | 1019 |
| 624 | Ga0500572_046699 | 3300053111 | Bacteria | 1277 |
| 625 | Ga0500614_066134 | 3300053123 | Bacteria | 982 |
| 626 | Ga0500614_100091 | 3300053123 | Bacteria | 835 |
| 627 | Ga0500628_091356 | 3300053129 | Bacteria | 793 |
| 628 | Ga0500652_050659 | 3300053131 | Bacteria | 1694 |
| 629 | Ga0500658_0014745 | 3300053134 | Bacteria | 2894 |
| 630 | Ga0500561_0102750 | 3300053137 | Bacteria | 857 |
| 631 | Ga0500568_0267803 | 3300053139 | Bacteria | 621 |
| 632 | Ga0500573_0033239 | 3300053140 | Bacteria | 2977 |
| 633 | Ga0500573_0052189 | 3300053140 | Bacteria | 2351 |
| 634 | Ga0500573_0306925 | 3300053140 | Bacteria | 790 |
| 635 | Ga0500588_0080447 | 3300053146 | Bacteria | 1089 |
| 636 | Ga0500589_325700 | 3300053147 | Bacteria | 535 |
| 637 | Ga0500600_0004613 | 3300053149 | Bacteria | 8101 |
| 638 | Ga0500600_0122439 | 3300053149 | Bacteria | 1338 |
| 639 | Ga0500616_0012533 | 3300053153 | Bacteria | 4958 |
| 640 | Ga0500633_0019571 | 3300053160 | Bacteria | 2026 |
| 641 | Ga0500633_0118032 | 3300053160 | Bacteria | 986 |
| 642 | Ga0500634_0096496 | 3300053161 | Bacteria | 1488 |
| 643 | Ga0500636_0304403 | 3300053177 | Bacteria | 783 |
| 644 | Ga0500656_008315 | 3300053732 | Bacteria | 1098 |
| 645 | Ga0500587_012775 | 3300053739 | Bacteria | 1058 |
| 646 | Ga0501084_0006017 | 3300054114 | Bacteria | 9975 |
| 647 | Ga0501082_0174901 | 3300060353 | Bacteria | 1867 |
| 648 | Ga0466962_0000163 | 3300061719 | Bacteria | 28323 |
| 649 | Ga0466962_0011589 | 3300061719 | Bacteria | 4246 |
| 650 | Ga0466962_0249241 | 3300061719 | Bacteria | 872 |
| 651 | Ga0530510_0296286 | 3300061734 | Bacteria | 1210 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300010375 | Ga0105239_11253092 | Ga0105239_112530921 | 146 |
| 2 | 3300049586 | Ga0501070_1324685 | Ga0501070_1324685_85_534 | 146 |
| 3 | iso_pu_bacteria | 2862290372 | 2862294501 | 149 |
| 4 | iso_pu_bacteria | 2877676314 | 2877680759 | 149 |
| 5 | iso_pu_bacteria | 2984576629 | 2984576915 | 149 |
| 6 | iso_pu_bacteria | 2990256926 | 2990258662 | 149 |
| 7 | iso_pu_bacteria | 3006321560 | 3006325610 | 149 |
| 8 | iso_pu_bacteria | 8054609563 | 8054610322 | 149 |
| 9 | iso_pu_bacteria | 8056207758 | 8056210357 | 149 |
| 10 | iso_pu_bacteria | 2863404153 | 2863404226 | 150 |
| 11 | iso_pu_bacteria | 2867369537 | 2867370525 | 150 |
| 12 | 3300005548 | Ga0070665_100304078 | Ga0070665_1003040782 | 151 |
| 13 | 3300028379 | Ga0268266_11488576 | Ga0268266_114885762 | 151 |
| 14 | iso_pu_bacteria | 2643221548 | 2643763057 | 151 |
| 15 | iso_pu_bacteria | 2643221682 | 2644464085 | 151 |
| 16 | iso_pu_bacteria | 2767802112 | 2768646205 | 151 |
| 17 | iso_pu_bacteria | 2862705112 | 2862709410 | 151 |
| 18 | iso_pu_bacteria | 2867346516 | 2867350585 | 151 |
| 19 | iso_pu_bacteria | 2867428634 | 2867433671 | 151 |
| 20 | iso_pu_bacteria | 2919446982 | 2919450529 | 151 |
| 21 | iso_pu_bacteria | 2990044586 | 2990049137 | 151 |
| 22 | iso_pu_bacteria | 3006393351 | 3006397422 | 151 |
| 23 | iso_pu_bacteria | 8008485437 | 8008489956 | 151 |
| 24 | iso_pu_bacteria | 8008574985 | 8008578592 | 151 |
| 25 | iso_pu_bacteria | 8025524527 | 8025529311 | 151 |
| 26 | 3300041498 | Ga0451841_0983366 | Ga0451841_0983366_31_489 | 152 |
| 27 | iso_pu_bacteria | 2547132111 | 2547405984 | 152 |
| 28 | iso_pu_bacteria | 2582581312 | 2585300259 | 152 |
| 29 | iso_pu_bacteria | 2582581313 | 2585311016 | 152 |
| 30 | iso_pu_bacteria | 2582581314 | 2585314449 | 152 |
| 31 | iso_pu_bacteria | 2616644814 | 2616700252 | 152 |
| 32 | iso_pu_bacteria | 2643221578 | 2643900037 | 152 |
| 33 | iso_pu_bacteria | 2643221647 | 2644262970 | 152 |
| 34 | iso_pu_bacteria | 2643221673 | 2644405739 | 152 |
| 35 | iso_pu_bacteria | 2643221678 | 2644443193 | 152 |
| 36 | iso_pu_bacteria | 2643221714 | 2644626992 | 152 |
| 37 | iso_pu_bacteria | 2784132148 | 2784588922 | 152 |
| 38 | iso_pu_bacteria | 2784746768 | 2785369872 | 152 |
| 39 | iso_pu_bacteria | 2786546132 | 2786670952 | 152 |
| 40 | iso_pu_bacteria | 2791355406 | 2793980905 | 152 |
| 41 | iso_pu_bacteria | 2808606359 | 2808842366 | 152 |
| 42 | iso_pu_bacteria | 2808606375 | 2808920890 | 152 |
| 43 | iso_pu_bacteria | 2808606448 | 2809232541 | 152 |
| 44 | iso_pu_bacteria | 2811994879 | 2812357736 | 152 |
| 45 | iso_pu_bacteria | 2811994917 | 2812480223 | 152 |
| 46 | iso_pu_bacteria | 2818991463 | 2819697219 | 152 |
| 47 | iso_pu_bacteria | 2852635781 | 2852637141 | 152 |
| 48 | iso_pu_bacteria | 2862281513 | 2862285988 | 152 |
| 49 | iso_pu_bacteria | 2862382967 | 2862389625 | 152 |
| 50 | iso_pu_bacteria | 2862507626 | 2862508027 | 152 |
| 51 | iso_pu_bacteria | 2862574272 | 2862578925 | 152 |
| 52 | iso_pu_bacteria | 2867475112 | 2867481258 | 152 |
| 53 | iso_pu_bacteria | 2875391855 | 2875395277 | 152 |
| 54 | iso_pu_bacteria | 2912715099 | 2912719496 | 152 |
| 55 | iso_pu_bacteria | 2912723979 | 2912731346 | 152 |
| 56 | iso_pu_bacteria | 2912757875 | 2912761186 | 152 |
| 57 | iso_pu_bacteria | 2919468124 | 2919471957 | 152 |
| 58 | iso_pu_bacteria | 2946045630 | 2946049612 | 152 |
| 59 | iso_pu_bacteria | 2946064051 | 2946068135 | 152 |
| 60 | iso_pu_bacteria | 2946072368 | 2946076225 | 152 |
| 61 | iso_pu_bacteria | 2947224130 | 2947228804 | 152 |
| 62 | iso_pu_bacteria | 2954002825 | 2954006731 | 152 |
| 63 | iso_pu_bacteria | 2954380949 | 2954385865 | 152 |
| 64 | iso_pu_bacteria | 2954673503 | 2954677278 | 152 |
| 65 | iso_pu_bacteria | 2954682443 | 2954686874 | 152 |
| 66 | iso_pu_bacteria | 2954691527 | 2954696524 | 152 |
| 67 | iso_pu_bacteria | 2954701450 | 2954705762 | 152 |
| 68 | iso_pu_bacteria | 2954711539 | 2954715886 | 152 |
| 69 | iso_pu_bacteria | 2954721474 | 2954725808 | 152 |
| 70 | iso_pu_bacteria | 2954731030 | 2954735994 | 152 |
| 71 | iso_pu_bacteria | 2954740390 | 2954744763 | 152 |
| 72 | iso_pu_bacteria | 2954749733 | 2954754836 | 152 |
| 73 | iso_pu_bacteria | 2954759201 | 2954763725 | 152 |
| 74 | iso_pu_bacteria | 2966598605 | 2966602031 | 152 |
| 75 | iso_pu_bacteria | 2990059506 | 2990064994 | 152 |
| 76 | iso_pu_bacteria | 2997600082 | 2997606688 | 152 |
| 77 | iso_pu_bacteria | 3006493962 | 3006499308 | 152 |
| 78 | iso_pu_bacteria | 8008558824 | 8008566921 | 152 |
| 79 | iso_pu_bacteria | 8023623736 | 8023624051 | 152 |
| 80 | iso_pu_bacteria | 8025530807 | 8025534277 | 152 |
| 81 | iso_pu_bacteria | 8033684223 | 8033689086 | 152 |
| 82 | iso_pu_bacteria | 8047893842 | 8047899714 | 152 |
| 83 | iso_pu_bacteria | 8048127548 | 8048129004 | 152 |
| 84 | iso_pu_bacteria | 8048356638 | 8048359217 | 152 |
| 85 | iso_pu_bacteria | 8048369669 | 8048376662 | 152 |
| 86 | iso_pu_bacteria | 8048379754 | 8048385715 | 152 |
| 87 | iso_pu_bacteria | 8048406513 | 8048409467 | 152 |
| 88 | iso_pu_bacteria | 8054160619 | 8054163569 | 152 |
| 89 | iso_pu_bacteria | 8056829672 | 8056833347 | 152 |
| 90 | 3300003316 | rootH1_10033732 | rootH1_100337324 | 153 |
| 91 | 3300003322 | rootL2_10210732 | rootL2_102107322 | 153 |
| 92 | 3300003323 | rootH1_10152422 | rootH1_101524222 | 153 |
| 93 | 3300005458 | Ga0070681_10359612 | Ga0070681_103596121 | 153 |
| 94 | 3300014969 | Ga0157376_10944088 | Ga0157376_109440881 | 153 |
| 95 | 3300022467 | Ga0224712_10241416 | Ga0224712_102414161 | 153 |
| 96 | 3300025935 | Ga0207709_10962978 | Ga0207709_109629781 | 153 |
| 97 | 3300028794 | Ga0307515_10581538 | Ga0307515_105815382 | 153 |
| 98 | 3300030521 | Ga0307511_10248197 | Ga0307511_102481971 | 153 |
| 99 | 3300031616 | Ga0307508_10724499 | Ga0307508_107244991 | 153 |
| 100 | 3300033180 | Ga0307510_10494631 | Ga0307510_104946311 | 153 |
| 101 | 3300041494 | Ga0451837_0989560 | Ga0451837_0989560_706_1167 | 153 |
| 102 | 3300046454 | Ga0495592_0086204 | Ga0495592_0086204_741_1202 | 153 |
| 103 | 3300046459 | Ga0495629_0016632 | Ga0495629_0016632_3587_4048 | 153 |
| 104 | 3300046459 | Ga0495629_0317301 | Ga0495629_0317301_235_696 | 153 |
| 105 | 3300046492 | Ga0495585_0007936 | Ga0495585_0007936_5730_6191 | 153 |
| 106 | 3300046492 | Ga0495585_0088060 | Ga0495585_0088060_441_902 | 153 |
| 107 | 3300046501 | Ga0495607_0095114 | Ga0495607_0095114_738_1199 | 153 |
| 108 | 3300046513 | Ga0495616_0334252 | Ga0495616_0334252_67_528 | 153 |
| 109 | 3300046515 | Ga0495620_0057291 | Ga0495620_0057291_1152_1613 | 153 |
| 110 | 3300046526 | Ga0495666_0488619 | Ga0495666_0488619_54_515 | 153 |
| 111 | 3300046528 | Ga0495642_0204514 | Ga0495642_0204514_130_591 | 153 |
| 112 | 3300046529 | Ga0495652_0018776 | Ga0495652_0018776_5148_5609 | 153 |
| 113 | 3300046533 | Ga0495640_0005132 | Ga0495640_0005132_7061_7522 | 153 |
| 114 | 3300046538 | Ga0495609_0037075 | Ga0495609_0037075_216_677 | 153 |
| 115 | 3300046642 | Ga0495634_0036930 | Ga0495634_0036930_501_962 | 153 |
| 116 | 3300046660 | Ga0495625_0139786 | Ga0495625_0139786_544_1005 | 153 |
| 117 | 3300046675 | Ga0495657_0289018 | Ga0495657_0289018_41_502 | 153 |
| 118 | 3300046689 | Ga0495613_0391034 | Ga0495613_0391034_459_920 | 153 |
| 119 | 3300046691 | Ga0495670_0106878 | Ga0495670_0106878_918_1379 | 153 |
| 120 | 3300046692 | Ga0495671_0058976 | Ga0495671_0058976_913_1374 | 153 |
| 121 | 3300046794 | Ga0495589_0072839 | Ga0495589_0072839_449_910 | 153 |
| 122 | 3300047317 | Ga0495604_0017363 | Ga0495604_0017363_5238_5699 | 153 |
| 123 | 3300047317 | Ga0495604_0206185 | Ga0495604_0206185_499_960 | 153 |
| 124 | 3300047318 | Ga0495636_0296473 | Ga0495636_0296473_130_591 | 153 |
| 125 | 3300047321 | Ga0495676_0024429 | Ga0495676_0024429_546_1007 | 153 |
| 126 | 3300047323 | Ga0495683_0012497 | Ga0495683_0012497_2722_3183 | 153 |
| 127 | 3300047447 | Ga0495685_008344 | Ga0495685_008344_789_1250 | 153 |
| 128 | 3300049568 | Ga0501031_0028807 | Ga0501031_0028807_1153_1614 | 153 |
| 129 | 3300049568 | Ga0501031_0048382 | Ga0501031_0048382_2218_2679 | 153 |
| 130 | 3300049568 | Ga0501031_0162913 | Ga0501031_0162913_802_1263 | 153 |
| 131 | 3300049569 | Ga0501032_0004893 | Ga0501032_0004893_2632_3093 | 153 |
| 132 | 3300049569 | Ga0501032_0019559 | Ga0501032_0019559_4264_4725 | 153 |
| 133 | 3300049569 | Ga0501032_0031825 | Ga0501032_0031825_2528_2989 | 153 |
| 134 | 3300049570 | Ga0501033_0012983 | Ga0501033_0012983_133_594 | 153 |
| 135 | 3300049570 | Ga0501033_0630213 | Ga0501033_0630213_184_645 | 153 |
| 136 | 3300049571 | Ga0501034_0027444 | Ga0501034_0027444_392_853 | 153 |
| 137 | 3300049571 | Ga0501034_1252451 | Ga0501034_1252451_92_553 | 153 |
| 138 | 3300049572 | Ga0501036_0071114 | Ga0501036_0071114_2392_2853 | 153 |
| 139 | 3300049572 | Ga0501036_0110506 | Ga0501036_0110506_615_1076 | 153 |
| 140 | 3300049573 | Ga0501037_0008710 | Ga0501037_0008710_2056_2517 | 153 |
| 141 | 3300049573 | Ga0501037_0037533 | Ga0501037_0037533_51_512 | 153 |
| 142 | 3300049573 | Ga0501037_0051209 | Ga0501037_0051209_472_933 | 153 |
| 143 | 3300049574 | Ga0501038_0068534 | Ga0501038_0068534_2023_2484 | 153 |
| 144 | 3300049574 | Ga0501038_0752872 | Ga0501038_0752872_17_478 | 153 |
| 145 | 3300049575 | Ga0501039_0008768 | Ga0501039_0008768_3100_3561 | 153 |
| 146 | 3300049575 | Ga0501039_0123269 | Ga0501039_0123269_1482_1943 | 153 |
| 147 | 3300049576 | Ga0501040_0032809 | Ga0501040_0032809_2520_2981 | 153 |
| 148 | 3300049577 | Ga0501041_0016821 | Ga0501041_0016821_2709_3170 | 153 |
| 149 | 3300049578 | Ga0501042_0046275 | Ga0501042_0046275_249_710 | 153 |
| 150 | 3300049578 | Ga0501042_0437498 | Ga0501042_0437498_457_918 | 153 |
| 151 | 3300049579 | Ga0501043_0006511 | Ga0501043_0006511_7912_8373 | 153 |
| 152 | 3300049579 | Ga0501043_0027864 | Ga0501043_0027864_3287_3748 | 153 |
| 153 | 3300049579 | Ga0501043_0142473 | Ga0501043_0142473_1213_1674 | 153 |
| 154 | 3300049580 | Ga0501046_0111282 | Ga0501046_0111282_392_853 | 153 |
| 155 | 3300049581 | Ga0501047_0030243 | Ga0501047_0030243_4006_4467 | 153 |
| 156 | 3300049581 | Ga0501047_0118676 | Ga0501047_0118676_820_1281 | 153 |
| 157 | 3300049581 | Ga0501047_0169834 | Ga0501047_0169834_599_1060 | 153 |
| 158 | 3300049581 | Ga0501047_0189979 | Ga0501047_0189979_842_1303 | 153 |
| 159 | 3300049581 | Ga0501047_0490974 | Ga0501047_0490974_35_496 | 153 |
| 160 | 3300049582 | Ga0501048_0037511 | Ga0501048_0037511_2006_2467 | 153 |
| 161 | 3300049583 | Ga0501067_0010603 | Ga0501067_0010603_4258_4719 | 153 |
| 162 | 3300049584 | Ga0501068_0074920 | Ga0501068_0074920_446_907 | 153 |
| 163 | 3300049585 | Ga0501069_0004549 | Ga0501069_0004549_6621_7082 | 153 |
| 164 | 3300049586 | Ga0501070_0049737 | Ga0501070_0049737_1014_1475 | 153 |
| 165 | 3300049586 | Ga0501070_0183686 | Ga0501070_0183686_629_1090 | 153 |
| 166 | 3300049587 | Ga0501071_0013450 | Ga0501071_0013450_5028_5489 | 153 |
| 167 | 3300049588 | Ga0501072_0005819 | Ga0501072_0005819_3717_4178 | 153 |
| 168 | 3300049589 | Ga0501073_0009815 | Ga0501073_0009815_4702_5163 | 153 |
| 169 | 3300049590 | Ga0501074_0325926 | Ga0501074_0325926_249_710 | 153 |
| 170 | 3300049593 | Ga0501077_0054792 | Ga0501077_0054792_1500_1961 | 153 |
| 171 | 3300049741 | Ga0501079_0008914 | Ga0501079_0008914_4743_5204 | 153 |
| 172 | 3300049742 | Ga0501080_0046620 | Ga0501080_0046620_1610_2071 | 153 |
| 173 | 3300049744 | Ga0501083_0007078 | Ga0501083_0007078_5141_5602 | 153 |
| 174 | 3300049822 | Ga0501035_0035114 | Ga0501035_0035114_1199_1660 | 153 |
| 175 | 3300049822 | Ga0501035_0179042 | Ga0501035_0179042_1124_1585 | 153 |
| 176 | 3300049822 | Ga0501035_0250020 | Ga0501035_0250020_266_727 | 153 |
| 177 | 3300049823 | Ga0501044_0064552 | Ga0501044_0064552_1611_2072 | 153 |
| 178 | 3300049823 | Ga0501044_0122272 | Ga0501044_0122272_1181_1642 | 153 |
| 179 | 3300049823 | Ga0501044_0174836 | Ga0501044_0174836_220_681 | 153 |
| 180 | 3300049823 | Ga0501044_0186816 | Ga0501044_0186816_1184_1645 | 153 |
| 181 | 3300049824 | Ga0501045_0017787 | Ga0501045_0017787_2520_2981 | 153 |
| 182 | 3300049824 | Ga0501045_0118231 | Ga0501045_0118231_1266_1727 | 153 |
| 183 | 3300054114 | Ga0501084_0006017 | Ga0501084_0006017_3066_3527 | 153 |
| 184 | 3300060353 | Ga0501082_0174901 | Ga0501082_0174901_376_837 | 153 |
| 185 | 3300061734 | Ga0530510_0296286 | Ga0530510_0296286_286_747 | 153 |
| 186 | 3300005366 | Ga0070659_100618232 | Ga0070659_1006182321 | 154 |
| 187 | 3300005456 | Ga0070678_100978085 | Ga0070678_1009780852 | 154 |
| 188 | 3300005539 | Ga0068853_100104923 | Ga0068853_1001049234 | 154 |
| 189 | 3300005563 | Ga0068855_100023062 | Ga0068855_1000230627 | 154 |
| 190 | 3300005577 | Ga0068857_100269982 | Ga0068857_1002699821 | 154 |
| 191 | 3300005614 | Ga0068856_100010663 | Ga0068856_1000106637 | 154 |
| 192 | 3300005615 | Ga0070702_100991800 | Ga0070702_1009918002 | 154 |
| 193 | 3300005616 | Ga0068852_100001014 | Ga0068852_10000101411 | 154 |
| 194 | 3300009093 | Ga0105240_10076356 | Ga0105240_100763565 | 154 |
| 195 | 3300009093 | Ga0105240_10907819 | Ga0105240_109078192 | 154 |
| 196 | 3300009174 | Ga0105241_10001341 | Ga0105241_1000134113 | 154 |
| 197 | 3300010375 | Ga0105239_10014936 | Ga0105239_100149363 | 154 |
| 198 | 3300010375 | Ga0105239_11323169 | Ga0105239_113231692 | 154 |
| 199 | 3300013308 | Ga0157375_12561578 | Ga0157375_125615781 | 154 |
| 200 | 3300014326 | Ga0157380_10600838 | Ga0157380_106008382 | 154 |
| 201 | 3300022467 | Ga0224712_10045281 | Ga0224712_100452812 | 154 |
| 202 | 3300025911 | Ga0207654_10009813 | Ga0207654_100098132 | 154 |
| 203 | 3300025913 | Ga0207695_10004099 | Ga0207695_100040993 | 154 |
| 204 | 3300025914 | Ga0207671_10000128 | Ga0207671_10000128108 | 154 |
| 205 | 3300025924 | Ga0207694_10207057 | Ga0207694_102070572 | 154 |
| 206 | 3300025949 | Ga0207667_10055281 | Ga0207667_100552813 | 154 |
| 207 | 3300025981 | Ga0207640_10379866 | Ga0207640_103798661 | 154 |
| 208 | 3300026041 | Ga0207639_10085880 | Ga0207639_100858804 | 154 |
| 209 | 3300026075 | Ga0207708_10312671 | Ga0207708_103126712 | 154 |
| 210 | 3300026078 | Ga0207702_10249966 | Ga0207702_102499662 | 154 |
| 211 | 3300026116 | Ga0207674_10947892 | Ga0207674_109478921 | 154 |
| 212 | 3300026118 | Ga0207675_100068085 | Ga0207675_1000680851 | 154 |
| 213 | 3300026121 | Ga0207683_11356060 | Ga0207683_113560602 | 154 |
| 214 | 3300026142 | Ga0207698_10349870 | Ga0207698_103498702 | 154 |
| 215 | 3300028379 | Ga0268266_10179042 | Ga0268266_101790422 | 154 |
| 216 | 3300031995 | Ga0307409_100119570 | Ga0307409_1001195703 | 154 |
| 217 | 3300032005 | Ga0307411_10634545 | Ga0307411_106345452 | 154 |
| 218 | 3300037312 | Ga0395899_0580091 | Ga0395899_0580091_204_668 | 154 |
| 219 | 3300037418 | Ga0395900_0179671 | Ga0395900_0179671_1239_1703 | 154 |
| 220 | 3300037466 | Ga0395898_0001397 | Ga0395898_0001397_13917_14381 | 154 |
| 221 | 3300038443 | Ga0395901_0078391 | Ga0395901_0078391_770_1234 | 154 |
| 222 | 3300041453 | Ga0451797_0889241 | Ga0451797_0889241_278_742 | 154 |
| 223 | 3300044656 | Ga0466969_0005631 | Ga0466969_0005631_2726_3190 | 154 |
| 224 | 3300044693 | Ga0466961_0034399 | Ga0466961_0034399_1678_2142 | 154 |
| 225 | 3300044693 | Ga0466961_0062799 | Ga0466961_0062799_1385_1849 | 154 |
| 226 | 3300044765 | Ga0466970_0016652 | Ga0466970_0016652_35_499 | 154 |
| 227 | 3300045836 | Ga0466958_0136775 | Ga0466958_0136775_878_1342 | 154 |
| 228 | 3300046462 | Ga0495651_0001478 | Ga0495651_0001478_17164_17628 | 154 |
| 229 | 3300046516 | Ga0495628_0006091 | Ga0495628_0006091_194_658 | 154 |
| 230 | 3300046529 | Ga0495652_0002292 | Ga0495652_0002292_18813_19277 | 154 |
| 231 | 3300046809 | Ga0495600_0004676 | Ga0495600_0004676_5462_5926 | 154 |
| 232 | 3300047315 | Ga0495581_0389546 | Ga0495581_0389546_261_725 | 154 |
| 233 | 3300047317 | Ga0495604_0409596 | Ga0495604_0409596_144_608 | 154 |
| 234 | 3300049568 | Ga0501031_0047522 | Ga0501031_0047522_1230_1694 | 154 |
| 235 | 3300049570 | Ga0501033_0203535 | Ga0501033_0203535_362_826 | 154 |
| 236 | 3300049571 | Ga0501034_0027409 | Ga0501034_0027409_1826_2290 | 154 |
| 237 | 3300049574 | Ga0501038_0010841 | Ga0501038_0010841_5902_6366 | 154 |
| 238 | 3300049575 | Ga0501039_0512505 | Ga0501039_0512505_14_478 | 154 |
| 239 | 3300049575 | Ga0501039_0515784 | Ga0501039_0515784_14_478 | 154 |
| 240 | 3300049579 | Ga0501043_0008928 | Ga0501043_0008928_2902_3366 | 154 |
| 241 | 3300049581 | Ga0501047_0002783 | Ga0501047_0002783_8112_8576 | 154 |
| 242 | 3300049823 | Ga0501044_0011729 | Ga0501044_0011729_6154_6618 | 154 |
| 243 | 3300053077 | Ga0495601_0190628 | Ga0495601_0190628_743_1207 | 154 |
| 244 | 3300053140 | Ga0500573_0306925 | Ga0500573_0306925_188_652 | 154 |
| 245 | iso_pu_bacteria | 2990088156 | 2990092272 | 154 |
| 246 | 3300005539 | Ga0068853_101139383 | Ga0068853_1011393831 | 155 |
| 247 | 3300009148 | Ga0105243_12657826 | Ga0105243_126578261 | 155 |
| 248 | 3300014497 | Ga0182008_10002267 | Ga0182008_100022675 | 155 |
| 249 | 3300015262 | Ga0182007_10004465 | Ga0182007_100044653 | 155 |
| 250 | 3300025927 | Ga0207687_10076420 | Ga0207687_100764202 | 155 |
| 251 | 3300026041 | Ga0207639_10176724 | Ga0207639_101767242 | 155 |
| 252 | 3300028794 | Ga0307515_10000928 | Ga0307515_1000092850 | 155 |
| 253 | 3300030521 | Ga0307511_10000945 | Ga0307511_1000094533 | 155 |
| 254 | 3300030521 | Ga0307511_10057234 | Ga0307511_100572342 | 155 |
| 255 | 3300030522 | Ga0307512_10240452 | Ga0307512_102404522 | 155 |
| 256 | 3300030744 | Ga0316181_1127688 | Ga0316181_11276881 | 155 |
| 257 | 3300031507 | Ga0307509_10076738 | Ga0307509_100767382 | 155 |
| 258 | 3300031507 | Ga0307509_10252668 | Ga0307509_102526682 | 155 |
| 259 | 3300031616 | Ga0307508_10022735 | Ga0307508_100227352 | 155 |
| 260 | 3300031616 | Ga0307508_10198007 | Ga0307508_101980072 | 155 |
| 261 | 3300031649 | Ga0307514_10208235 | Ga0307514_102082351 | 155 |
| 262 | 3300031665 | Ga0316575_10051119 | Ga0316575_100511193 | 155 |
| 263 | 3300031730 | Ga0307516_10144310 | Ga0307516_101443102 | 155 |
| 264 | 3300031838 | Ga0307518_10271488 | Ga0307518_102714881 | 155 |
| 265 | 3300033179 | Ga0307507_10017128 | Ga0307507_100171284 | 155 |
| 266 | 3300033179 | Ga0307507_10028020 | Ga0307507_100280205 | 155 |
| 267 | 3300033180 | Ga0307510_10041179 | Ga0307510_100411793 | 155 |
| 268 | 3300033180 | Ga0307510_10121601 | Ga0307510_101216013 | 155 |
| 269 | 3300033180 | Ga0307510_10219680 | Ga0307510_102196801 | 155 |
| 270 | 3300038443 | Ga0395901_0096424 | Ga0395901_0096424_1742_2209 | 155 |
| 271 | 3300041406 | Ga0439439_0066166 | Ga0439439_0066166_480_947 | 155 |
| 272 | 3300042007 | Ga0439449_0084120 | Ga0439449_0084120_556_1023 | 155 |
| 273 | 3300042131 | Ga0450894_000065 | Ga0450894_000065_2687_3157 | 155 |
| 274 | 3300042132 | Ga0450895_005044 | Ga0450895_005044_11_481 | 155 |
| 275 | 3300042133 | Ga0450896_001817 | Ga0450896_001817_926_1396 | 155 |
| 276 | 3300042134 | Ga0450898_005535 | Ga0450898_005535_301_771 | 155 |
| 277 | 3300042135 | Ga0450899_000511 | Ga0450899_000511_3876_4346 | 155 |
| 278 | 3300042139 | Ga0450904_013758 | Ga0450904_013758_87_557 | 155 |
| 279 | 3300042145 | Ga0450906_000844 | Ga0450906_000844_526_996 | 155 |
| 280 | 3300042184 | Ga0450908_032289 | Ga0450908_032289_323_793 | 155 |
| 281 | 3300045976 | Ga0466967_0016389 | Ga0466967_0016389_4588_5055 | 155 |
| 282 | 3300045976 | Ga0466967_0883424 | Ga0466967_0883424_316_786 | 155 |
| 283 | 3300046454 | Ga0495592_0159822 | Ga0495592_0159822_862_1329 | 155 |
| 284 | 3300046459 | Ga0495629_0015401 | Ga0495629_0015401_668_1135 | 155 |
| 285 | 3300046462 | Ga0495651_0101094 | Ga0495651_0101094_1450_1917 | 155 |
| 286 | 3300046476 | Ga0495662_0000395 | Ga0495662_0000395_6195_6662 | 155 |
| 287 | 3300046477 | Ga0495664_0004484 | Ga0495664_0004484_178_645 | 155 |
| 288 | 3300046514 | Ga0495618_0041048 | Ga0495618_0041048_2262_2729 | 155 |
| 289 | 3300046516 | Ga0495628_0287576 | Ga0495628_0287576_70_537 | 155 |
| 290 | 3300046517 | Ga0495630_0076146 | Ga0495630_0076146_1079_1546 | 155 |
| 291 | 3300046518 | Ga0495631_0150477 | Ga0495631_0150477_68_535 | 155 |
| 292 | 3300046524 | Ga0495648_0219270 | Ga0495648_0219270_12_479 | 155 |
| 293 | 3300046529 | Ga0495652_0690736 | Ga0495652_0690736_121_588 | 155 |
| 294 | 3300046533 | Ga0495640_0170785 | Ga0495640_0170785_894_1361 | 155 |
| 295 | 3300046535 | Ga0495586_0041897 | Ga0495586_0041897_1263_1730 | 155 |
| 296 | 3300046543 | Ga0495645_0017508 | Ga0495645_0017508_2251_2718 | 155 |
| 297 | 3300046559 | Ga0495667_0144260 | Ga0495667_0144260_983_1450 | 155 |
| 298 | 3300046642 | Ga0495634_0027789 | Ga0495634_0027789_1840_2307 | 155 |
| 299 | 3300046660 | Ga0495625_0027694 | Ga0495625_0027694_307_774 | 155 |
| 300 | 3300046663 | Ga0495635_0000602 | Ga0495635_0000602_21192_21659 | 155 |
| 301 | 3300046675 | Ga0495657_0002328 | Ga0495657_0002328_7156_7623 | 155 |
| 302 | 3300046680 | Ga0495646_0000580 | Ga0495646_0000580_16879_17346 | 155 |
| 303 | 3300046683 | Ga0495658_0087961 | Ga0495658_0087961_734_1201 | 155 |
| 304 | 3300046689 | Ga0495613_0001160 | Ga0495613_0001160_8449_8916 | 155 |
| 305 | 3300046692 | Ga0495671_0007931 | Ga0495671_0007931_2003_2470 | 155 |
| 306 | 3300047315 | Ga0495581_0017554 | Ga0495581_0017554_1870_2337 | 155 |
| 307 | 3300047317 | Ga0495604_0000226 | Ga0495604_0000226_45977_46444 | 155 |
| 308 | 3300047319 | Ga0495674_0041092 | Ga0495674_0041092_1560_2027 | 155 |
| 309 | 3300047321 | Ga0495676_0018192 | Ga0495676_0018192_311_778 | 155 |
| 310 | 3300047443 | Ga0495687_028005 | Ga0495687_028005_1270_1737 | 155 |
| 311 | 3300047444 | Ga0495675_0043171 | Ga0495675_0043171_1875_2342 | 155 |
| 312 | 3300047445 | Ga0495677_0319884 | Ga0495677_0319884_33_500 | 155 |
| 313 | 3300047470 | Ga0495681_0004063 | Ga0495681_0004063_2524_2991 | 155 |
| 314 | 3300047472 | Ga0495686_0124692 | Ga0495686_0124692_37_504 | 155 |
| 315 | 3300047673 | Ga0495593_0003706 | Ga0495593_0003706_3290_3757 | 155 |
| 316 | 3300048088 | Ga0495602_0018549 | Ga0495602_0018549_171_638 | 155 |
| 317 | 3300048089 | Ga0495614_0032643 | Ga0495614_0032643_1750_2217 | 155 |
| 318 | 3300048903 | Ga0496100_0551341 | Ga0496100_0551341_388_855 | 155 |
| 319 | 3300049568 | Ga0501031_0591754 | Ga0501031_0591754_75_542 | 155 |
| 320 | 3300049569 | Ga0501032_0019445 | Ga0501032_0019445_2495_2962 | 155 |
| 321 | 3300049571 | Ga0501034_0104840 | Ga0501034_0104840_1412_1879 | 155 |
| 322 | 3300049571 | Ga0501034_0160144 | Ga0501034_0160144_1119_1595 | 155 |
| 323 | 3300049572 | Ga0501036_0152940 | Ga0501036_0152940_623_1090 | 155 |
| 324 | 3300049573 | Ga0501037_0041679 | Ga0501037_0041679_2877_3353 | 155 |
| 325 | 3300049573 | Ga0501037_0261434 | Ga0501037_0261434_484_951 | 155 |
| 326 | 3300049574 | Ga0501038_0004798 | Ga0501038_0004798_5454_5921 | 155 |
| 327 | 3300049578 | Ga0501042_0734049 | Ga0501042_0734049_50_517 | 155 |
| 328 | 3300049579 | Ga0501043_0190454 | Ga0501043_0190454_194_661 | 155 |
| 329 | 3300049579 | Ga0501043_0475831 | Ga0501043_0475831_340_816 | 155 |
| 330 | 3300049580 | Ga0501046_0134751 | Ga0501046_0134751_1125_1601 | 155 |
| 331 | 3300049581 | Ga0501047_0011970 | Ga0501047_0011970_5432_5899 | 155 |
| 332 | 3300049581 | Ga0501047_0255805 | Ga0501047_0255805_351_827 | 155 |
| 333 | 3300049586 | Ga0501070_0213894 | Ga0501070_0213894_1035_1502 | 155 |
| 334 | 3300049589 | Ga0501073_0125795 | Ga0501073_0125795_659_1126 | 155 |
| 335 | 3300049742 | Ga0501080_0043441 | Ga0501080_0043441_2729_3196 | 155 |
| 336 | 3300049822 | Ga0501035_0334895 | Ga0501035_0334895_483_959 | 155 |
| 337 | 3300049822 | Ga0501035_0602242 | Ga0501035_0602242_16_483 | 155 |
| 338 | 3300049823 | Ga0501044_0078050 | Ga0501044_0078050_1031_1507 | 155 |
| 339 | 3300049823 | Ga0501044_0448254 | Ga0501044_0448254_301_768 | 155 |
| 340 | 3300049823 | Ga0501044_0509651 | Ga0501044_0509651_315_782 | 155 |
| 341 | 3300053095 | Ga0500640_020336 | Ga0500640_020336_937_1404 | 155 |
| 342 | 3300053107 | Ga0500560_003059 | Ga0500560_003059_2827_3294 | 155 |
| 343 | 3300053111 | Ga0500572_046699 | Ga0500572_046699_248_715 | 155 |
| 344 | 3300053123 | Ga0500614_100091 | Ga0500614_100091_31_498 | 155 |
| 345 | 3300053140 | Ga0500573_0052189 | Ga0500573_0052189_310_777 | 155 |
| 346 | 3300053160 | Ga0500633_0118032 | Ga0500633_0118032_468_935 | 155 |
| 347 | 3300001989 | JGI24739J22299_10022997 | JGI24739J22299_100229972 | 156 |
| 348 | 3300001990 | JGI24737J22298_10070152 | JGI24737J22298_100701522 | 156 |
| 349 | 3300002067 | JGI24735J21928_10045118 | JGI24735J21928_100451181 | 156 |
| 350 | 3300002075 | JGI24738J21930_10047408 | JGI24738J21930_100474081 | 156 |
| 351 | 3300003215 | JGI25153J46596_10049885 | JGI25153J46596_100498852 | 156 |
| 352 | 3300003316 | rootH1_10033733 | rootH1_100337332 | 156 |
| 353 | 3300003322 | rootL2_10041240 | rootL2_100412405 | 156 |
| 354 | 3300003323 | rootH1_10123303 | rootH1_101233033 | 156 |
| 355 | 3300003354 | JGI25160J50197_1047075 | JGI25160J50197_10470751 | 156 |
| 356 | 3300003578 | Ga0006562J51391_1050546 | Ga0006562J51391_10505464 | 156 |
| 357 | 3300003578 | Ga0006562J51391_1050549 | Ga0006562J51391_10505492 | 156 |
| 358 | 3300003578 | Ga0006562J51391_1061896 | Ga0006562J51391_10618962 | 156 |
| 359 | 3300005548 | Ga0070665_100330676 | Ga0070665_1003306762 | 156 |
| 360 | 3300005564 | Ga0070664_100072581 | Ga0070664_1000725813 | 156 |
| 361 | 3300005614 | Ga0068856_100415826 | Ga0068856_1004158262 | 156 |
| 362 | 3300005937 | Ga0081455_10365355 | Ga0081455_103653552 | 156 |
| 363 | 3300006048 | Ga0075363_100076247 | Ga0075363_1000762472 | 156 |
| 364 | 3300006048 | Ga0075363_100087882 | Ga0075363_1000878822 | 156 |
| 365 | 3300006048 | Ga0075363_100201209 | Ga0075363_1002012092 | 156 |
| 366 | 3300006353 | Ga0075370_10084253 | Ga0075370_100842532 | 156 |
| 367 | 3300006948 | Ga0099826_10388104 | Ga0099826_103881042 | 156 |
| 368 | 3300009092 | Ga0105250_10175887 | Ga0105250_101758871 | 156 |
| 369 | 3300009098 | Ga0105245_10241199 | Ga0105245_102411991 | 156 |
| 370 | 3300009098 | Ga0105245_10328955 | Ga0105245_103289552 | 156 |
| 371 | 3300009148 | Ga0105243_10956558 | Ga0105243_109565582 | 156 |
| 372 | 3300009176 | Ga0105242_10517223 | Ga0105242_105172232 | 156 |
| 373 | 3300009177 | Ga0105248_10106466 | Ga0105248_101064663 | 156 |
| 374 | 3300009551 | Ga0105238_10709397 | Ga0105238_107093972 | 156 |
| 375 | 3300009553 | Ga0105249_11659376 | Ga0105249_116593761 | 156 |
| 376 | 3300010375 | Ga0105239_11665290 | Ga0105239_116652902 | 156 |
| 377 | 3300010375 | Ga0105239_12481449 | Ga0105239_124814491 | 156 |
| 378 | 3300011119 | Ga0105246_10000030 | Ga0105246_100000308 | 156 |
| 379 | 3300011119 | Ga0105246_10135778 | Ga0105246_101357783 | 156 |
| 380 | 3300011119 | Ga0105246_10476239 | Ga0105246_104762391 | 156 |
| 381 | 3300013105 | Ga0157369_10065387 | Ga0157369_100653873 | 156 |
| 382 | 3300013296 | Ga0157374_10365857 | Ga0157374_103658571 | 156 |
| 383 | 3300013307 | Ga0157372_10102885 | Ga0157372_101028852 | 156 |
| 384 | 3300015688 | Ga0183367_1008 | Ga0183367_1008366 | 156 |
| 385 | 3300025297 | Ga0209758_1008765 | Ga0209758_10087655 | 156 |
| 386 | 3300025302 | Ga0207426_1001637 | Ga0207426_10016376 | 156 |
| 387 | 3300025302 | Ga0207426_1003477 | Ga0207426_10034778 | 156 |
| 388 | 3300025302 | Ga0207426_1004228 | Ga0207426_10042287 | 156 |
| 389 | 3300025302 | Ga0207426_1010421 | Ga0207426_10104212 | 156 |
| 390 | 3300025302 | Ga0207426_1018541 | Ga0207426_10185414 | 156 |
| 391 | 3300025903 | Ga0207680_10540608 | Ga0207680_105406082 | 156 |
| 392 | 3300025904 | Ga0207647_10015752 | Ga0207647_100157524 | 156 |
| 393 | 3300025927 | Ga0207687_10049131 | Ga0207687_100491312 | 156 |
| 394 | 3300025933 | Ga0207706_10090638 | Ga0207706_100906387 | 156 |
| 395 | 3300025941 | Ga0207711_10279927 | Ga0207711_102799272 | 156 |
| 396 | 3300025945 | Ga0207679_10025198 | Ga0207679_100251988 | 156 |
| 397 | 3300026035 | Ga0207703_10277085 | Ga0207703_102770852 | 156 |
| 398 | 3300026067 | Ga0207678_10023248 | Ga0207678_100232488 | 156 |
| 399 | 3300026078 | Ga0207702_10269079 | Ga0207702_102690792 | 156 |
| 400 | 3300027312 | Ga0209371_1013135 | Ga0209371_10131353 | 156 |
| 401 | 3300027666 | Ga0209282_1270904 | Ga0209282_12709042 | 156 |
| 402 | 3300027866 | Ga0209813_10024039 | Ga0209813_100240393 | 156 |
| 403 | 3300028379 | Ga0268266_10279799 | Ga0268266_102797992 | 156 |
| 404 | 3300028794 | Ga0307515_10437980 | Ga0307515_104379801 | 156 |
| 405 | 3300030500 | Ga0268256_1014405 | Ga0268256_10144051 | 156 |
| 406 | 3300030521 | Ga0307511_10205780 | Ga0307511_102057801 | 156 |
| 407 | 3300030522 | Ga0307512_10012951 | Ga0307512_100129516 | 156 |
| 408 | 3300031456 | Ga0307513_10003927 | Ga0307513_1000392715 | 156 |
| 409 | 3300031456 | Ga0307513_10072221 | Ga0307513_100722213 | 156 |
| 410 | 3300031456 | Ga0307513_10116156 | Ga0307513_101161562 | 156 |
| 411 | 3300031507 | Ga0307509_10022630 | Ga0307509_100226304 | 156 |
| 412 | 3300031507 | Ga0307509_10605991 | Ga0307509_106059912 | 156 |
| 413 | 3300031548 | Ga0307408_102085221 | Ga0307408_1020852211 | 156 |
| 414 | 3300031616 | Ga0307508_10002378 | Ga0307508_100023789 | 156 |
| 415 | 3300031616 | Ga0307508_10047622 | Ga0307508_100476222 | 156 |
| 416 | 3300031616 | Ga0307508_10077737 | Ga0307508_100777372 | 156 |
| 417 | 3300031616 | Ga0307508_10079919 | Ga0307508_100799192 | 156 |
| 418 | 3300031649 | Ga0307514_10018627 | Ga0307514_100186273 | 156 |
| 419 | 3300031649 | Ga0307514_10238643 | Ga0307514_102386432 | 156 |
| 420 | 3300031649 | Ga0307514_10345239 | Ga0307514_103452392 | 156 |
| 421 | 3300031649 | Ga0307514_10349345 | Ga0307514_103493451 | 156 |
| 422 | 3300031649 | Ga0307514_10356189 | Ga0307514_103561892 | 156 |
| 423 | 3300031730 | Ga0307516_10006477 | Ga0307516_1000647710 | 156 |
| 424 | 3300031730 | Ga0307516_10240442 | Ga0307516_102404422 | 156 |
| 425 | 3300031730 | Ga0307516_10356750 | Ga0307516_103567502 | 156 |
| 426 | 3300031838 | Ga0307518_10058932 | Ga0307518_100589324 | 156 |
| 427 | 3300031838 | Ga0307518_10175432 | Ga0307518_101754322 | 156 |
| 428 | 3300031852 | Ga0307410_10067358 | Ga0307410_100673583 | 156 |
| 429 | 3300031852 | Ga0307410_10275437 | Ga0307410_102754372 | 156 |
| 430 | 3300031995 | Ga0307409_100037687 | Ga0307409_1000376873 | 156 |
| 431 | 3300032002 | Ga0307416_101709543 | Ga0307416_1017095432 | 156 |
| 432 | 3300033180 | Ga0307510_10085353 | Ga0307510_100853531 | 156 |
| 433 | 3300037312 | Ga0395899_0261655 | Ga0395899_0261655_12_482 | 156 |
| 434 | 3300037418 | Ga0395900_0424277 | Ga0395900_0424277_19_489 | 156 |
| 435 | 3300037466 | Ga0395898_0003880 | Ga0395898_0003880_576_1046 | 156 |
| 436 | 3300037466 | Ga0395898_0073658 | Ga0395898_0073658_425_901 | 156 |
| 437 | 3300037471 | Ga0395905_0365510 | Ga0395905_0365510_826_1296 | 156 |
| 438 | 3300038443 | Ga0395901_0105186 | Ga0395901_0105186_652_1122 | 156 |
| 439 | 3300041404 | Ga0439436_0003058 | Ga0439436_0003058_3437_3907 | 156 |
| 440 | 3300041404 | Ga0439436_0004048 | Ga0439436_0004048_1768_2238 | 156 |
| 441 | 3300041406 | Ga0439439_0008564 | Ga0439439_0008564_1297_1767 | 156 |
| 442 | 3300041443 | Ga0451789_1138150 | Ga0451789_1138150_28_498 | 156 |
| 443 | 3300041486 | Ga0451807_2473932 | Ga0451807_2473932_234_707 | 156 |
| 444 | 3300041503 | Ga0451847_0832006 | Ga0451847_0832006_143_613 | 156 |
| 445 | 3300041507 | Ga0451851_0290026 | Ga0451851_0290026_125_595 | 156 |
| 446 | 3300041507 | Ga0451851_1377664 | Ga0451851_1377664_57_530 | 156 |
| 447 | 3300041512 | Ga0451853_0777276 | Ga0451853_0777276_868_1341 | 156 |
| 448 | 3300041512 | Ga0451853_2561483 | Ga0451853_2561483_1183_1653 | 156 |
| 449 | 3300041999 | Ga0439433_0000565 | Ga0439433_0000565_3858_4328 | 156 |
| 450 | 3300041999 | Ga0439433_0023848 | Ga0439433_0023848_96_566 | 156 |
| 451 | 3300042002 | Ga0439442_009075 | Ga0439442_009075_579_1049 | 156 |
| 452 | 3300042002 | Ga0439442_011672 | Ga0439442_011672_1297_1767 | 156 |
| 453 | 3300042005 | Ga0439448_0002231 | Ga0439448_0002231_3115_3585 | 156 |
| 454 | 3300042006 | Ga0439432_021300 | Ga0439432_021300_352_822 | 156 |
| 455 | 3300042007 | Ga0439449_0000841 | Ga0439449_0000841_7619_8089 | 156 |
| 456 | 3300042014 | Ga0439457_001497 | Ga0439457_001497_2027_2497 | 156 |
| 457 | 3300042015 | Ga0439462_0000959 | Ga0439462_0000959_2473_2943 | 156 |
| 458 | 3300042127 | Ga0450890_010016 | Ga0450890_010016_295_765 | 156 |
| 459 | 3300042136 | Ga0450900_004000 | Ga0450900_004000_707_1177 | 156 |
| 460 | 3300042138 | Ga0450903_000670 | Ga0450903_000670_1887_2357 | 156 |
| 461 | 3300042157 | Ga0439458_0000517 | Ga0439458_0000517_1490_1960 | 156 |
| 462 | 3300042439 | Ga0439464_0012340 | Ga0439464_0012340_690_1160 | 156 |
| 463 | 3300044656 | Ga0466969_0073532 | Ga0466969_0073532_1158_1628 | 156 |
| 464 | 3300044658 | Ga0466972_0001060 | Ga0466972_0001060_9849_10322 | 156 |
| 465 | 3300044658 | Ga0466972_0069299 | Ga0466972_0069299_750_1220 | 156 |
| 466 | 3300044658 | Ga0466972_0081032 | Ga0466972_0081032_95_568 | 156 |
| 467 | 3300044658 | Ga0466972_0295908 | Ga0466972_0295908_256_729 | 156 |
| 468 | 3300044683 | Ga0466965_0000312 | Ga0466965_0000312_7238_7708 | 156 |
| 469 | 3300044683 | Ga0466965_0014405 | Ga0466965_0014405_3180_3653 | 156 |
| 470 | 3300044683 | Ga0466965_0241500 | Ga0466965_0241500_31_504 | 156 |
| 471 | 3300044684 | Ga0466966_0001162 | Ga0466966_0001162_5092_5565 | 156 |
| 472 | 3300044684 | Ga0466966_0002783 | Ga0466966_0002783_7957_8427 | 156 |
| 473 | 3300044693 | Ga0466961_0002591 | Ga0466961_0002591_2140_2610 | 156 |
| 474 | 3300044693 | Ga0466961_0005840 | Ga0466961_0005840_140_613 | 156 |
| 475 | 3300044693 | Ga0466961_0035125 | Ga0466961_0035125_1199_1672 | 156 |
| 476 | 3300044694 | Ga0466963_0003115 | Ga0466963_0003115_1478_1954 | 156 |
| 477 | 3300044694 | Ga0466963_0165305 | Ga0466963_0165305_82_555 | 156 |
| 478 | 3300044706 | Ga0466964_0008956 | Ga0466964_0008956_138_608 | 156 |
| 479 | 3300044706 | Ga0466964_0039907 | Ga0466964_0039907_1083_1556 | 156 |
| 480 | 3300044706 | Ga0466964_0392880 | Ga0466964_0392880_64_537 | 156 |
| 481 | 3300044719 | Ga0466971_0000277 | Ga0466971_0000277_589_1059 | 156 |
| 482 | 3300044719 | Ga0466971_0015939 | Ga0466971_0015939_2645_3118 | 156 |
| 483 | 3300044735 | Ga0466968_0087204 | Ga0466968_0087204_157_630 | 156 |
| 484 | 3300044765 | Ga0466970_0000443 | Ga0466970_0000443_11139_11609 | 156 |
| 485 | 3300044765 | Ga0466970_0006602 | Ga0466970_0006602_1533_2003 | 156 |
| 486 | 3300044765 | Ga0466970_0057196 | Ga0466970_0057196_57_530 | 156 |
| 487 | 3300044842 | Ga0466957_0001357 | Ga0466957_0001357_3710_4180 | 156 |
| 488 | 3300044901 | Ga0466960_0266483 | Ga0466960_0266483_28_498 | 156 |
| 489 | 3300045049 | Ga0466959_0019009 | Ga0466959_0019009_2038_2508 | 156 |
| 490 | 3300045836 | Ga0466958_0118783 | Ga0466958_0118783_1143_1616 | 156 |
| 491 | 3300045976 | Ga0466967_0004534 | Ga0466967_0004534_2889_3359 | 156 |
| 492 | 3300045976 | Ga0466967_0006993 | Ga0466967_0006993_2075_2545 | 156 |
| 493 | 3300045976 | Ga0466967_0030987 | Ga0466967_0030987_2791_3264 | 156 |
| 494 | 3300045976 | Ga0466967_0210293 | Ga0466967_0210293_49_525 | 156 |
| 495 | 3300046452 | Ga0495617_007941 | Ga0495617_007941_1023_1493 | 156 |
| 496 | 3300046453 | Ga0495627_099664 | Ga0495627_099664_268_738 | 156 |
| 497 | 3300046454 | Ga0495592_0009032 | Ga0495592_0009032_6678_7148 | 156 |
| 498 | 3300046455 | Ga0495603_0000701 | Ga0495603_0000701_17627_18097 | 156 |
| 499 | 3300046455 | Ga0495603_0002941 | Ga0495603_0002941_3374_3844 | 156 |
| 500 | 3300046455 | Ga0495603_0004561 | Ga0495603_0004561_5732_6202 | 156 |
| 501 | 3300046455 | Ga0495603_0007883 | Ga0495603_0007883_1588_2058 | 156 |
| 502 | 3300046455 | Ga0495603_0025037 | Ga0495603_0025037_2972_3442 | 156 |
| 503 | 3300046455 | Ga0495603_0046323 | Ga0495603_0046323_248_718 | 156 |
| 504 | 3300046455 | Ga0495603_0627013 | Ga0495603_0627013_63_533 | 156 |
| 505 | 3300046459 | Ga0495629_0000808 | Ga0495629_0000808_23709_24179 | 156 |
| 506 | 3300046459 | Ga0495629_0008474 | Ga0495629_0008474_6938_7408 | 156 |
| 507 | 3300046459 | Ga0495629_0013998 | Ga0495629_0013998_4509_4979 | 156 |
| 508 | 3300046459 | Ga0495629_0030931 | Ga0495629_0030931_1936_2406 | 156 |
| 509 | 3300046459 | Ga0495629_0085598 | Ga0495629_0085598_863_1333 | 156 |
| 510 | 3300046459 | Ga0495629_0137419 | Ga0495629_0137419_1046_1516 | 156 |
| 511 | 3300046460 | Ga0495638_0110084 | Ga0495638_0110084_762_1232 | 156 |
| 512 | 3300046460 | Ga0495638_0175704 | Ga0495638_0175704_154_624 | 156 |
| 513 | 3300046460 | Ga0495638_0249774 | Ga0495638_0249774_383_853 | 156 |
| 514 | 3300046461 | Ga0495641_0186225 | Ga0495641_0186225_239_709 | 156 |
| 515 | 3300046461 | Ga0495641_0314772 | Ga0495641_0314772_81_551 | 156 |
| 516 | 3300046474 | Ga0495605_0005776 | Ga0495605_0005776_2584_3054 | 156 |
| 517 | 3300046474 | Ga0495605_0028277 | Ga0495605_0028277_520_990 | 156 |
| 518 | 3300046476 | Ga0495662_0009266 | Ga0495662_0009266_3607_4077 | 156 |
| 519 | 3300046476 | Ga0495662_0049855 | Ga0495662_0049855_1167_1637 | 156 |
| 520 | 3300046477 | Ga0495664_0061773 | Ga0495664_0061773_1033_1503 | 156 |
| 521 | 3300046492 | Ga0495585_0164620 | Ga0495585_0164620_317_787 | 156 |
| 522 | 3300046492 | Ga0495585_0281423 | Ga0495585_0281423_249_719 | 156 |
| 523 | 3300046499 | Ga0495594_0005254 | Ga0495594_0005254_851_1321 | 156 |
| 524 | 3300046499 | Ga0495594_0012424 | Ga0495594_0012424_382_852 | 156 |
| 525 | 3300046499 | Ga0495594_0016252 | Ga0495594_0016252_1480_1950 | 156 |
| 526 | 3300046499 | Ga0495594_0033179 | Ga0495594_0033179_119_589 | 156 |
| 527 | 3300046499 | Ga0495594_0069923 | Ga0495594_0069923_179_649 | 156 |
| 528 | 3300046499 | Ga0495594_0132329 | Ga0495594_0132329_291_761 | 156 |
| 529 | 3300046499 | Ga0495594_0231446 | Ga0495594_0231446_57_527 | 156 |
| 530 | 3300046499 | Ga0495594_0284825 | Ga0495594_0284825_370_840 | 156 |
| 531 | 3300046500 | Ga0495596_0049344 | Ga0495596_0049344_434_904 | 156 |
| 532 | 3300046501 | Ga0495607_0069566 | Ga0495607_0069566_291_761 | 156 |
| 533 | 3300046506 | Ga0495583_0060370 | Ga0495583_0060370_1161_1631 | 156 |
| 534 | 3300046506 | Ga0495583_0095732 | Ga0495583_0095732_344_814 | 156 |
| 535 | 3300046506 | Ga0495583_0171396 | Ga0495583_0171396_178_648 | 156 |
| 536 | 3300046507 | Ga0495606_0013342 | Ga0495606_0013342_2949_3419 | 156 |
| 537 | 3300046511 | Ga0495608_0528453 | Ga0495608_0528453_199_669 | 156 |
| 538 | 3300046512 | Ga0495610_0012935 | Ga0495610_0012935_1916_2386 | 156 |
| 539 | 3300046513 | Ga0495616_0002920 | Ga0495616_0002920_9704_10174 | 156 |
| 540 | 3300046514 | Ga0495618_0118360 | Ga0495618_0118360_372_842 | 156 |
| 541 | 3300046515 | Ga0495620_0005708 | Ga0495620_0005708_1588_2058 | 156 |
| 542 | 3300046515 | Ga0495620_0021552 | Ga0495620_0021552_164_634 | 156 |
| 543 | 3300046516 | Ga0495628_0037203 | Ga0495628_0037203_3288_3758 | 156 |
| 544 | 3300046517 | Ga0495630_0140144 | Ga0495630_0140144_135_608 | 156 |
| 545 | 3300046518 | Ga0495631_0005953 | Ga0495631_0005953_4081_4551 | 156 |
| 546 | 3300046519 | Ga0495632_0025647 | Ga0495632_0025647_950_1420 | 156 |
| 547 | 3300046519 | Ga0495632_0169047 | Ga0495632_0169047_15_485 | 156 |
| 548 | 3300046520 | Ga0495637_0131564 | Ga0495637_0131564_297_767 | 156 |
| 549 | 3300046522 | Ga0495643_0008008 | Ga0495643_0008008_338_808 | 156 |
| 550 | 3300046522 | Ga0495643_0008270 | Ga0495643_0008270_5869_6339 | 156 |
| 551 | 3300046523 | Ga0495644_0114281 | Ga0495644_0114281_544_1014 | 156 |
| 552 | 3300046524 | Ga0495648_0104392 | Ga0495648_0104392_529_999 | 156 |
| 553 | 3300046524 | Ga0495648_0267686 | Ga0495648_0267686_103_573 | 156 |
| 554 | 3300046526 | Ga0495666_0086076 | Ga0495666_0086076_880_1350 | 156 |
| 555 | 3300046528 | Ga0495642_0076710 | Ga0495642_0076710_163_633 | 156 |
| 556 | 3300046529 | Ga0495652_0226270 | Ga0495652_0226270_177_647 | 156 |
| 557 | 3300046530 | Ga0495654_0039808 | Ga0495654_0039808_863_1333 | 156 |
| 558 | 3300046535 | Ga0495586_0114791 | Ga0495586_0114791_938_1408 | 156 |
| 559 | 3300046538 | Ga0495609_0014264 | Ga0495609_0014264_2174_2644 | 156 |
| 560 | 3300046542 | Ga0495597_0065595 | Ga0495597_0065595_574_1044 | 156 |
| 561 | 3300046543 | Ga0495645_0156268 | Ga0495645_0156268_573_1043 | 156 |
| 562 | 3300046557 | Ga0495622_0007310 | Ga0495622_0007310_1291_1761 | 156 |
| 563 | 3300046557 | Ga0495622_0024271 | Ga0495622_0024271_1334_1804 | 156 |
| 564 | 3300046558 | Ga0495633_0033065 | Ga0495633_0033065_1161_1631 | 156 |
| 565 | 3300046559 | Ga0495667_0229274 | Ga0495667_0229274_212_682 | 156 |
| 566 | 3300046615 | Ga0495656_0553821 | Ga0495656_0553821_129_599 | 156 |
| 567 | 3300046616 | Ga0495668_0017571 | Ga0495668_0017571_2933_3403 | 156 |
| 568 | 3300046616 | Ga0495668_0024591 | Ga0495668_0024591_2550_3020 | 156 |
| 569 | 3300046648 | Ga0495611_0047056 | Ga0495611_0047056_948_1418 | 156 |
| 570 | 3300046648 | Ga0495611_0228764 | Ga0495611_0228764_217_687 | 156 |
| 571 | 3300046660 | Ga0495625_0043869 | Ga0495625_0043869_388_858 | 156 |
| 572 | 3300046660 | Ga0495625_0174059 | Ga0495625_0174059_275_745 | 156 |
| 573 | 3300046660 | Ga0495625_0411778 | Ga0495625_0411778_357_827 | 156 |
| 574 | 3300046663 | Ga0495635_0205053 | Ga0495635_0205053_61_531 | 156 |
| 575 | 3300046663 | Ga0495635_0224614 | Ga0495635_0224614_764_1234 | 156 |
| 576 | 3300046665 | Ga0495661_0012661 | Ga0495661_0012661_4952_5422 | 156 |
| 577 | 3300046665 | Ga0495661_0123762 | Ga0495661_0123762_470_940 | 156 |
| 578 | 3300046674 | Ga0495588_0001017 | Ga0495588_0001017_100_570 | 156 |
| 579 | 3300046674 | Ga0495588_0001932 | Ga0495588_0001932_905_1375 | 156 |
| 580 | 3300046674 | Ga0495588_0080786 | Ga0495588_0080786_723_1193 | 156 |
| 581 | 3300046674 | Ga0495588_0393200 | Ga0495588_0393200_235_705 | 156 |
| 582 | 3300046675 | Ga0495657_0029544 | Ga0495657_0029544_3176_3646 | 156 |
| 583 | 3300046675 | Ga0495657_0072892 | Ga0495657_0072892_72_542 | 156 |
| 584 | 3300046679 | Ga0495623_0513047 | Ga0495623_0513047_30_500 | 156 |
| 585 | 3300046680 | Ga0495646_0063836 | Ga0495646_0063836_43_513 | 156 |
| 586 | 3300046683 | Ga0495658_0103622 | Ga0495658_0103622_240_710 | 156 |
| 587 | 3300046689 | Ga0495613_0004327 | Ga0495613_0004327_5126_5596 | 156 |
| 588 | 3300046689 | Ga0495613_0017915 | Ga0495613_0017915_1912_2382 | 156 |
| 589 | 3300046689 | Ga0495613_0208155 | Ga0495613_0208155_151_621 | 156 |
| 590 | 3300046689 | Ga0495613_0254240 | Ga0495613_0254240_32_502 | 156 |
| 591 | 3300046689 | Ga0495613_0452794 | Ga0495613_0452794_384_854 | 156 |
| 592 | 3300046689 | Ga0495613_0644312 | Ga0495613_0644312_24_494 | 156 |
| 593 | 3300046690 | Ga0495624_0124203 | Ga0495624_0124203_299_769 | 156 |
| 594 | 3300046690 | Ga0495624_0432879 | Ga0495624_0432879_291_761 | 156 |
| 595 | 3300046691 | Ga0495670_0000768 | Ga0495670_0000768_5617_6087 | 156 |
| 596 | 3300046691 | Ga0495670_0066409 | Ga0495670_0066409_704_1174 | 156 |
| 597 | 3300046691 | Ga0495670_0452614 | Ga0495670_0452614_138_608 | 156 |
| 598 | 3300046692 | Ga0495671_0178769 | Ga0495671_0178769_407_877 | 156 |
| 599 | 3300046694 | Ga0495649_0024808 | Ga0495649_0024808_2549_3019 | 156 |
| 600 | 3300046694 | Ga0495649_0041202 | Ga0495649_0041202_999_1469 | 156 |
| 601 | 3300046694 | Ga0495649_0174306 | Ga0495649_0174306_586_1056 | 156 |
| 602 | 3300046794 | Ga0495589_0010936 | Ga0495589_0010936_686_1156 | 156 |
| 603 | 3300046794 | Ga0495589_0015889 | Ga0495589_0015889_2555_3025 | 156 |
| 604 | 3300046794 | Ga0495589_0110063 | Ga0495589_0110063_184_654 | 156 |
| 605 | 3300046794 | Ga0495589_0119531 | Ga0495589_0119531_750_1220 | 156 |
| 606 | 3300046794 | Ga0495589_0121734 | Ga0495589_0121734_654_1124 | 156 |
| 607 | 3300046809 | Ga0495600_0191492 | Ga0495600_0191492_615_1085 | 156 |
| 608 | 3300046809 | Ga0495600_0268036 | Ga0495600_0268036_552_1022 | 156 |
| 609 | 3300046810 | Ga0495660_0025579 | Ga0495660_0025579_2530_3000 | 156 |
| 610 | 3300046810 | Ga0495660_0116713 | Ga0495660_0116713_760_1230 | 156 |
| 611 | 3300046810 | Ga0495660_0123697 | Ga0495660_0123697_16_486 | 156 |
| 612 | 3300047315 | Ga0495581_0038486 | Ga0495581_0038486_2270_2740 | 156 |
| 613 | 3300047315 | Ga0495581_0340649 | Ga0495581_0340649_34_504 | 156 |
| 614 | 3300047315 | Ga0495581_0387340 | Ga0495581_0387340_28_498 | 156 |
| 615 | 3300047317 | Ga0495604_0002227 | Ga0495604_0002227_14923_15396 | 156 |
| 616 | 3300047317 | Ga0495604_0073508 | Ga0495604_0073508_549_1019 | 156 |
| 617 | 3300047318 | Ga0495636_0004207 | Ga0495636_0004207_4990_5460 | 156 |
| 618 | 3300047318 | Ga0495636_0036488 | Ga0495636_0036488_634_1104 | 156 |
| 619 | 3300047318 | Ga0495636_0041026 | Ga0495636_0041026_702_1172 | 156 |
| 620 | 3300047318 | Ga0495636_0063937 | Ga0495636_0063937_201_671 | 156 |
| 621 | 3300047319 | Ga0495674_0296435 | Ga0495674_0296435_731_1201 | 156 |
| 622 | 3300047321 | Ga0495676_0002383 | Ga0495676_0002383_852_1322 | 156 |
| 623 | 3300047321 | Ga0495676_0010778 | Ga0495676_0010778_2501_2971 | 156 |
| 624 | 3300047321 | Ga0495676_0016617 | Ga0495676_0016617_5753_6223 | 156 |
| 625 | 3300047321 | Ga0495676_0060795 | Ga0495676_0060795_2065_2535 | 156 |
| 626 | 3300047321 | Ga0495676_0114621 | Ga0495676_0114621_1203_1673 | 156 |
| 627 | 3300047321 | Ga0495676_0337533 | Ga0495676_0337533_291_761 | 156 |
| 628 | 3300047321 | Ga0495676_0950478 | Ga0495676_0950478_31_501 | 156 |
| 629 | 3300047321 | Ga0495676_0991646 | Ga0495676_0991646_12_482 | 156 |
| 630 | 3300047322 | Ga0495680_0014470 | Ga0495680_0014470_5497_5967 | 156 |
| 631 | 3300047323 | Ga0495683_0069893 | Ga0495683_0069893_1162_1632 | 156 |
| 632 | 3300047323 | Ga0495683_0162249 | Ga0495683_0162249_407_877 | 156 |
| 633 | 3300047323 | Ga0495683_0428736 | Ga0495683_0428736_52_522 | 156 |
| 634 | 3300047443 | Ga0495687_004621 | Ga0495687_004621_1205_1675 | 156 |
| 635 | 3300047443 | Ga0495687_009644 | Ga0495687_009644_2441_2911 | 156 |
| 636 | 3300047443 | Ga0495687_019701 | Ga0495687_019701_2559_3029 | 156 |
| 637 | 3300047443 | Ga0495687_029674 | Ga0495687_029674_1668_2138 | 156 |
| 638 | 3300047443 | Ga0495687_059001 | Ga0495687_059001_407_880 | 156 |
| 639 | 3300047443 | Ga0495687_097942 | Ga0495687_097942_515_985 | 156 |
| 640 | 3300047444 | Ga0495675_0031721 | Ga0495675_0031721_46_516 | 156 |
| 641 | 3300047444 | Ga0495675_0044461 | Ga0495675_0044461_1447_1917 | 156 |
| 642 | 3300047444 | Ga0495675_0101791 | Ga0495675_0101791_210_680 | 156 |
| 643 | 3300047445 | Ga0495677_0040808 | Ga0495677_0040808_697_1167 | 156 |
| 644 | 3300047446 | Ga0495679_116447 | Ga0495679_116447_164_634 | 156 |
| 645 | 3300047447 | Ga0495685_000778 | Ga0495685_000778_3306_3776 | 156 |
| 646 | 3300047447 | Ga0495685_004500 | Ga0495685_004500_1190_1660 | 156 |
| 647 | 3300047447 | Ga0495685_014206 | Ga0495685_014206_887_1357 | 156 |
| 648 | 3300047447 | Ga0495685_017916 | Ga0495685_017916_1421_1894 | 156 |
| 649 | 3300047447 | Ga0495685_033159 | Ga0495685_033159_714_1184 | 156 |
| 650 | 3300047447 | Ga0495685_081222 | Ga0495685_081222_485_955 | 156 |
| 651 | 3300047469 | Ga0495673_0158595 | Ga0495673_0158595_269_739 | 156 |
| 652 | 3300047470 | Ga0495681_0009575 | Ga0495681_0009575_2139_2609 | 156 |
| 653 | 3300047470 | Ga0495681_0049976 | Ga0495681_0049976_22_492 | 156 |
| 654 | 3300047470 | Ga0495681_0074063 | Ga0495681_0074063_965_1435 | 156 |
| 655 | 3300047470 | Ga0495681_0123531 | Ga0495681_0123531_191_664 | 156 |
| 656 | 3300047471 | Ga0495684_0101024 | Ga0495684_0101024_597_1067 | 156 |
| 657 | 3300047472 | Ga0495686_0014932 | Ga0495686_0014932_4742_5212 | 156 |
| 658 | 3300047472 | Ga0495686_0054549 | Ga0495686_0054549_1071_1544 | 156 |
| 659 | 3300047673 | Ga0495593_0034713 | Ga0495593_0034713_1359_1829 | 156 |
| 660 | 3300047673 | Ga0495593_0275466 | Ga0495593_0275466_212_682 | 156 |
| 661 | 3300048088 | Ga0495602_0632923 | Ga0495602_0632923_241_711 | 156 |
| 662 | 3300048089 | Ga0495614_0000762 | Ga0495614_0000762_4519_4989 | 156 |
| 663 | 3300048089 | Ga0495614_0052465 | Ga0495614_0052465_1143_1613 | 156 |
| 664 | 3300048089 | Ga0495614_0113128 | Ga0495614_0113128_691_1161 | 156 |
| 665 | 3300048089 | Ga0495614_0131186 | Ga0495614_0131186_123_593 | 156 |
| 666 | 3300048091 | Ga0495626_0013046 | Ga0495626_0013046_1698_2168 | 156 |
| 667 | 3300048905 | Ga0496102_0258527 | Ga0496102_0258527_159_629 | 156 |
| 668 | 3300048912 | Ga0496109_0027221 | Ga0496109_0027221_4559_5029 | 156 |
| 669 | 3300048913 | Ga0496110_0187678 | Ga0496110_0187678_79_549 | 156 |
| 670 | 3300048916 | Ga0496113_0813276 | Ga0496113_0813276_141_611 | 156 |
| 671 | 3300048916 | Ga0496113_0886114 | Ga0496113_0886114_157_630 | 156 |
| 672 | 3300048927 | Ga0496124_0798252 | Ga0496124_0798252_66_536 | 156 |
| 673 | 3300049459 | Ga0495678_043912 | Ga0495678_043912_718_1188 | 156 |
| 674 | 3300049460 | Ga0495682_0140059 | Ga0495682_0140059_237_707 | 156 |
| 675 | 3300049568 | Ga0501031_0100282 | Ga0501031_0100282_437_916 | 156 |
| 676 | 3300049568 | Ga0501031_0663043 | Ga0501031_0663043_141_614 | 156 |
| 677 | 3300049569 | Ga0501032_0046785 | Ga0501032_0046785_888_1367 | 156 |
| 678 | 3300049570 | Ga0501033_0002071 | Ga0501033_0002071_9030_9503 | 156 |
| 679 | 3300049570 | Ga0501033_0140986 | Ga0501033_0140986_1246_1725 | 156 |
| 680 | 3300049570 | Ga0501033_0454388 | Ga0501033_0454388_23_502 | 156 |
| 681 | 3300049571 | Ga0501034_0007488 | Ga0501034_0007488_2358_2837 | 156 |
| 682 | 3300049571 | Ga0501034_0240338 | Ga0501034_0240338_1000_1479 | 156 |
| 683 | 3300049572 | Ga0501036_0029018 | Ga0501036_0029018_966_1445 | 156 |
| 684 | 3300049573 | Ga0501037_0304226 | Ga0501037_0304226_77_556 | 156 |
| 685 | 3300049574 | Ga0501038_0054508 | Ga0501038_0054508_1404_1883 | 156 |
| 686 | 3300049574 | Ga0501038_0270448 | Ga0501038_0270448_252_731 | 156 |
| 687 | 3300049574 | Ga0501038_0554041 | Ga0501038_0554041_308_781 | 156 |
| 688 | 3300049579 | Ga0501043_0065798 | Ga0501043_0065798_2215_2694 | 156 |
| 689 | 3300049581 | Ga0501047_0033911 | Ga0501047_0033911_1674_2153 | 156 |
| 690 | 3300049582 | Ga0501048_0035095 | Ga0501048_0035095_997_1476 | 156 |
| 691 | 3300049822 | Ga0501035_0048356 | Ga0501035_0048356_981_1460 | 156 |
| 692 | 3300049822 | Ga0501035_0227105 | Ga0501035_0227105_495_968 | 156 |
| 693 | 3300049823 | Ga0501044_0010468 | Ga0501044_0010468_7628_8101 | 156 |
| 694 | 3300049823 | Ga0501044_0011825 | Ga0501044_0011825_6721_7191 | 156 |
| 695 | 3300049823 | Ga0501044_0045099 | Ga0501044_0045099_3705_4184 | 156 |
| 696 | 3300049824 | Ga0501045_0174387 | Ga0501045_0174387_159_638 | 156 |
| 697 | 3300050490 | nmdc:mga03n38_14218_c1 | nmdc:mga03n38_14218_c1_1616_2089 | 156 |
| 698 | 3300050490 | nmdc:mga03n38_166880_c1 | nmdc:mga03n38_166880_c1_323_796 | 156 |
| 699 | 3300050494 | nmdc:mga06z11_12423_c1 | nmdc:mga06z11_12423_c1_2226_2702 | 156 |
| 700 | 3300050496 | nmdc:mga07m45_152927_c1 | nmdc:mga07m45_152927_c1_284_757 | 156 |
| 701 | 3300053086 | Ga0500578_0074757 | Ga0500578_0074757_1433_1903 | 156 |
| 702 | 3300053086 | Ga0500578_0101155 | Ga0500578_0101155_604_1077 | 156 |
| 703 | 3300053087 | Ga0500643_157121 | Ga0500643_157121_125_595 | 156 |
| 704 | 3300053092 | Ga0500583_0138571 | Ga0500583_0138571_567_1037 | 156 |
| 705 | 3300053094 | Ga0500566_0186833 | Ga0500566_0186833_315_785 | 156 |
| 706 | 3300053096 | Ga0500641_0203838 | Ga0500641_0203838_46_519 | 156 |
| 707 | 3300053096 | Ga0500641_0313674 | Ga0500641_0313674_112_582 | 156 |
| 708 | 3300053099 | Ga0500654_129155 | Ga0500654_129155_90_560 | 156 |
| 709 | 3300053100 | Ga0500660_144907 | Ga0500660_144907_406_876 | 156 |
| 710 | 3300053101 | Ga0500553_214185 | Ga0500553_214185_12_482 | 156 |
| 711 | 3300053104 | Ga0500556_0180274 | Ga0500556_0180274_268_738 | 156 |
| 712 | 3300053105 | Ga0500557_178373 | Ga0500557_178373_32_502 | 156 |
| 713 | 3300053107 | Ga0500560_004466 | Ga0500560_004466_2451_2921 | 156 |
| 714 | 3300053107 | Ga0500560_035928 | Ga0500560_035928_568_1038 | 156 |
| 715 | 3300053109 | Ga0500569_084559 | Ga0500569_084559_479_949 | 156 |
| 716 | 3300053123 | Ga0500614_066134 | Ga0500614_066134_478_948 | 156 |
| 717 | 3300053129 | Ga0500628_091356 | Ga0500628_091356_67_537 | 156 |
| 718 | 3300053131 | Ga0500652_050659 | Ga0500652_050659_1103_1573 | 156 |
| 719 | 3300053134 | Ga0500658_0014745 | Ga0500658_0014745_11_481 | 156 |
| 720 | 3300053137 | Ga0500561_0102750 | Ga0500561_0102750_50_520 | 156 |
| 721 | 3300053139 | Ga0500568_0267803 | Ga0500568_0267803_121_594 | 156 |
| 722 | 3300053140 | Ga0500573_0033239 | Ga0500573_0033239_2456_2926 | 156 |
| 723 | 3300053146 | Ga0500588_0080447 | Ga0500588_0080447_17_487 | 156 |
| 724 | 3300053147 | Ga0500589_325700 | Ga0500589_325700_17_487 | 156 |
| 725 | 3300053149 | Ga0500600_0004613 | Ga0500600_0004613_3143_3613 | 156 |
| 726 | 3300053149 | Ga0500600_0122439 | Ga0500600_0122439_521_994 | 156 |
| 727 | 3300053153 | Ga0500616_0012533 | Ga0500616_0012533_2877_3347 | 156 |
| 728 | 3300053160 | Ga0500633_0019571 | Ga0500633_0019571_1027_1497 | 156 |
| 729 | 3300053161 | Ga0500634_0096496 | Ga0500634_0096496_635_1105 | 156 |
| 730 | 3300053177 | Ga0500636_0304403 | Ga0500636_0304403_277_747 | 156 |
| 731 | 3300053732 | Ga0500656_008315 | Ga0500656_008315_116_586 | 156 |
| 732 | 3300053739 | Ga0500587_012775 | Ga0500587_012775_258_728 | 156 |
| 733 | 3300061719 | Ga0466962_0000163 | Ga0466962_0000163_19255_19725 | 156 |
| 734 | 3300061719 | Ga0466962_0011589 | Ga0466962_0011589_3715_4188 | 156 |
| 735 | 3300061719 | Ga0466962_0249241 | Ga0466962_0249241_265_738 | 156 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wv4-assembly1.cif.gz_B | x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form | 0.8275 | 24 | 140 |
| 1wv4-assembly1.cif.gz_A | x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form | 0.7854 | 14 | 140 |
| 5jab-assembly1.cif.gz_B | structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 | 0.7843 | 10 | 146 |
| 1rfe-assembly1.cif.gz_A | crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis | 0.7834 | 4 | 143 |
| 7kq2-assembly1.cif.gz_A | 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 | 0.7778 | 15 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wv4B00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8275 | 24 | 140 | 2.30.110.10 |
| 6eciG00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.798 | 6 | 146 | 2.30.110.10 |
| 6eciG00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.785 | 6 | 146 | 2.30.110.10 |
| 2asfA00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7809 | 14 | 146 | 2.30.110.10 |
| af_O07754_2_147_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.7804 | 11 | 146 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G9ERN7-F1-model_v4 | PPOX class probable F420-dependent enzyme | 0.997 | 1 | 153 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A495L8T1-F1-model_v4 | PPOX class probable F420-dependent enzyme | 0.9949 | 1 | 151 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A1I1ZE95-F1-model_v4 | PPOX class probable F420-dependent enzyme | 0.9915 | 1 | 153 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A4Y3KWS0-F1-model_v4 | PPOX class F420-dependent enzyme | 0.9912 | 1 | 153 |
GO:0005829
GO:0016627 GO:0070967 |
| AF-A0A1G9ERN7-F1-model_v4 | PPOX class probable F420-dependent enzyme | 0.9905 | 1 | 153 |
GO:0005829
GO:0016627 GO:0070967 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar