F478259
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 736 | 352 | 1472 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300009147|Ga0114129_10115544|Ga0114129_101155442 |
| Length | 381 |
| Sequence | VAALLHCGGKPLEHQSKGKAAPHLPSSSNAERAAQSKRLCRNFASPAAFICVRFSGAPHNARARIDLVITTAGKLEQLQSTIESVIHGKSDVVELALVTLLAGGHLLIEDVPGVGKTTLAQTLARSFDCSFQRIQFTSDMLPSDIVGLEVFNQRNGTFEFKSGPIFANVILADEINRSTPKTQSALLEAMAEGHVTVEQETYRLPQPFIVLATQNPIEHHGTYPLPESQLDRFMMRLRMGYPDSEDEKTILREQTLNSAVDRVVPVMHSDGVLALQHEVREVTVDEALIDYLIRIVRATRDADILDLGVSPRGSLALYHASQALAFVEGRDFVIPDDIKRLVVPIFAHRIVVNSRYSTGLRRSEEAQAALLEILKTVNVPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 8 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 62 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 63 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 64 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 67 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 68 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 69 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 80 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 82 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 83 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 84 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 85 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 86 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 87 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 88 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 89 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 92 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 123 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 185 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 187 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 188 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 189 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 196 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 197 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 198 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 199 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 200 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 209 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 216 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 219 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 220 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 221 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 222 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 223 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 226 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 227 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 259 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 260 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 271 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 272 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 273 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 274 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 277 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 278 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 279 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 280 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 281 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 282 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 283 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 284 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 285 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 288 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 290 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 291 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 302 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 303 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 304 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 305 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 306 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 309 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 310 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 311 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 312 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 313 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 314 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 315 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 316 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 317 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 318 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 319 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 320 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 321 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 322 | 2739367866 | Hymenobacter sp. YR204 | Isolate | Unclassified |
| 323 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 324 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 325 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 326 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 327 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 328 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 329 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 330 | 2919186247 | Pedobacter africanus 2697 | Isolate | Rhizosphere |
| 331 | 2919414237 | Neobacillus niacini 3240 | Isolate | Rhizosphere |
| 332 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 333 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 334 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 335 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 336 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 337 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 338 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 339 | 2939593269 | Lysinibacillus parviboronicapiens 736 | Isolate | Rhizosphere |
| 340 | 2939664404 | Pedobacter africanus 2990 | Isolate | Rhizosphere |
| 341 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 342 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 343 | 2977254563 | Bacillus sp. SORGH_AS 510 | Isolate | Unclassified |
| 344 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 345 | 2990275345 | Bacillus sp. SLBN-46 | Isolate | Unclassified |
| 346 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 347 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 348 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 349 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 350 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 351 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 352 | 8054280661 | Metabacillus kandeliae GX 13764 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.89 |
| Metatranscriptomes | 0.14 |
| Isolates | 5.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.76 |
| Nodule | 0 |
| Rhizoplane | 1.9 |
| Rhizosphere | 86.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0114129_10115544 | 3300009147 | Bacteria | 3699 |
| 2 | MRS1b_contig_1663259 | 2162886011 | Bacteria | 1918 |
| 3 | JGI24737J22298_10000097 | 3300001990 | Bacteria | 25865 |
| 4 | JGI24735J21928_10000007 | 3300002067 | Bacteria | 333510 |
| 5 | JGI24034J26672_10000002 | 3300002239 | Bacteria | 925353 |
| 6 | JGI25157J39369_1004215 | 3300002741 | Bacteria | 2673 |
| 7 | JGI25151J46595_10001377 | 3300003187 | Bacteria | 16775 |
| 8 | JGI25151J46595_10001863 | 3300003187 | Bacteria | 13515 |
| 9 | JGI25151J46595_10006116 | 3300003187 | Bacteria | 6112 |
| 10 | JGI25151J46595_10010655 | 3300003187 | Bacteria | 4257 |
| 11 | JGI25151J46595_10025188 | 3300003187 | Bacteria | 2424 |
| 12 | JGI25151J46595_10033737 | 3300003187 | Bacteria | 1966 |
| 13 | rootH1_10086689 | 3300003316 | Bacteria | 7588 |
| 14 | rootH2_10009713 | 3300003320 | Bacteria | 16901 |
| 15 | rootH2_10035798 | 3300003320 | Bacteria | 4386 |
| 16 | rootH2_10270546 | 3300003320 | Bacteria | 3945 |
| 17 | rootL2_10156444 | 3300003322 | Bacteria | 8320 |
| 18 | rootH1_10050749 | 3300003323 | Bacteria | 18676 |
| 19 | rootH1_10050750 | 3300003323 | Bacteria | 4561 |
| 20 | rootH1_10100346 | 3300003323 | Bacteria | 4520 |
| 21 | rootH1_10107607 | 3300003323 | Bacteria | 13604 |
| 22 | rootH1_10160410 | 3300003323 | Bacteria | 5106 |
| 23 | Ga0065714_10007468 | 3300005288 | Bacteria | 2855 |
| 24 | Ga0065714_10064452 | 3300005288 | Bacteria | 75496 |
| 25 | Ga0065714_10090251 | 3300005288 | Bacteria | 1951 |
| 26 | Ga0065704_10018369 | 3300005289 | Bacteria | 2082 |
| 27 | Ga0065704_10075745 | 3300005289 | Bacteria | 5440 |
| 28 | Ga0065704_10098471 | 3300005289 | Unclassified | 2351 |
| 29 | Ga0065704_10192970 | 3300005289 | Bacteria | 1181 |
| 30 | Ga0065712_10000126 | 3300005290 | Bacteria | 75495 |
| 31 | Ga0065712_10132409 | 3300005290 | Bacteria | 1534 |
| 32 | Ga0065715_10016731 | 3300005293 | Bacteria | 1798 |
| 33 | Ga0065715_10030556 | 3300005293 | Bacteria | 1862 |
| 34 | Ga0065715_10089100 | 3300005293 | Bacteria | 14369 |
| 35 | Ga0065715_10152398 | 3300005293 | Unclassified | 1714 |
| 36 | Ga0065707_10004795 | 3300005295 | Bacteria | 4533 |
| 37 | Ga0065707_10211243 | 3300005295 | Bacteria | 1264 |
| 38 | Ga0070683_100005282 | 3300005329 | Bacteria | 10755 |
| 39 | Ga0070690_100062870 | 3300005330 | Unclassified | 2394 |
| 40 | Ga0070670_100000197 | 3300005331 | Bacteria | 55774 |
| 41 | Ga0070670_100061085 | 3300005331 | Bacteria | 3235 |
| 42 | Ga0070670_100069198 | 3300005331 | Unclassified | 3030 |
| 43 | Ga0070670_100126539 | 3300005331 | Bacteria | 2205 |
| 44 | Ga0070680_100077232 | 3300005336 | Bacteria | 2743 |
| 45 | Ga0070682_100000521 | 3300005337 | Bacteria | 24093 |
| 46 | Ga0070682_100010419 | 3300005337 | Bacteria | 5275 |
| 47 | Ga0070682_100068716 | 3300005337 | Bacteria | 2261 |
| 48 | Ga0068868_100003527 | 3300005338 | Bacteria | 10902 |
| 49 | Ga0070689_100000477 | 3300005340 | Bacteria | 23646 |
| 50 | Ga0070689_100009455 | 3300005340 | Bacteria | 6910 |
| 51 | Ga0070689_100181231 | 3300005340 | Unclassified | 1711 |
| 52 | Ga0070661_100018563 | 3300005344 | Unclassified | 4947 |
| 53 | Ga0070692_10012597 | 3300005345 | Bacteria | 3919 |
| 54 | Ga0070692_10021813 | 3300005345 | Bacteria | 3120 |
| 55 | Ga0070668_100000485 | 3300005347 | Bacteria | 26322 |
| 56 | Ga0070669_100002344 | 3300005353 | Bacteria | 13688 |
| 57 | Ga0070669_100032694 | 3300005353 | Unclassified | 3758 |
| 58 | Ga0070669_100061120 | 3300005353 | Bacteria | 2768 |
| 59 | Ga0070675_100034602 | 3300005354 | Bacteria | 4101 |
| 60 | Ga0070671_100065176 | 3300005355 | Bacteria | 3034 |
| 61 | Ga0070671_100078029 | 3300005355 | Bacteria | 2768 |
| 62 | Ga0070673_100011473 | 3300005364 | Bacteria | 6047 |
| 63 | Ga0070673_100323007 | 3300005364 | Archaea | 1364 |
| 64 | Ga0070688_100039588 | 3300005365 | Unclassified | 2885 |
| 65 | Ga0070659_100000907 | 3300005366 | Bacteria | 21655 |
| 66 | Ga0070659_100006997 | 3300005366 | Bacteria | 8166 |
| 67 | Ga0070667_100014914 | 3300005367 | Bacteria | 6419 |
| 68 | Ga0070667_100018335 | 3300005367 | Bacteria | 5803 |
| 69 | Ga0070667_100030209 | 3300005367 | Bacteria | 4519 |
| 70 | Ga0070703_10000196 | 3300005406 | Bacteria | 29410 |
| 71 | Ga0070703_10005842 | 3300005406 | Bacteria | 3448 |
| 72 | Ga0070709_10000044 | 3300005434 | Bacteria | 101838 |
| 73 | Ga0070711_100000005 | 3300005439 | Bacteria | 187807 |
| 74 | Ga0070705_100000004 | 3300005440 | Bacteria | 127804 |
| 75 | Ga0070705_100272451 | 3300005440 | Bacteria | 1199 |
| 76 | Ga0070700_100000282 | 3300005441 | Bacteria | 26812 |
| 77 | Ga0070700_100011695 | 3300005441 | Bacteria | 4869 |
| 78 | Ga0070700_100014323 | 3300005441 | Bacteria | 4475 |
| 79 | Ga0070700_100030135 | 3300005441 | Bacteria | 3240 |
| 80 | Ga0070700_100043333 | 3300005441 | Bacteria | 2768 |
| 81 | Ga0070700_100080457 | 3300005441 | Bacteria | 2102 |
| 82 | Ga0070694_100013822 | 3300005444 | Bacteria | 5047 |
| 83 | Ga0070694_100025866 | 3300005444 | Bacteria | 3800 |
| 84 | Ga0070694_100053286 | 3300005444 | Unclassified | 2737 |
| 85 | Ga0070694_100073602 | 3300005444 | Bacteria | 2360 |
| 86 | Ga0070708_100000354 | 3300005445 | Bacteria | 34774 |
| 87 | Ga0070708_100043850 | 3300005445 | Bacteria | 3931 |
| 88 | Ga0070708_100055229 | 3300005445 | Bacteria | 3531 |
| 89 | Ga0070663_100002213 | 3300005455 | Bacteria | 10879 |
| 90 | Ga0070662_100077810 | 3300005457 | Unclassified | 2462 |
| 91 | Ga0070662_100093776 | 3300005457 | Unclassified | 2259 |
| 92 | Ga0070662_100225513 | 3300005457 | Unclassified | 1497 |
| 93 | Ga0070681_10000061 | 3300005458 | Bacteria | 78507 |
| 94 | Ga0070681_10005697 | 3300005458 | Bacteria | 12039 |
| 95 | Ga0070681_10187820 | 3300005458 | Bacteria | 1986 |
| 96 | Ga0070681_10328364 | 3300005458 | Bacteria | 1439 |
| 97 | Ga0068867_100113299 | 3300005459 | Bacteria | 2086 |
| 98 | Ga0070685_10016779 | 3300005466 | Unclassified | 3907 |
| 99 | Ga0070706_100000123 | 3300005467 | Bacteria | 94768 |
| 100 | Ga0070706_100000191 | 3300005467 | Bacteria | 76922 |
| 101 | Ga0070706_100122282 | 3300005467 | Bacteria | 2426 |
| 102 | Ga0070706_100346954 | 3300005467 | Bacteria | 1384 |
| 103 | Ga0070707_100000480 | 3300005468 | Bacteria | 39510 |
| 104 | Ga0070707_100005532 | 3300005468 | Bacteria | 11803 |
| 105 | Ga0070707_100133399 | 3300005468 | Bacteria | 2415 |
| 106 | Ga0070698_100013529 | 3300005471 | Bacteria | 8639 |
| 107 | Ga0070698_100017775 | 3300005471 | Bacteria | 7489 |
| 108 | Ga0070698_100092672 | 3300005471 | Bacteria | 3002 |
| 109 | Ga0070698_100098703 | 3300005471 | Bacteria | 2894 |
| 110 | Ga0070698_100105194 | 3300005471 | Bacteria | 2792 |
| 111 | Ga0070698_100262650 | 3300005471 | Bacteria | 1659 |
| 112 | Ga0070699_100000079 | 3300005518 | Bacteria | 92794 |
| 113 | Ga0070699_100012076 | 3300005518 | Bacteria | 7451 |
| 114 | Ga0070699_100077462 | 3300005518 | Bacteria | 2894 |
| 115 | Ga0070699_100119080 | 3300005518 | Bacteria | 2321 |
| 116 | Ga0070699_100166368 | 3300005518 | Bacteria | 1953 |
| 117 | Ga0070699_100391916 | 3300005518 | Bacteria | 1255 |
| 118 | Ga0070679_100000097 | 3300005530 | Bacteria | 67206 |
| 119 | Ga0070679_100007956 | 3300005530 | Bacteria | 9949 |
| 120 | Ga0070697_100016913 | 3300005536 | Bacteria | 5733 |
| 121 | Ga0070697_100040223 | 3300005536 | Bacteria | 3781 |
| 122 | Ga0070697_100151793 | 3300005536 | Bacteria | 1953 |
| 123 | Ga0070697_100372732 | 3300005536 | Bacteria | 1235 |
| 124 | Ga0068853_100064583 | 3300005539 | Bacteria | 3175 |
| 125 | Ga0068853_100073772 | 3300005539 | Unclassified | 2976 |
| 126 | Ga0068853_100211749 | 3300005539 | Bacteria | 1767 |
| 127 | Ga0070672_100000994 | 3300005543 | Bacteria | 17139 |
| 128 | Ga0070672_100016553 | 3300005543 | Bacteria | 5281 |
| 129 | Ga0070672_100144289 | 3300005543 | Bacteria | 1966 |
| 130 | Ga0070672_100147509 | 3300005543 | Bacteria | 1944 |
| 131 | Ga0070686_100151359 | 3300005544 | Bacteria | 1625 |
| 132 | Ga0070695_100060917 | 3300005545 | Bacteria | 2447 |
| 133 | Ga0070695_100085547 | 3300005545 | Bacteria | 2094 |
| 134 | Ga0070695_100102821 | 3300005545 | Bacteria | 1927 |
| 135 | Ga0070695_100431515 | 3300005545 | Bacteria | 1005 |
| 136 | Ga0070696_100001170 | 3300005546 | Bacteria | 16984 |
| 137 | Ga0070696_100111611 | 3300005546 | Unclassified | 1969 |
| 138 | Ga0070696_100197202 | 3300005546 | Bacteria | 1501 |
| 139 | Ga0070693_100002062 | 3300005547 | Bacteria | 9206 |
| 140 | Ga0070693_100019434 | 3300005547 | Bacteria | 3561 |
| 141 | Ga0070704_100024049 | 3300005549 | Bacteria | 3991 |
| 142 | Ga0070704_100107393 | 3300005549 | Bacteria | 2117 |
| 143 | Ga0070704_100198868 | 3300005549 | Bacteria | 1616 |
| 144 | Ga0068855_100001460 | 3300005563 | Bacteria | 29509 |
| 145 | Ga0068855_100009255 | 3300005563 | Bacteria | 11902 |
| 146 | Ga0068855_100318355 | 3300005563 | Bacteria | 1720 |
| 147 | Ga0068855_100325446 | 3300005563 | Bacteria | 1698 |
| 148 | Ga0070664_100003354 | 3300005564 | Bacteria | 12948 |
| 149 | Ga0070664_100075439 | 3300005564 | Bacteria | 2896 |
| 150 | Ga0070664_100155895 | 3300005564 | Bacteria | 2018 |
| 151 | Ga0068857_100014362 | 3300005577 | Bacteria | 6903 |
| 152 | Ga0068857_100219200 | 3300005577 | Bacteria | 1737 |
| 153 | Ga0068854_100015039 | 3300005578 | Bacteria | 5116 |
| 154 | Ga0068854_100031272 | 3300005578 | Unclassified | 3698 |
| 155 | Ga0068854_100074275 | 3300005578 | Bacteria | 2494 |
| 156 | Ga0068856_100002373 | 3300005614 | Bacteria | 19382 |
| 157 | Ga0068856_100022407 | 3300005614 | Bacteria | 6141 |
| 158 | Ga0068856_100061353 | 3300005614 | Bacteria | 3714 |
| 159 | Ga0070702_100005951 | 3300005615 | Bacteria | 5735 |
| 160 | Ga0070702_100026898 | 3300005615 | Bacteria | 3097 |
| 161 | Ga0070702_100058777 | 3300005615 | Bacteria | 2229 |
| 162 | Ga0068852_100152395 | 3300005616 | Bacteria | 2151 |
| 163 | Ga0068852_100368394 | 3300005616 | Unclassified | 1407 |
| 164 | Ga0068859_100017121 | 3300005617 | Bacteria | 7278 |
| 165 | Ga0068859_100044540 | 3300005617 | Bacteria | 4458 |
| 166 | Ga0068859_100331917 | 3300005617 | Bacteria | 1615 |
| 167 | Ga0068859_100480199 | 3300005617 | Bacteria | 1338 |
| 168 | Ga0068864_100002693 | 3300005618 | Bacteria | 14639 |
| 169 | Ga0068864_100008341 | 3300005618 | Bacteria | 8550 |
| 170 | Ga0068864_100059732 | 3300005618 | Bacteria | 3299 |
| 171 | Ga0068864_100107090 | 3300005618 | Unclassified | 2486 |
| 172 | Ga0068864_100155817 | 3300005618 | Bacteria | 2073 |
| 173 | Ga0068864_100156235 | 3300005618 | Bacteria | 2070 |
| 174 | Ga0068864_100230186 | 3300005618 | Bacteria | 1714 |
| 175 | Ga0068866_10076614 | 3300005718 | Bacteria | 1784 |
| 176 | Ga0068861_100001080 | 3300005719 | Bacteria | 16847 |
| 177 | Ga0068870_10012945 | 3300005840 | Bacteria | 3909 |
| 178 | Ga0068863_100008702 | 3300005841 | Bacteria | 9915 |
| 179 | Ga0068863_100147345 | 3300005841 | Bacteria | 2252 |
| 180 | Ga0068863_100261267 | 3300005841 | Unclassified | 1674 |
| 181 | Ga0068858_100000008 | 3300005842 | Bacteria | 238361 |
| 182 | Ga0068858_100091996 | 3300005842 | Unclassified | 2823 |
| 183 | Ga0068858_100175608 | 3300005842 | Bacteria | 2021 |
| 184 | Ga0068858_100183069 | 3300005842 | Bacteria | 1979 |
| 185 | Ga0068860_100029308 | 3300005843 | Bacteria | 5293 |
| 186 | Ga0068860_100103959 | 3300005843 | Bacteria | 2711 |
| 187 | Ga0068860_100180542 | 3300005843 | Bacteria | 2040 |
| 188 | Ga0068862_100219729 | 3300005844 | Bacteria | 1720 |
| 189 | Ga0068862_100470568 | 3300005844 | Bacteria | 1188 |
| 190 | Ga0081539_10000281 | 3300005985 | Bacteria | 114795 |
| 191 | Ga0081539_10001696 | 3300005985 | Bacteria | 35529 |
| 192 | Ga0070716_100023080 | 3300006173 | Bacteria | 3295 |
| 193 | Ga0070716_100163570 | 3300006173 | Bacteria | 1445 |
| 194 | Ga0070712_100262382 | 3300006175 | Bacteria | 1384 |
| 195 | Ga0075367_10160637 | 3300006178 | Bacteria | 1397 |
| 196 | Ga0075366_10000587 | 3300006195 | Bacteria | 17036 |
| 197 | Ga0075366_10000717 | 3300006195 | Bacteria | 15728 |
| 198 | Ga0075366_10002129 | 3300006195 | Bacteria | 10070 |
| 199 | Ga0075366_10003484 | 3300006195 | Bacteria | 8315 |
| 200 | Ga0097621_100000818 | 3300006237 | Bacteria | 21982 |
| 201 | Ga0097621_100001790 | 3300006237 | Bacteria | 14753 |
| 202 | Ga0097621_100002333 | 3300006237 | Bacteria | 13006 |
| 203 | Ga0097621_100009111 | 3300006237 | Bacteria | 7194 |
| 204 | Ga0097621_100011629 | 3300006237 | Bacteria | 6490 |
| 205 | Ga0068871_100000027 | 3300006358 | Bacteria | 78588 |
| 206 | Ga0068871_100008440 | 3300006358 | Bacteria | 7410 |
| 207 | Ga0068871_100021708 | 3300006358 | Bacteria | 4940 |
| 208 | Ga0068871_100179954 | 3300006358 | Bacteria | 1816 |
| 209 | Ga0075428_100006981 | 3300006844 | Bacteria | 12527 |
| 210 | Ga0075428_100134189 | 3300006844 | Bacteria | 2692 |
| 211 | Ga0075428_100350893 | 3300006844 | Bacteria | 1584 |
| 212 | Ga0075428_100368169 | 3300006844 | Bacteria | 1541 |
| 213 | Ga0075430_100002853 | 3300006846 | Bacteria | 14471 |
| 214 | Ga0075430_100115917 | 3300006846 | Bacteria | 2232 |
| 215 | Ga0075431_100000012 | 3300006847 | Bacteria | 93206 |
| 216 | Ga0075433_10017729 | 3300006852 | Bacteria | 5907 |
| 217 | Ga0075433_10030288 | 3300006852 | Unclassified | 4616 |
| 218 | Ga0075433_10045416 | 3300006852 | Bacteria | 3819 |
| 219 | Ga0075433_10126401 | 3300006852 | Bacteria | 2270 |
| 220 | Ga0075433_10233194 | 3300006852 | Bacteria | 1634 |
| 221 | Ga0075434_100003290 | 3300006871 | Bacteria | 14444 |
| 222 | Ga0075434_100007068 | 3300006871 | Bacteria | 10363 |
| 223 | Ga0075434_100008100 | 3300006871 | Bacteria | 9747 |
| 224 | Ga0075434_100113435 | 3300006871 | Bacteria | 2722 |
| 225 | Ga0075434_100164981 | 3300006871 | Bacteria | 2235 |
| 226 | Ga0075434_100354863 | 3300006871 | Bacteria | 1487 |
| 227 | Ga0075429_100000250 | 3300006880 | Bacteria | 36963 |
| 228 | Ga0075429_100116173 | 3300006880 | Bacteria | 2339 |
| 229 | Ga0068865_100086347 | 3300006881 | Bacteria | 2265 |
| 230 | Ga0068865_100113608 | 3300006881 | Bacteria | 2002 |
| 231 | Ga0075436_100000294 | 3300006914 | Bacteria | 31712 |
| 232 | Ga0075436_100002610 | 3300006914 | Bacteria | 12388 |
| 233 | Ga0075436_100047920 | 3300006914 | Bacteria | 2948 |
| 234 | Ga0097620_100017121 | 3300006931 | Bacteria | 7278 |
| 235 | Ga0097620_100044538 | 3300006931 | Bacteria | 4458 |
| 236 | Ga0097620_100331892 | 3300006931 | Bacteria | 1615 |
| 237 | Ga0097620_100480246 | 3300006931 | Bacteria | 1338 |
| 238 | Ga0075435_100017855 | 3300007076 | Bacteria | 5378 |
| 239 | Ga0075435_100067969 | 3300007076 | Unclassified | 2902 |
| 240 | Ga0105244_10021952 | 3300009036 | Bacteria | 3519 |
| 241 | Ga0105244_10039616 | 3300009036 | Bacteria | 2452 |
| 242 | Ga0105244_10151452 | 3300009036 | Bacteria | 1111 |
| 243 | Ga0105250_10024464 | 3300009092 | Bacteria | 2434 |
| 244 | Ga0105250_10042104 | 3300009092 | Bacteria | 1830 |
| 245 | Ga0105240_10000010 | 3300009093 | Bacteria | 537830 |
| 246 | Ga0105240_10114782 | 3300009093 | Bacteria | 3253 |
| 247 | Ga0105240_10159575 | 3300009093 | Bacteria | 2680 |
| 248 | Ga0111539_10008333 | 3300009094 | Bacteria | 13193 |
| 249 | Ga0111539_10008642 | 3300009094 | Bacteria | 12928 |
| 250 | Ga0111539_10057935 | 3300009094 | Bacteria | 4598 |
| 251 | Ga0105245_10066688 | 3300009098 | Unclassified | 3258 |
| 252 | Ga0105245_10294029 | 3300009098 | Bacteria | 1592 |
| 253 | Ga0105247_10000001 | 3300009101 | Bacteria | 739726 |
| 254 | Ga0105247_10001705 | 3300009101 | Bacteria | 15493 |
| 255 | Ga0114129_10001534 | 3300009147 | Bacteria | 31295 |
| 256 | Ga0114129_10025501 | 3300009147 | Bacteria | 8378 |
| 257 | Ga0114129_10040498 | 3300009147 | Bacteria | 6568 |
| 258 | Ga0114129_10044738 | 3300009147 | Bacteria | 6227 |
| 259 | Ga0114129_10057615 | 3300009147 | Bacteria | 5436 |
| 260 | Ga0114129_10108521 | 3300009147 | Unclassified | 3832 |
| 261 | Ga0114129_10224681 | 3300009147 | Bacteria | 2531 |
| 262 | Ga0114129_10743159 | 3300009147 | Bacteria | 1257 |
| 263 | Ga0105243_10003364 | 3300009148 | Bacteria | 12974 |
| 264 | Ga0105243_10010076 | 3300009148 | Bacteria | 7187 |
| 265 | Ga0105243_10017495 | 3300009148 | Bacteria | 5419 |
| 266 | Ga0105243_10463132 | 3300009148 | Bacteria | 1192 |
| 267 | Ga0105241_10003391 | 3300009174 | Bacteria | 11857 |
| 268 | Ga0105241_10077738 | 3300009174 | Bacteria | 2591 |
| 269 | Ga0105241_10261984 | 3300009174 | Bacteria | 1469 |
| 270 | Ga0105241_10341604 | 3300009174 | Bacteria | 1297 |
| 271 | Ga0105242_10000891 | 3300009176 | Bacteria | 23188 |
| 272 | Ga0105242_10012803 | 3300009176 | Bacteria | 6461 |
| 273 | Ga0105242_10125801 | 3300009176 | Bacteria | 2206 |
| 274 | Ga0105248_10007624 | 3300009177 | Bacteria | 11890 |
| 275 | Ga0105248_10022506 | 3300009177 | Bacteria | 6991 |
| 276 | Ga0105248_10050320 | 3300009177 | Bacteria | 4673 |
| 277 | Ga0105248_10170651 | 3300009177 | Bacteria | 2452 |
| 278 | Ga0105248_10230959 | 3300009177 | Unclassified | 2083 |
| 279 | Ga0105237_10000243 | 3300009545 | Bacteria | 77722 |
| 280 | Ga0105237_10001478 | 3300009545 | Bacteria | 30966 |
| 281 | Ga0105237_10001876 | 3300009545 | Bacteria | 26824 |
| 282 | Ga0105237_10004342 | 3300009545 | Bacteria | 16433 |
| 283 | Ga0105237_10050332 | 3300009545 | Bacteria | 4186 |
| 284 | Ga0105237_10241497 | 3300009545 | Bacteria | 1808 |
| 285 | Ga0105237_10438580 | 3300009545 | Bacteria | 1312 |
| 286 | Ga0105238_10005420 | 3300009551 | Bacteria | 12606 |
| 287 | Ga0105238_10162218 | 3300009551 | Bacteria | 2211 |
| 288 | Ga0105249_10000082 | 3300009553 | Bacteria | 137479 |
| 289 | Ga0105249_10170865 | 3300009553 | Bacteria | 2108 |
| 290 | Ga0105249_10197449 | 3300009553 | Bacteria | 1967 |
| 291 | Ga0105249_10350697 | 3300009553 | Bacteria | 1495 |
| 292 | Ga0105239_10000017 | 3300010375 | Bacteria | 290760 |
| 293 | Ga0105239_10000049 | 3300010375 | Bacteria | 177578 |
| 294 | Ga0105239_10001384 | 3300010375 | Bacteria | 32533 |
| 295 | Ga0105239_10116890 | 3300010375 | Bacteria | 2960 |
| 296 | Ga0105239_10504817 | 3300010375 | Bacteria | 1375 |
| 297 | Ga0105246_10019191 | 3300011119 | Unclassified | 4365 |
| 298 | Ga0105246_10081231 | 3300011119 | Bacteria | 2310 |
| 299 | Ga0157373_10000271 | 3300013100 | Bacteria | 41646 |
| 300 | Ga0157373_10023117 | 3300013100 | Bacteria | 4507 |
| 301 | Ga0157370_10125654 | 3300013104 | Bacteria | 2394 |
| 302 | Ga0157370_10171708 | 3300013104 | Bacteria | 2015 |
| 303 | Ga0157369_10001079 | 3300013105 | Bacteria | 34142 |
| 304 | Ga0157369_10142629 | 3300013105 | Bacteria | 2534 |
| 305 | Ga0157374_10226269 | 3300013296 | Unclassified | 1837 |
| 306 | Ga0157378_10000019 | 3300013297 | Bacteria | 132704 |
| 307 | Ga0157378_10002520 | 3300013297 | Bacteria | 16294 |
| 308 | Ga0157378_10002795 | 3300013297 | Bacteria | 15564 |
| 309 | Ga0157378_10653839 | 3300013297 | Bacteria | 1067 |
| 310 | Ga0163162_10000002 | 3300013306 | Bacteria | 717331 |
| 311 | Ga0163162_10001286 | 3300013306 | Bacteria | 23460 |
| 312 | Ga0163162_10001331 | 3300013306 | Bacteria | 23058 |
| 313 | Ga0163162_10004456 | 3300013306 | Bacteria | 13495 |
| 314 | Ga0163162_10016391 | 3300013306 | Bacteria | 7242 |
| 315 | Ga0163162_10233942 | 3300013306 | Bacteria | 1968 |
| 316 | Ga0163162_10743197 | 3300013306 | Bacteria | 1101 |
| 317 | Ga0157372_10000039 | 3300013307 | Bacteria | 165839 |
| 318 | Ga0157372_10001854 | 3300013307 | Bacteria | 22916 |
| 319 | Ga0157372_10003585 | 3300013307 | Bacteria | 16704 |
| 320 | Ga0157372_10014058 | 3300013307 | Bacteria | 8550 |
| 321 | Ga0157372_10671503 | 3300013307 | Bacteria | 1206 |
| 322 | Ga0157375_10002102 | 3300013308 | Bacteria | 17186 |
| 323 | Ga0157375_10002184 | 3300013308 | Bacteria | 16916 |
| 324 | Ga0157375_10010071 | 3300013308 | Bacteria | 8313 |
| 325 | Ga0157375_10051184 | 3300013308 | Bacteria | 4055 |
| 326 | Ga0157375_10093906 | 3300013308 | Bacteria | 3067 |
| 327 | Ga0157375_10351444 | 3300013308 | Bacteria | 1640 |
| 328 | Ga0157375_10683378 | 3300013308 | Bacteria | 1181 |
| 329 | Ga0163163_10001860 | 3300014325 | Bacteria | 17819 |
| 330 | Ga0163163_10002627 | 3300014325 | Bacteria | 15209 |
| 331 | Ga0163163_10011288 | 3300014325 | Bacteria | 8096 |
| 332 | Ga0163163_10035537 | 3300014325 | Bacteria | 4835 |
| 333 | Ga0163163_10052764 | 3300014325 | Bacteria | 4012 |
| 334 | Ga0163163_10065484 | 3300014325 | Bacteria | 3607 |
| 335 | Ga0163163_10236617 | 3300014325 | Bacteria | 1875 |
| 336 | Ga0157380_10001945 | 3300014326 | Bacteria | 13738 |
| 337 | Ga0157379_10068136 | 3300014968 | Unclassified | 3182 |
| 338 | Ga0157379_10190366 | 3300014968 | Bacteria | 1854 |
| 339 | Ga0157376_10014310 | 3300014969 | Bacteria | 5950 |
| 340 | Ga0157376_10014352 | 3300014969 | Bacteria | 5944 |
| 341 | Ga0157376_10103497 | 3300014969 | Bacteria | 2493 |
| 342 | Ga0163161_10091511 | 3300017792 | Unclassified | 2251 |
| 343 | Ga0163161_10132652 | 3300017792 | Bacteria | 1880 |
| 344 | Ga0163161_10148331 | 3300017792 | Bacteria | 1781 |
| 345 | Ga0207672_1000029 | 3300025223 | Bacteria | 18151 |
| 346 | Ga0209784_100182 | 3300025224 | Bacteria | 50922 |
| 347 | Ga0209026_1000201 | 3300025250 | Bacteria | 82838 |
| 348 | Ga0209233_1000485 | 3300025261 | Bacteria | 24300 |
| 349 | Ga0209130_1001355 | 3300025284 | Bacteria | 16545 |
| 350 | Ga0209130_1012524 | 3300025284 | Bacteria | 2213 |
| 351 | Ga0209676_1001031 | 3300025292 | Bacteria | 32380 |
| 352 | Ga0209676_1001852 | 3300025292 | Bacteria | 17435 |
| 353 | Ga0209025_1000136 | 3300025294 | Bacteria | 190335 |
| 354 | Ga0209025_1000156 | 3300025294 | Bacteria | 168932 |
| 355 | Ga0209025_1001301 | 3300025294 | Bacteria | 34084 |
| 356 | Ga0209025_1002853 | 3300025294 | Bacteria | 17337 |
| 357 | Ga0209025_1010042 | 3300025294 | Bacteria | 6479 |
| 358 | Ga0209025_1011240 | 3300025294 | Bacteria | 5930 |
| 359 | Ga0209025_1014487 | 3300025294 | Bacteria | 4843 |
| 360 | Ga0209025_1015969 | 3300025294 | Bacteria | 4474 |
| 361 | Ga0209025_1021704 | 3300025294 | Bacteria | 3444 |
| 362 | Ga0207697_10013777 | 3300025315 | Unclassified | 3368 |
| 363 | Ga0207696_1002910 | 3300025711 | Bacteria | 8054 |
| 364 | Ga0207655_1014413 | 3300025728 | Bacteria | 4468 |
| 365 | Ga0207653_10000250 | 3300025885 | Bacteria | 34622 |
| 366 | Ga0207653_10011818 | 3300025885 | Bacteria | 2724 |
| 367 | Ga0207642_10111639 | 3300025899 | Bacteria | 1393 |
| 368 | Ga0207642_10123889 | 3300025899 | Bacteria | 1338 |
| 369 | Ga0207710_10000003 | 3300025900 | Bacteria | 1071597 |
| 370 | Ga0207710_10004862 | 3300025900 | Bacteria | 5824 |
| 371 | Ga0207688_10198129 | 3300025901 | Bacteria | 1203 |
| 372 | Ga0207647_10003398 | 3300025904 | Bacteria | 11929 |
| 373 | Ga0207699_10000038 | 3300025906 | Bacteria | 125079 |
| 374 | Ga0207643_10005387 | 3300025908 | Bacteria | 6847 |
| 375 | Ga0207643_10017758 | 3300025908 | Bacteria | 3894 |
| 376 | Ga0207643_10059521 | 3300025908 | Unclassified | 2179 |
| 377 | Ga0207684_10000049 | 3300025910 | Bacteria | 240008 |
| 378 | Ga0207684_10000912 | 3300025910 | Bacteria | 33630 |
| 379 | Ga0207684_10054792 | 3300025910 | Bacteria | 3383 |
| 380 | Ga0207684_10064884 | 3300025910 | Bacteria | 3100 |
| 381 | Ga0207684_10142293 | 3300025910 | Bacteria | 2062 |
| 382 | Ga0207654_10012227 | 3300025911 | Bacteria | 4394 |
| 383 | Ga0207654_10034815 | 3300025911 | Bacteria | 2800 |
| 384 | Ga0207654_10207091 | 3300025911 | Bacteria | 1294 |
| 385 | Ga0207654_10283004 | 3300025911 | Bacteria | 1122 |
| 386 | Ga0207707_10000003 | 3300025912 | Bacteria | 642592 |
| 387 | Ga0207707_10081959 | 3300025912 | Unclassified | 2816 |
| 388 | Ga0207695_10000019 | 3300025913 | Bacteria | 732137 |
| 389 | Ga0207695_10000064 | 3300025913 | Bacteria | 346010 |
| 390 | Ga0207695_10093576 | 3300025913 | Bacteria | 3014 |
| 391 | Ga0207671_10001012 | 3300025914 | Bacteria | 34397 |
| 392 | Ga0207671_10007390 | 3300025914 | Bacteria | 9541 |
| 393 | Ga0207671_10018508 | 3300025914 | Bacteria | 5341 |
| 394 | Ga0207671_10027822 | 3300025914 | Bacteria | 4227 |
| 395 | Ga0207693_10110220 | 3300025915 | Bacteria | 2158 |
| 396 | Ga0207663_10000011 | 3300025916 | Bacteria | 172453 |
| 397 | Ga0207660_10032975 | 3300025917 | Bacteria | 3579 |
| 398 | Ga0207662_10000662 | 3300025918 | Bacteria | 15627 |
| 399 | Ga0207649_10020492 | 3300025920 | Unclassified | 3793 |
| 400 | Ga0207652_10000140 | 3300025921 | Bacteria | 76797 |
| 401 | Ga0207652_10028969 | 3300025921 | Unclassified | 4624 |
| 402 | Ga0207646_10001431 | 3300025922 | Bacteria | 29630 |
| 403 | Ga0207646_10010047 | 3300025922 | Bacteria | 9283 |
| 404 | Ga0207646_10086798 | 3300025922 | Bacteria | 2800 |
| 405 | Ga0207681_10067382 | 3300025923 | Bacteria | 2482 |
| 406 | Ga0207694_10123935 | 3300025924 | Bacteria | 2065 |
| 407 | Ga0207694_10194488 | 3300025924 | Bacteria | 1649 |
| 408 | Ga0207650_10000009 | 3300025925 | Bacteria | 483583 |
| 409 | Ga0207650_10043682 | 3300025925 | Bacteria | 3291 |
| 410 | Ga0207650_10059444 | 3300025925 | Unclassified | 2849 |
| 411 | Ga0207650_10178428 | 3300025925 | Bacteria | 1692 |
| 412 | Ga0207650_10273859 | 3300025925 | Bacteria | 1372 |
| 413 | Ga0207644_10000820 | 3300025931 | Bacteria | 19760 |
| 414 | Ga0207644_10010338 | 3300025931 | Bacteria | 6152 |
| 415 | Ga0207690_10000560 | 3300025932 | Bacteria | 24270 |
| 416 | Ga0207690_10070469 | 3300025932 | Unclassified | 2408 |
| 417 | Ga0207706_10173190 | 3300025933 | Unclassified | 1896 |
| 418 | Ga0207706_10299074 | 3300025933 | Bacteria | 1402 |
| 419 | Ga0207686_10023094 | 3300025934 | Bacteria | 3588 |
| 420 | Ga0207709_10008191 | 3300025935 | Bacteria | 5788 |
| 421 | Ga0207670_10000875 | 3300025936 | Bacteria | 15855 |
| 422 | Ga0207670_10005535 | 3300025936 | Bacteria | 6941 |
| 423 | Ga0207670_10381608 | 3300025936 | Bacteria | 1123 |
| 424 | Ga0207704_10004320 | 3300025938 | Bacteria | 6495 |
| 425 | Ga0207704_10064660 | 3300025938 | Bacteria | 2287 |
| 426 | Ga0207704_10172415 | 3300025938 | Bacteria | 1553 |
| 427 | Ga0207704_10176028 | 3300025938 | Bacteria | 1541 |
| 428 | Ga0207665_10035710 | 3300025939 | Bacteria | 3301 |
| 429 | Ga0207691_10000532 | 3300025940 | Bacteria | 38059 |
| 430 | Ga0207691_10001247 | 3300025940 | Bacteria | 25432 |
| 431 | Ga0207691_10159411 | 3300025940 | Bacteria | 1980 |
| 432 | Ga0207691_10330918 | 3300025940 | Bacteria | 1305 |
| 433 | Ga0207711_10002332 | 3300025941 | Bacteria | 17005 |
| 434 | Ga0207711_10014371 | 3300025941 | Bacteria | 6574 |
| 435 | Ga0207711_10030154 | 3300025941 | Bacteria | 4574 |
| 436 | Ga0207711_10032301 | 3300025941 | Unclassified | 4425 |
| 437 | Ga0207711_10036996 | 3300025941 | Bacteria | 4142 |
| 438 | Ga0207711_10061781 | 3300025941 | Bacteria | 3230 |
| 439 | Ga0207711_10177902 | 3300025941 | Bacteria | 1933 |
| 440 | Ga0207689_10006711 | 3300025942 | Bacteria | 10153 |
| 441 | Ga0207689_10342716 | 3300025942 | Bacteria | 1242 |
| 442 | Ga0207679_10010959 | 3300025945 | Bacteria | 5850 |
| 443 | Ga0207679_10058334 | 3300025945 | Bacteria | 2860 |
| 444 | Ga0207667_10003309 | 3300025949 | Bacteria | 19883 |
| 445 | Ga0207667_10016224 | 3300025949 | Bacteria | 8418 |
| 446 | Ga0207667_10586607 | 3300025949 | Bacteria | 1125 |
| 447 | Ga0207651_10054631 | 3300025960 | Bacteria | 2738 |
| 448 | Ga0207651_10079827 | 3300025960 | Bacteria | 2352 |
| 449 | Ga0207651_10158841 | 3300025960 | Bacteria | 1770 |
| 450 | Ga0207651_10190507 | 3300025960 | Bacteria | 1635 |
| 451 | Ga0207712_10000075 | 3300025961 | Bacteria | 120693 |
| 452 | Ga0207712_10102826 | 3300025961 | Bacteria | 2128 |
| 453 | Ga0207668_10001378 | 3300025972 | Bacteria | 14326 |
| 454 | Ga0207640_10013216 | 3300025981 | Bacteria | 4726 |
| 455 | Ga0207640_10131006 | 3300025981 | Bacteria | 1813 |
| 456 | Ga0207640_10203798 | 3300025981 | Bacteria | 1501 |
| 457 | Ga0207640_10434594 | 3300025981 | Bacteria | 1078 |
| 458 | Ga0207658_10022239 | 3300025986 | Bacteria | 4414 |
| 459 | Ga0207658_10041279 | 3300025986 | Bacteria | 3340 |
| 460 | Ga0207658_10075003 | 3300025986 | Bacteria | 2572 |
| 461 | Ga0207677_10001456 | 3300026023 | Bacteria | 12539 |
| 462 | Ga0207677_10017475 | 3300026023 | Bacteria | 4277 |
| 463 | Ga0207677_10165308 | 3300026023 | Bacteria | 1724 |
| 464 | Ga0207703_10063977 | 3300026035 | Bacteria | 3018 |
| 465 | Ga0207703_10064001 | 3300026035 | Bacteria | 3017 |
| 466 | Ga0207703_10073796 | 3300026035 | Unclassified | 2823 |
| 467 | Ga0207703_10220764 | 3300026035 | Bacteria | 1694 |
| 468 | Ga0207703_10302013 | 3300026035 | Bacteria | 1460 |
| 469 | Ga0207639_10055685 | 3300026041 | Unclassified | 3028 |
| 470 | Ga0207639_10135284 | 3300026041 | Bacteria | 2046 |
| 471 | Ga0207708_10000306 | 3300026075 | Bacteria | 38726 |
| 472 | Ga0207708_10005322 | 3300026075 | Bacteria | 9479 |
| 473 | Ga0207708_10020819 | 3300026075 | Bacteria | 4949 |
| 474 | Ga0207708_10035752 | 3300026075 | Bacteria | 3780 |
| 475 | Ga0207708_10043777 | 3300026075 | Bacteria | 3412 |
| 476 | Ga0207708_10058478 | 3300026075 | Bacteria | 2941 |
| 477 | Ga0207708_10064096 | 3300026075 | Bacteria | 2807 |
| 478 | Ga0207708_10073197 | 3300026075 | Bacteria | 2626 |
| 479 | Ga0207702_10165331 | 3300026078 | Bacteria | 2023 |
| 480 | Ga0207702_10204826 | 3300026078 | Bacteria | 1831 |
| 481 | Ga0207641_10046264 | 3300026088 | Bacteria | 3667 |
| 482 | Ga0207641_10062771 | 3300026088 | Bacteria | 3172 |
| 483 | Ga0207648_10063225 | 3300026089 | Bacteria | 3226 |
| 484 | Ga0207648_10078693 | 3300026089 | Unclassified | 2876 |
| 485 | Ga0207648_10099212 | 3300026089 | Bacteria | 2550 |
| 486 | Ga0207676_10002006 | 3300026095 | Bacteria | 14828 |
| 487 | Ga0207676_10003420 | 3300026095 | Bacteria | 11223 |
| 488 | Ga0207676_10006376 | 3300026095 | Bacteria | 8333 |
| 489 | Ga0207676_10063832 | 3300026095 | Bacteria | 2926 |
| 490 | Ga0207676_10157362 | 3300026095 | Bacteria | 1964 |
| 491 | Ga0207676_10163118 | 3300026095 | Bacteria | 1933 |
| 492 | Ga0207676_10488279 | 3300026095 | Bacteria | 1167 |
| 493 | Ga0207674_10000024 | 3300026116 | Bacteria | 156174 |
| 494 | Ga0207674_10167372 | 3300026116 | Bacteria | 2152 |
| 495 | Ga0207674_10177594 | 3300026116 | Bacteria | 2082 |
| 496 | Ga0207674_10589564 | 3300026116 | Bacteria | 1074 |
| 497 | Ga0207675_100006134 | 3300026118 | Bacteria | 11424 |
| 498 | Ga0207675_100016641 | 3300026118 | Bacteria | 6866 |
| 499 | Ga0207698_10099794 | 3300026142 | Bacteria | 2403 |
| 500 | Ga0207428_10002708 | 3300027907 | Bacteria | 17662 |
| 501 | Ga0207428_10015560 | 3300027907 | Bacteria | 6576 |
| 502 | Ga0207428_10055116 | 3300027907 | Bacteria | 3162 |
| 503 | Ga0268265_10108291 | 3300028380 | Bacteria | 2262 |
| 504 | Ga0268265_10228261 | 3300028380 | Bacteria | 1634 |
| 505 | Ga0268264_10087620 | 3300028381 | Bacteria | 2677 |
| 506 | Ga0268264_10310703 | 3300028381 | Unclassified | 1487 |
| 507 | Ga0268264_10406812 | 3300028381 | Bacteria | 1309 |
| 508 | Ga0265319_1002362 | 3300028563 | Bacteria | 10376 |
| 509 | Ga0265318_10000036 | 3300028577 | Bacteria | 138442 |
| 510 | Ga0307517_10020061 | 3300028786 | Bacteria | 8538 |
| 511 | Ga0307515_10107653 | 3300028794 | Bacteria | 3293 |
| 512 | Ga0237817_10047 | 3300030083 | Bacteria | 41405 |
| 513 | Ga0237817_10073 | 3300030083 | Bacteria | 30655 |
| 514 | Ga0265330_10000407 | 3300031235 | Bacteria | 29618 |
| 515 | Ga0265332_10000240 | 3300031238 | Bacteria | 43655 |
| 516 | Ga0265320_10001850 | 3300031240 | Bacteria | 15018 |
| 517 | Ga0265329_10000794 | 3300031242 | Bacteria | 16061 |
| 518 | Ga0265340_10001802 | 3300031247 | Bacteria | 12230 |
| 519 | Ga0265331_10021528 | 3300031250 | Bacteria | 3298 |
| 520 | Ga0265327_10000038 | 3300031251 | Bacteria | 292416 |
| 521 | Ga0265327_10000234 | 3300031251 | Bacteria | 112034 |
| 522 | Ga0265316_10027785 | 3300031344 | Bacteria | 4677 |
| 523 | Ga0307408_100452078 | 3300031548 | Bacteria | 1114 |
| 524 | Ga0265313_10000046 | 3300031595 | Bacteria | 114012 |
| 525 | Ga0265313_10001489 | 3300031595 | Bacteria | 21821 |
| 526 | Ga0307508_10126913 | 3300031616 | Bacteria | 2154 |
| 527 | Ga0265314_10051165 | 3300031711 | Bacteria | 2878 |
| 528 | Ga0265342_10000174 | 3300031712 | Bacteria | 71229 |
| 529 | Ga0265342_10042225 | 3300031712 | Bacteria | 2756 |
| 530 | Ga0307405_10171810 | 3300031731 | Bacteria | 1547 |
| 531 | Ga0307405_10339041 | 3300031731 | Bacteria | 1155 |
| 532 | Ga0307413_10115999 | 3300031824 | Bacteria | 1803 |
| 533 | Ga0307406_10195438 | 3300031901 | Bacteria | 1485 |
| 534 | Ga0307412_10037502 | 3300031911 | Bacteria | 3115 |
| 535 | Ga0307412_10182230 | 3300031911 | Bacteria | 1581 |
| 536 | Ga0307414_10001140 | 3300032004 | Bacteria | 13601 |
| 537 | Ga0307414_10511769 | 3300032004 | Bacteria | 1064 |
| 538 | Ga0307415_100038633 | 3300032126 | Bacteria | 3148 |
| 539 | Ga0307510_10060386 | 3300033180 | Bacteria | 3902 |
| 540 | Ga0373951_0000254 | 3300035091 | Bacteria | 17520 |
| 541 | Ga0373951_0024006 | 3300035091 | Bacteria | 1411 |
| 542 | Ga0373932_0053892 | 3300035112 | Bacteria | 1202 |
| 543 | Ga0373941_0003155 | 3300035115 | Bacteria | 3704 |
| 544 | Ga0395899_0001025 | 3300037312 | Bacteria | 25492 |
| 545 | Ga0395900_0131399 | 3300037418 | Bacteria | 2566 |
| 546 | Ga0395900_0590639 | 3300037418 | Bacteria | 1052 |
| 547 | Ga0395898_0284061 | 3300037466 | Bacteria | 1579 |
| 548 | Ga0237819_00181 | 3300038705 | Bacteria | 23104 |
| 549 | Ga0237819_00325 | 3300038705 | Bacteria | 17480 |
| 550 | Ga0400489_74505 | 3300039093 | Bacteria | 1389 |
| 551 | Ga0436365_0591950 | 3300039437 | Bacteria | 2759 |
| 552 | Ga0451577_0346541 | 3300042876 | Bacteria | 1347 |
| 553 | Ga0466969_0065576 | 3300044656 | Bacteria | 1755 |
| 554 | Ga0453683_0012148 | 3300044673 | Bacteria | 5652 |
| 555 | Ga0466966_0002402 | 3300044684 | Bacteria | 12225 |
| 556 | Ga0466970_0021342 | 3300044765 | Bacteria | 3373 |
| 557 | Ga0466959_0046529 | 3300045049 | Bacteria | 3192 |
| 558 | Ga0451576_0073094 | 3300045051 | Bacteria | 3568 |
| 559 | Ga0451576_0124662 | 3300045051 | Bacteria | 2684 |
| 560 | Ga0466958_0004917 | 3300045836 | Bacteria | 7124 |
| 561 | Ga0466967_0000820 | 3300045976 | Bacteria | 16327 |
| 562 | Ga0495650_0000081 | 3300046471 | Bacteria | 240957 |
| 563 | Ga0495580_0232281 | 3300046472 | Bacteria | 1266 |
| 564 | Ga0495585_0000036 | 3300046492 | Bacteria | 135914 |
| 565 | Ga0495596_0021225 | 3300046500 | Bacteria | 2652 |
| 566 | Ga0495606_0000034 | 3300046507 | Bacteria | 247705 |
| 567 | Ga0495606_0007210 | 3300046507 | Bacteria | 10022 |
| 568 | Ga0495606_0021571 | 3300046507 | Bacteria | 4717 |
| 569 | Ga0495610_0003276 | 3300046512 | Bacteria | 12761 |
| 570 | Ga0495616_0008353 | 3300046513 | Bacteria | 6141 |
| 571 | Ga0495620_0061159 | 3300046515 | Bacteria | 1568 |
| 572 | Ga0495631_0015081 | 3300046518 | Bacteria | 3713 |
| 573 | Ga0495632_0035043 | 3300046519 | Bacteria | 2564 |
| 574 | Ga0495637_0033076 | 3300046520 | Bacteria | 2274 |
| 575 | Ga0495598_0002140 | 3300046537 | Bacteria | 4034 |
| 576 | Ga0495621_0000749 | 3300046539 | Bacteria | 8212 |
| 577 | Ga0495625_0000049 | 3300046660 | Bacteria | 197646 |
| 578 | Ga0495625_0020849 | 3300046660 | Bacteria | 5053 |
| 579 | Ga0495661_0003026 | 3300046665 | Bacteria | 12671 |
| 580 | Ga0495661_0079747 | 3300046665 | Bacteria | 1891 |
| 581 | Ga0495647_0097594 | 3300046681 | Bacteria | 1213 |
| 582 | Ga0495649_0000014 | 3300046694 | Bacteria | 287408 |
| 583 | Ga0495649_0127154 | 3300046694 | Bacteria | 1345 |
| 584 | Ga0495660_0014741 | 3300046810 | Bacteria | 4521 |
| 585 | Ga0495636_0023277 | 3300047318 | Bacteria | 2507 |
| 586 | Ga0495687_000249 | 3300047443 | Bacteria | 72846 |
| 587 | Ga0495686_0004135 | 3300047472 | Bacteria | 12083 |
| 588 | Ga0496101_0060411 | 3300048904 | Bacteria | 2750 |
| 589 | Ga0496102_0031481 | 3300048905 | Bacteria | 4759 |
| 590 | Ga0496104_0199606 | 3300048907 | Bacteria | 1912 |
| 591 | Ga0496106_0135447 | 3300048909 | Bacteria | 1934 |
| 592 | Ga0496106_0255966 | 3300048909 | Bacteria | 1400 |
| 593 | Ga0496108_0046069 | 3300048911 | Bacteria | 3643 |
| 594 | Ga0496108_0071982 | 3300048911 | Bacteria | 2918 |
| 595 | Ga0496109_0000097 | 3300048912 | Bacteria | 90961 |
| 596 | Ga0496112_0082158 | 3300048915 | Bacteria | 3187 |
| 597 | Ga0496112_0108511 | 3300048915 | Bacteria | 2746 |
| 598 | Ga0496112_0135114 | 3300048915 | Bacteria | 2437 |
| 599 | Ga0496112_0441625 | 3300048915 | Bacteria | 1239 |
| 600 | Ga0496113_0409726 | 3300048916 | Bacteria | 1089 |
| 601 | Ga0501308_010861 | 3300049128 | Bacteria | 1018 |
| 602 | Ga0495678_006696 | 3300049459 | Bacteria | 6081 |
| 603 | Ga0501298_005299 | 3300049521 | Bacteria | 2063 |
| 604 | Ga0501299_005418 | 3300049522 | Unclassified | 1960 |
| 605 | Ga0501031_0137827 | 3300049568 | Bacteria | 1594 |
| 606 | Ga0501034_0377583 | 3300049571 | Bacteria | 1343 |
| 607 | Ga0501038_0038497 | 3300049574 | Bacteria | 4187 |
| 608 | Ga0501046_0202580 | 3300049580 | Bacteria | 1476 |
| 609 | Ga0501048_0083945 | 3300049582 | Bacteria | 2246 |
| 610 | Ga0501067_0008718 | 3300049583 | Bacteria | 5618 |
| 611 | Ga0501069_0020991 | 3300049585 | Bacteria | 3542 |
| 612 | Ga0501072_0064829 | 3300049588 | Bacteria | 2881 |
| 613 | Ga0501075_0012195 | 3300049591 | Bacteria | 6101 |
| 614 | Ga0501076_0196961 | 3300049592 | Bacteria | 1645 |
| 615 | Ga0501206_001020 | 3300049653 | Bacteria | 3497 |
| 616 | Ga0501207_000108 | 3300049654 | Bacteria | 6993 |
| 617 | Ga0501207_006923 | 3300049654 | Bacteria | 1605 |
| 618 | Ga0501217_000307 | 3300049661 | Bacteria | 7778 |
| 619 | Ga0501217_011657 | 3300049661 | Bacteria | 1948 |
| 620 | Ga0501223_001008 | 3300049663 | Bacteria | 6653 |
| 621 | Ga0501224_001484 | 3300049664 | Bacteria | 3111 |
| 622 | Ga0501233_001558 | 3300049668 | Bacteria | 3931 |
| 623 | Ga0501233_001714 | 3300049668 | Bacteria | 3774 |
| 624 | Ga0501240_000955 | 3300049673 | Bacteria | 2650 |
| 625 | Ga0501240_005790 | 3300049673 | Bacteria | 1496 |
| 626 | Ga0501242_004100 | 3300049674 | Bacteria | 1607 |
| 627 | Ga0501243_001346 | 3300049675 | Bacteria | 3509 |
| 628 | Ga0501243_005916 | 3300049675 | Bacteria | 1846 |
| 629 | Ga0501256_001338 | 3300049685 | Bacteria | 1796 |
| 630 | Ga0501257_001905 | 3300049686 | Bacteria | 4335 |
| 631 | Ga0501259_000262 | 3300049688 | Bacteria | 8273 |
| 632 | Ga0501221_000246 | 3300049704 | Bacteria | 7890 |
| 633 | Ga0501221_011851 | 3300049704 | Bacteria | 1578 |
| 634 | Ga0501221_013765 | 3300049704 | Bacteria | 1493 |
| 635 | Ga0501225_0001425 | 3300049705 | Bacteria | 7470 |
| 636 | Ga0501234_001984 | 3300049707 | Bacteria | 3236 |
| 637 | Ga0501079_0023586 | 3300049741 | Bacteria | 4722 |
| 638 | Ga0501080_0109114 | 3300049742 | Bacteria | 2565 |
| 639 | Ga0501283_003061 | 3300049779 | Bacteria | 2197 |
| 640 | Ga0501045_0021143 | 3300049824 | Bacteria | 4653 |
| 641 | Ga0501212_000907 | 3300049851 | Bacteria | 3122 |
| 642 | nmdc:mga0k408_1201_c1 | 3300050493 | Bacteria | 14176 |
| 643 | nmdc:mga0k408_1481_c1 | 3300050493 | Bacteria | 12676 |
| 644 | nmdc:mga0k408_609_c1 | 3300050493 | Bacteria | 19796 |
| 645 | nmdc:mga05p37_202765_c1 | 3300050507 | Bacteria | 2401 |
| 646 | nmdc:mga05p37_22121_c1 | 3300050507 | Bacteria | 7707 |
| 647 | nmdc:mga05p37_30492_c1 | 3300050507 | Bacteria | 6580 |
| 648 | nmdc:mga05p37_49159_c1 | 3300050507 | Bacteria | 5187 |
| 649 | nmdc:mga05p37_699_c1 | 3300050507 | Bacteria | 37199 |
| 650 | nmdc:mga05p37_8917_c1 | 3300050507 | Bacteria | 11854 |
| 651 | nmdc:mga09592_196566_c1 | 3300050508 | Bacteria | 1746 |
| 652 | nmdc:mga09592_4409_c1 | 3300050508 | Bacteria | 11388 |
| 653 | nmdc:mga0qj67_31079_c1 | 3300050509 | Bacteria | 4159 |
| 654 | nmdc:mga0qj67_7926_c1 | 3300050509 | Bacteria | 7848 |
| 655 | nmdc:mga06r32_111123_c1 | 3300050510 | Bacteria | 2697 |
| 656 | nmdc:mga06r32_157545_c1 | 3300050510 | Bacteria | 2252 |
| 657 | nmdc:mga06r32_162_c1 | 3300050510 | Bacteria | 51825 |
| 658 | nmdc:mga08y16_255458_c1 | 3300050511 | Unclassified | 1810 |
| 659 | nmdc:mga08y16_39125_c1 | 3300050511 | Bacteria | 4977 |
| 660 | nmdc:mga08y16_42768_c1 | 3300050511 | Bacteria | 4745 |
| 661 | nmdc:mga08y16_78613_c1 | 3300050511 | Bacteria | 3439 |
| 662 | nmdc:mga0n895_161819_c1 | 3300050512 | Bacteria | 2270 |
| 663 | nmdc:mga0n895_183479_c1 | 3300050512 | Bacteria | 2124 |
| 664 | nmdc:mga0n895_4428_c1 | 3300050512 | Bacteria | 11542 |
| 665 | nmdc:mga0n895_68243_c1 | 3300050512 | Bacteria | 3522 |
| 666 | nmdc:mga0rr50_108835_c1 | 3300050513 | Bacteria | 2190 |
| 667 | nmdc:mga0rr50_158766_c1 | 3300050513 | Bacteria | 1834 |
| 668 | nmdc:mga0rr50_362323_c1 | 3300050513 | Bacteria | 1220 |
| 669 | nmdc:mga08x19_1903_c1 | 3300050514 | Bacteria | 12756 |
| 670 | nmdc:mga08x19_2_c1 | 3300050514 | Bacteria | 741277 |
| 671 | nmdc:mga08x19_37044_c1 | 3300050514 | Bacteria | 3093 |
| 672 | nmdc:mga0a205_121134_c1 | 3300050515 | Bacteria | 2515 |
| 673 | nmdc:mga0a205_133791_c1 | 3300050515 | Bacteria | 2380 |
| 674 | nmdc:mga0a205_162390_c1 | 3300050515 | Bacteria | 2130 |
| 675 | nmdc:mga0a205_170898_c1 | 3300050515 | Bacteria | 2070 |
| 676 | nmdc:mga0a205_19597_c1 | 3300050515 | Bacteria | 6381 |
| 677 | nmdc:mga0a205_227272_c1 | 3300050515 | Unclassified | 1750 |
| 678 | nmdc:mga0a205_331679_c1 | 3300050515 | Bacteria | 1391 |
| 679 | nmdc:mga0a205_368438_c1 | 3300050515 | Bacteria | 1303 |
| 680 | nmdc:mga0a205_46214_c1 | 3300050515 | Bacteria | 4199 |
| 681 | nmdc:mga0a205_68530_c1 | 3300050515 | Bacteria | 3426 |
| 682 | Ga0495601_0157526 | 3300053077 | Unclassified | 1483 |
| 683 | Ga0500555_003266 | 3300053103 | Bacteria | 4616 |
| 684 | Ga0500608_001731 | 3300053122 | Bacteria | 7797 |
| 685 | Ga0500559_0047211 | 3300053136 | Bacteria | 1890 |
| 686 | Ga0500622_0003605 | 3300053156 | Bacteria | 10195 |
| 687 | Ga0500622_0124835 | 3300053156 | Bacteria | 1244 |
| 688 | Ga0500624_000472 | 3300053157 | Bacteria | 11992 |
| 689 | Ga0501084_0011717 | 3300054114 | Bacteria | 7258 |
| 690 | Ga0501084_0393320 | 3300054114 | Bacteria | 1171 |
| 691 | Ga0501082_0279701 | 3300060353 | Bacteria | 1453 |
| 692 | Ga0530510_0161773 | 3300061734 | Bacteria | 1656 |
| 693 | 2553392815 | 2551306519 | Bacteria | 5465154 |
| 694 | 2595088194 | 2593339131 | Bacteria | 5116855 |
| 695 | 2599481925 | 2599185184 | Bacteria | 6430550 |
| 696 | 2644704573 | 2643221729 | Bacteria | 6621700 |
| 697 | 2644709267 | 2643221730 | Bacteria | 6523787 |
| 698 | 2685149997 | 2684622632 | Bacteria | 5380049 |
| 699 | 2698323202 | 2695420987 | Bacteria | 6152737 |
| 700 | 2705994038 | 2703719227 | Bacteria | 5631989 |
| 701 | 2721505362 | 2718218445 | Bacteria | 5113413 |
| 702 | 2738817158 | 2738541295 | Bacteria | 5730091 |
| 703 | 2739159281 | 2738541358 | Bacteria | 5932299 |
| 704 | 2739211941 | 2738543006 | Bacteria | 5904091 |
| 705 | 2739267884 | 2738543017 | Bacteria | 4271950 |
| 706 | 2740031142 | 2739367866 | Bacteria | 4215900 |
| 707 | 2745167198 | 2744054657 | Bacteria | 5016802 |
| 708 | 2777839786 | 2775507192 | Bacteria | 4622234 |
| 709 | 2817616760 | 2816332336 | Bacteria | 5207640 |
| 710 | 2819571535 | 2818991441 | Bacteria | 5062707 |
| 711 | 2819578853 | 2818991443 | Bacteria | 6598732 |
| 712 | 2857587228 | 2857586860 | Bacteria | 4354574 |
| 713 | 2881958022 | 2881955468 | Bacteria | 3545609 |
| 714 | 2919190727 | 2919186247 | Bacteria | 6244071 |
| 715 | 2919419038 | 2919414237 | Bacteria | 5429133 |
| 716 | 2919440579 | 2919437846 | Bacteria | 6199444 |
| 717 | 2928084084 | 2928078545 | Bacteria | 6534839 |
| 718 | 2928152851 | 2928147474 | Bacteria | 6512076 |
| 719 | 2929235263 | 2929233124 | Bacteria | 5948380 |
| 720 | 2932087433 | 2932082852 | Bacteria | 6563563 |
| 721 | 2936363868 | 2936361878 | Bacteria | 5632809 |
| 722 | 2938919445 | 2938917290 | Bacteria | 5914775 |
| 723 | 2939597748 | 2939593269 | Bacteria | 4798695 |
| 724 | 2939669063 | 2939664404 | Bacteria | 6364494 |
| 725 | 2947428805 | 2947426588 | Bacteria | 5357194 |
| 726 | 2965763308 | 2965761152 | Bacteria | 5806513 |
| 727 | 2977259658 | 2977254563 | Bacteria | 4828420 |
| 728 | 2979085760 | 2979083700 | Bacteria | 5894929 |
| 729 | 2990275517 | 2990275345 | Bacteria | 4887158 |
| 730 | 3001894146 | 3001892409 | Bacteria | 6328293 |
| 731 | 3006978528 | 3006973921 | Bacteria | 4423788 |
| 732 | 3006979975 | 3006978542 | Bacteria | 5328100 |
| 733 | 8022625736 | 8022621104 | Bacteria | 5241040 |
| 734 | 8023444192 | 8023438354 | Bacteria | 5779374 |
| 735 | 8023449644 | 8023444577 | Bacteria | 5661597 |
| 736 | 8054282759 | 8054280661 | Bacteria | 4232245 |
| 737 | Ga0114129_10115544 | |||
| 738 | MRS1b_contig_1663259 | |||
| 739 | JGI24737J22298_10000097 | |||
| 740 | JGI24735J21928_10000007 | |||
| 741 | JGI24034J26672_10000002 | |||
| 742 | JGI25157J39369_1004215 | |||
| 743 | JGI25151J46595_10001377 | |||
| 744 | JGI25151J46595_10001863 | |||
| 745 | JGI25151J46595_10006116 | |||
| 746 | JGI25151J46595_10010655 | |||
| 747 | JGI25151J46595_10025188 | |||
| 748 | JGI25151J46595_10033737 | |||
| 749 | rootH1_10086689 | |||
| 750 | rootH2_10009713 | |||
| 751 | rootH2_10035798 | |||
| 752 | rootH2_10270546 | |||
| 753 | rootL2_10156444 | |||
| 754 | rootH1_10050749 | |||
| 755 | rootH1_10050750 | |||
| 756 | rootH1_10100346 | |||
| 757 | rootH1_10107607 | |||
| 758 | rootH1_10160410 | |||
| 759 | Ga0065714_10007468 | |||
| 760 | Ga0065714_10064452 | |||
| 761 | Ga0065714_10090251 | |||
| 762 | Ga0065704_10018369 | |||
| 763 | Ga0065704_10075745 | |||
| 764 | Ga0065704_10098471 | |||
| 765 | Ga0065704_10192970 | |||
| 766 | Ga0065712_10000126 | |||
| 767 | Ga0065712_10132409 | |||
| 768 | Ga0065715_10016731 | |||
| 769 | Ga0065715_10030556 | |||
| 770 | Ga0065715_10089100 | |||
| 771 | Ga0065715_10152398 | |||
| 772 | Ga0065707_10004795 | |||
| 773 | Ga0065707_10211243 | |||
| 774 | Ga0070683_100005282 | |||
| 775 | Ga0070690_100062870 | |||
| 776 | Ga0070670_100000197 | |||
| 777 | Ga0070670_100061085 | |||
| 778 | Ga0070670_100069198 | |||
| 779 | Ga0070670_100126539 | |||
| 780 | Ga0070680_100077232 | |||
| 781 | Ga0070682_100000521 | |||
| 782 | Ga0070682_100010419 | |||
| 783 | Ga0070682_100068716 | |||
| 784 | Ga0068868_100003527 | |||
| 785 | Ga0070689_100000477 | |||
| 786 | Ga0070689_100009455 | |||
| 787 | Ga0070689_100181231 | |||
| 788 | Ga0070661_100018563 | |||
| 789 | Ga0070692_10012597 | |||
| 790 | Ga0070692_10021813 | |||
| 791 | Ga0070668_100000485 | |||
| 792 | Ga0070669_100002344 | |||
| 793 | Ga0070669_100032694 | |||
| 794 | Ga0070669_100061120 | |||
| 795 | Ga0070675_100034602 | |||
| 796 | Ga0070671_100065176 | |||
| 797 | Ga0070671_100078029 | |||
| 798 | Ga0070673_100011473 | |||
| 799 | Ga0070673_100323007 | |||
| 800 | Ga0070688_100039588 | |||
| 801 | Ga0070659_100000907 | |||
| 802 | Ga0070659_100006997 | |||
| 803 | Ga0070667_100014914 | |||
| 804 | Ga0070667_100018335 | |||
| 805 | Ga0070667_100030209 | |||
| 806 | Ga0070703_10000196 | |||
| 807 | Ga0070703_10005842 | |||
| 808 | Ga0070709_10000044 | |||
| 809 | Ga0070711_100000005 | |||
| 810 | Ga0070705_100000004 | |||
| 811 | Ga0070705_100272451 | |||
| 812 | Ga0070700_100000282 | |||
| 813 | Ga0070700_100011695 | |||
| 814 | Ga0070700_100014323 | |||
| 815 | Ga0070700_100030135 | |||
| 816 | Ga0070700_100043333 | |||
| 817 | Ga0070700_100080457 | |||
| 818 | Ga0070694_100013822 | |||
| 819 | Ga0070694_100025866 | |||
| 820 | Ga0070694_100053286 | |||
| 821 | Ga0070694_100073602 | |||
| 822 | Ga0070708_100000354 | |||
| 823 | Ga0070708_100043850 | |||
| 824 | Ga0070708_100055229 | |||
| 825 | Ga0070663_100002213 | |||
| 826 | Ga0070662_100077810 | |||
| 827 | Ga0070662_100093776 | |||
| 828 | Ga0070662_100225513 | |||
| 829 | Ga0070681_10000061 | |||
| 830 | Ga0070681_10005697 | |||
| 831 | Ga0070681_10187820 | |||
| 832 | Ga0070681_10328364 | |||
| 833 | Ga0068867_100113299 | |||
| 834 | Ga0070685_10016779 | |||
| 835 | Ga0070706_100000123 | |||
| 836 | Ga0070706_100000191 | |||
| 837 | Ga0070706_100122282 | |||
| 838 | Ga0070706_100346954 | |||
| 839 | Ga0070707_100000480 | |||
| 840 | Ga0070707_100005532 | |||
| 841 | Ga0070707_100133399 | |||
| 842 | Ga0070698_100013529 | |||
| 843 | Ga0070698_100017775 | |||
| 844 | Ga0070698_100092672 | |||
| 845 | Ga0070698_100098703 | |||
| 846 | Ga0070698_100105194 | |||
| 847 | Ga0070698_100262650 | |||
| 848 | Ga0070699_100000079 | |||
| 849 | Ga0070699_100012076 | |||
| 850 | Ga0070699_100077462 | |||
| 851 | Ga0070699_100119080 | |||
| 852 | Ga0070699_100166368 | |||
| 853 | Ga0070699_100391916 | |||
| 854 | Ga0070679_100000097 | |||
| 855 | Ga0070679_100007956 | |||
| 856 | Ga0070697_100016913 | |||
| 857 | Ga0070697_100040223 | |||
| 858 | Ga0070697_100151793 | |||
| 859 | Ga0070697_100372732 | |||
| 860 | Ga0068853_100064583 | |||
| 861 | Ga0068853_100073772 | |||
| 862 | Ga0068853_100211749 | |||
| 863 | Ga0070672_100000994 | |||
| 864 | Ga0070672_100016553 | |||
| 865 | Ga0070672_100144289 | |||
| 866 | Ga0070672_100147509 | |||
| 867 | Ga0070686_100151359 | |||
| 868 | Ga0070695_100060917 | |||
| 869 | Ga0070695_100085547 | |||
| 870 | Ga0070695_100102821 | |||
| 871 | Ga0070695_100431515 | |||
| 872 | Ga0070696_100001170 | |||
| 873 | Ga0070696_100111611 | |||
| 874 | Ga0070696_100197202 | |||
| 875 | Ga0070693_100002062 | |||
| 876 | Ga0070693_100019434 | |||
| 877 | Ga0070704_100024049 | |||
| 878 | Ga0070704_100107393 | |||
| 879 | Ga0070704_100198868 | |||
| 880 | Ga0068855_100001460 | |||
| 881 | Ga0068855_100009255 | |||
| 882 | Ga0068855_100318355 | |||
| 883 | Ga0068855_100325446 | |||
| 884 | Ga0070664_100003354 | |||
| 885 | Ga0070664_100075439 | |||
| 886 | Ga0070664_100155895 | |||
| 887 | Ga0068857_100014362 | |||
| 888 | Ga0068857_100219200 | |||
| 889 | Ga0068854_100015039 | |||
| 890 | Ga0068854_100031272 | |||
| 891 | Ga0068854_100074275 | |||
| 892 | Ga0068856_100002373 | |||
| 893 | Ga0068856_100022407 | |||
| 894 | Ga0068856_100061353 | |||
| 895 | Ga0070702_100005951 | |||
| 896 | Ga0070702_100026898 | |||
| 897 | Ga0070702_100058777 | |||
| 898 | Ga0068852_100152395 | |||
| 899 | Ga0068852_100368394 | |||
| 900 | Ga0068859_100017121 | |||
| 901 | Ga0068859_100044540 | |||
| 902 | Ga0068859_100331917 | |||
| 903 | Ga0068859_100480199 | |||
| 904 | Ga0068864_100002693 | |||
| 905 | Ga0068864_100008341 | |||
| 906 | Ga0068864_100059732 | |||
| 907 | Ga0068864_100107090 | |||
| 908 | Ga0068864_100155817 | |||
| 909 | Ga0068864_100156235 | |||
| 910 | Ga0068864_100230186 | |||
| 911 | Ga0068866_10076614 | |||
| 912 | Ga0068861_100001080 | |||
| 913 | Ga0068870_10012945 | |||
| 914 | Ga0068863_100008702 | |||
| 915 | Ga0068863_100147345 | |||
| 916 | Ga0068863_100261267 | |||
| 917 | Ga0068858_100000008 | |||
| 918 | Ga0068858_100091996 | |||
| 919 | Ga0068858_100175608 | |||
| 920 | Ga0068858_100183069 | |||
| 921 | Ga0068860_100029308 | |||
| 922 | Ga0068860_100103959 | |||
| 923 | Ga0068860_100180542 | |||
| 924 | Ga0068862_100219729 | |||
| 925 | Ga0068862_100470568 | |||
| 926 | Ga0081539_10000281 | |||
| 927 | Ga0081539_10001696 | |||
| 928 | Ga0070716_100023080 | |||
| 929 | Ga0070716_100163570 | |||
| 930 | Ga0070712_100262382 | |||
| 931 | Ga0075367_10160637 | |||
| 932 | Ga0075366_10000587 | |||
| 933 | Ga0075366_10000717 | |||
| 934 | Ga0075366_10002129 | |||
| 935 | Ga0075366_10003484 | |||
| 936 | Ga0097621_100000818 | |||
| 937 | Ga0097621_100001790 | |||
| 938 | Ga0097621_100002333 | |||
| 939 | Ga0097621_100009111 | |||
| 940 | Ga0097621_100011629 | |||
| 941 | Ga0068871_100000027 | |||
| 942 | Ga0068871_100008440 | |||
| 943 | Ga0068871_100021708 | |||
| 944 | Ga0068871_100179954 | |||
| 945 | Ga0075428_100006981 | |||
| 946 | Ga0075428_100134189 | |||
| 947 | Ga0075428_100350893 | |||
| 948 | Ga0075428_100368169 | |||
| 949 | Ga0075430_100002853 | |||
| 950 | Ga0075430_100115917 | |||
| 951 | Ga0075431_100000012 | |||
| 952 | Ga0075433_10017729 | |||
| 953 | Ga0075433_10030288 | |||
| 954 | Ga0075433_10045416 | |||
| 955 | Ga0075433_10126401 | |||
| 956 | Ga0075433_10233194 | |||
| 957 | Ga0075434_100003290 | |||
| 958 | Ga0075434_100007068 | |||
| 959 | Ga0075434_100008100 | |||
| 960 | Ga0075434_100113435 | |||
| 961 | Ga0075434_100164981 | |||
| 962 | Ga0075434_100354863 | |||
| 963 | Ga0075429_100000250 | |||
| 964 | Ga0075429_100116173 | |||
| 965 | Ga0068865_100086347 | |||
| 966 | Ga0068865_100113608 | |||
| 967 | Ga0075436_100000294 | |||
| 968 | Ga0075436_100002610 | |||
| 969 | Ga0075436_100047920 | |||
| 970 | Ga0097620_100017121 | |||
| 971 | Ga0097620_100044538 | |||
| 972 | Ga0097620_100331892 | |||
| 973 | Ga0097620_100480246 | |||
| 974 | Ga0075435_100017855 | |||
| 975 | Ga0075435_100067969 | |||
| 976 | Ga0105244_10021952 | |||
| 977 | Ga0105244_10039616 | |||
| 978 | Ga0105244_10151452 | |||
| 979 | Ga0105250_10024464 | |||
| 980 | Ga0105250_10042104 | |||
| 981 | Ga0105240_10000010 | |||
| 982 | Ga0105240_10114782 | |||
| 983 | Ga0105240_10159575 | |||
| 984 | Ga0111539_10008333 | |||
| 985 | Ga0111539_10008642 | |||
| 986 | Ga0111539_10057935 | |||
| 987 | Ga0105245_10066688 | |||
| 988 | Ga0105245_10294029 | |||
| 989 | Ga0105247_10000001 | |||
| 990 | Ga0105247_10001705 | |||
| 991 | Ga0114129_10001534 | |||
| 992 | Ga0114129_10025501 | |||
| 993 | Ga0114129_10040498 | |||
| 994 | Ga0114129_10044738 | |||
| 995 | Ga0114129_10057615 | |||
| 996 | Ga0114129_10108521 | |||
| 997 | Ga0114129_10224681 | |||
| 998 | Ga0114129_10743159 | |||
| 999 | Ga0105243_10003364 | |||
| 1000 | Ga0105243_10010076 | |||
| 1001 | Ga0105243_10017495 | |||
| 1002 | Ga0105243_10463132 | |||
| 1003 | Ga0105241_10003391 | |||
| 1004 | Ga0105241_10077738 | |||
| 1005 | Ga0105241_10261984 | |||
| 1006 | Ga0105241_10341604 | |||
| 1007 | Ga0105242_10000891 | |||
| 1008 | Ga0105242_10012803 | |||
| 1009 | Ga0105242_10125801 | |||
| 1010 | Ga0105248_10007624 | |||
| 1011 | Ga0105248_10022506 | |||
| 1012 | Ga0105248_10050320 | |||
| 1013 | Ga0105248_10170651 | |||
| 1014 | Ga0105248_10230959 | |||
| 1015 | Ga0105237_10000243 | |||
| 1016 | Ga0105237_10001478 | |||
| 1017 | Ga0105237_10001876 | |||
| 1018 | Ga0105237_10004342 | |||
| 1019 | Ga0105237_10050332 | |||
| 1020 | Ga0105237_10241497 | |||
| 1021 | Ga0105237_10438580 | |||
| 1022 | Ga0105238_10005420 | |||
| 1023 | Ga0105238_10162218 | |||
| 1024 | Ga0105249_10000082 | |||
| 1025 | Ga0105249_10170865 | |||
| 1026 | Ga0105249_10197449 | |||
| 1027 | Ga0105249_10350697 | |||
| 1028 | Ga0105239_10000017 | |||
| 1029 | Ga0105239_10000049 | |||
| 1030 | Ga0105239_10001384 | |||
| 1031 | Ga0105239_10116890 | |||
| 1032 | Ga0105239_10504817 | |||
| 1033 | Ga0105246_10019191 | |||
| 1034 | Ga0105246_10081231 | |||
| 1035 | Ga0157373_10000271 | |||
| 1036 | Ga0157373_10023117 | |||
| 1037 | Ga0157370_10125654 | |||
| 1038 | Ga0157370_10171708 | |||
| 1039 | Ga0157369_10001079 | |||
| 1040 | Ga0157369_10142629 | |||
| 1041 | Ga0157374_10226269 | |||
| 1042 | Ga0157378_10000019 | |||
| 1043 | Ga0157378_10002520 | |||
| 1044 | Ga0157378_10002795 | |||
| 1045 | Ga0157378_10653839 | |||
| 1046 | Ga0163162_10000002 | |||
| 1047 | Ga0163162_10001286 | |||
| 1048 | Ga0163162_10001331 | |||
| 1049 | Ga0163162_10004456 | |||
| 1050 | Ga0163162_10016391 | |||
| 1051 | Ga0163162_10233942 | |||
| 1052 | Ga0163162_10743197 | |||
| 1053 | Ga0157372_10000039 | |||
| 1054 | Ga0157372_10001854 | |||
| 1055 | Ga0157372_10003585 | |||
| 1056 | Ga0157372_10014058 | |||
| 1057 | Ga0157372_10671503 | |||
| 1058 | Ga0157375_10002102 | |||
| 1059 | Ga0157375_10002184 | |||
| 1060 | Ga0157375_10010071 | |||
| 1061 | Ga0157375_10051184 | |||
| 1062 | Ga0157375_10093906 | |||
| 1063 | Ga0157375_10351444 | |||
| 1064 | Ga0157375_10683378 | |||
| 1065 | Ga0163163_10001860 | |||
| 1066 | Ga0163163_10002627 | |||
| 1067 | Ga0163163_10011288 | |||
| 1068 | Ga0163163_10035537 | |||
| 1069 | Ga0163163_10052764 | |||
| 1070 | Ga0163163_10065484 | |||
| 1071 | Ga0163163_10236617 | |||
| 1072 | Ga0157380_10001945 | |||
| 1073 | Ga0157379_10068136 | |||
| 1074 | Ga0157379_10190366 | |||
| 1075 | Ga0157376_10014310 | |||
| 1076 | Ga0157376_10014352 | |||
| 1077 | Ga0157376_10103497 | |||
| 1078 | Ga0163161_10091511 | |||
| 1079 | Ga0163161_10132652 | |||
| 1080 | Ga0163161_10148331 | |||
| 1081 | Ga0207672_1000029 | |||
| 1082 | Ga0209784_100182 | |||
| 1083 | Ga0209026_1000201 | |||
| 1084 | Ga0209233_1000485 | |||
| 1085 | Ga0209130_1001355 | |||
| 1086 | Ga0209130_1012524 | |||
| 1087 | Ga0209676_1001031 | |||
| 1088 | Ga0209676_1001852 | |||
| 1089 | Ga0209025_1000136 | |||
| 1090 | Ga0209025_1000156 | |||
| 1091 | Ga0209025_1001301 | |||
| 1092 | Ga0209025_1002853 | |||
| 1093 | Ga0209025_1010042 | |||
| 1094 | Ga0209025_1011240 | |||
| 1095 | Ga0209025_1014487 | |||
| 1096 | Ga0209025_1015969 | |||
| 1097 | Ga0209025_1021704 | |||
| 1098 | Ga0207697_10013777 | |||
| 1099 | Ga0207696_1002910 | |||
| 1100 | Ga0207655_1014413 | |||
| 1101 | Ga0207653_10000250 | |||
| 1102 | Ga0207653_10011818 | |||
| 1103 | Ga0207642_10111639 | |||
| 1104 | Ga0207642_10123889 | |||
| 1105 | Ga0207710_10000003 | |||
| 1106 | Ga0207710_10004862 | |||
| 1107 | Ga0207688_10198129 | |||
| 1108 | Ga0207647_10003398 | |||
| 1109 | Ga0207699_10000038 | |||
| 1110 | Ga0207643_10005387 | |||
| 1111 | Ga0207643_10017758 | |||
| 1112 | Ga0207643_10059521 | |||
| 1113 | Ga0207684_10000049 | |||
| 1114 | Ga0207684_10000912 | |||
| 1115 | Ga0207684_10054792 | |||
| 1116 | Ga0207684_10064884 | |||
| 1117 | Ga0207684_10142293 | |||
| 1118 | Ga0207654_10012227 | |||
| 1119 | Ga0207654_10034815 | |||
| 1120 | Ga0207654_10207091 | |||
| 1121 | Ga0207654_10283004 | |||
| 1122 | Ga0207707_10000003 | |||
| 1123 | Ga0207707_10081959 | |||
| 1124 | Ga0207695_10000019 | |||
| 1125 | Ga0207695_10000064 | |||
| 1126 | Ga0207695_10093576 | |||
| 1127 | Ga0207671_10001012 | |||
| 1128 | Ga0207671_10007390 | |||
| 1129 | Ga0207671_10018508 | |||
| 1130 | Ga0207671_10027822 | |||
| 1131 | Ga0207693_10110220 | |||
| 1132 | Ga0207663_10000011 | |||
| 1133 | Ga0207660_10032975 | |||
| 1134 | Ga0207662_10000662 | |||
| 1135 | Ga0207649_10020492 | |||
| 1136 | Ga0207652_10000140 | |||
| 1137 | Ga0207652_10028969 | |||
| 1138 | Ga0207646_10001431 | |||
| 1139 | Ga0207646_10010047 | |||
| 1140 | Ga0207646_10086798 | |||
| 1141 | Ga0207681_10067382 | |||
| 1142 | Ga0207694_10123935 | |||
| 1143 | Ga0207694_10194488 | |||
| 1144 | Ga0207650_10000009 | |||
| 1145 | Ga0207650_10043682 | |||
| 1146 | Ga0207650_10059444 | |||
| 1147 | Ga0207650_10178428 | |||
| 1148 | Ga0207650_10273859 | |||
| 1149 | Ga0207644_10000820 | |||
| 1150 | Ga0207644_10010338 | |||
| 1151 | Ga0207690_10000560 | |||
| 1152 | Ga0207690_10070469 | |||
| 1153 | Ga0207706_10173190 | |||
| 1154 | Ga0207706_10299074 | |||
| 1155 | Ga0207686_10023094 | |||
| 1156 | Ga0207709_10008191 | |||
| 1157 | Ga0207670_10000875 | |||
| 1158 | Ga0207670_10005535 | |||
| 1159 | Ga0207670_10381608 | |||
| 1160 | Ga0207704_10004320 | |||
| 1161 | Ga0207704_10064660 | |||
| 1162 | Ga0207704_10172415 | |||
| 1163 | Ga0207704_10176028 | |||
| 1164 | Ga0207665_10035710 | |||
| 1165 | Ga0207691_10000532 | |||
| 1166 | Ga0207691_10001247 | |||
| 1167 | Ga0207691_10159411 | |||
| 1168 | Ga0207691_10330918 | |||
| 1169 | Ga0207711_10002332 | |||
| 1170 | Ga0207711_10014371 | |||
| 1171 | Ga0207711_10030154 | |||
| 1172 | Ga0207711_10032301 | |||
| 1173 | Ga0207711_10036996 | |||
| 1174 | Ga0207711_10061781 | |||
| 1175 | Ga0207711_10177902 | |||
| 1176 | Ga0207689_10006711 | |||
| 1177 | Ga0207689_10342716 | |||
| 1178 | Ga0207679_10010959 | |||
| 1179 | Ga0207679_10058334 | |||
| 1180 | Ga0207667_10003309 | |||
| 1181 | Ga0207667_10016224 | |||
| 1182 | Ga0207667_10586607 | |||
| 1183 | Ga0207651_10054631 | |||
| 1184 | Ga0207651_10079827 | |||
| 1185 | Ga0207651_10158841 | |||
| 1186 | Ga0207651_10190507 | |||
| 1187 | Ga0207712_10000075 | |||
| 1188 | Ga0207712_10102826 | |||
| 1189 | Ga0207668_10001378 | |||
| 1190 | Ga0207640_10013216 | |||
| 1191 | Ga0207640_10131006 | |||
| 1192 | Ga0207640_10203798 | |||
| 1193 | Ga0207640_10434594 | |||
| 1194 | Ga0207658_10022239 | |||
| 1195 | Ga0207658_10041279 | |||
| 1196 | Ga0207658_10075003 | |||
| 1197 | Ga0207677_10001456 | |||
| 1198 | Ga0207677_10017475 | |||
| 1199 | Ga0207677_10165308 | |||
| 1200 | Ga0207703_10063977 | |||
| 1201 | Ga0207703_10064001 | |||
| 1202 | Ga0207703_10073796 | |||
| 1203 | Ga0207703_10220764 | |||
| 1204 | Ga0207703_10302013 | |||
| 1205 | Ga0207639_10055685 | |||
| 1206 | Ga0207639_10135284 | |||
| 1207 | Ga0207708_10000306 | |||
| 1208 | Ga0207708_10005322 | |||
| 1209 | Ga0207708_10020819 | |||
| 1210 | Ga0207708_10035752 | |||
| 1211 | Ga0207708_10043777 | |||
| 1212 | Ga0207708_10058478 | |||
| 1213 | Ga0207708_10064096 | |||
| 1214 | Ga0207708_10073197 | |||
| 1215 | Ga0207702_10165331 | |||
| 1216 | Ga0207702_10204826 | |||
| 1217 | Ga0207641_10046264 | |||
| 1218 | Ga0207641_10062771 | |||
| 1219 | Ga0207648_10063225 | |||
| 1220 | Ga0207648_10078693 | |||
| 1221 | Ga0207648_10099212 | |||
| 1222 | Ga0207676_10002006 | |||
| 1223 | Ga0207676_10003420 | |||
| 1224 | Ga0207676_10006376 | |||
| 1225 | Ga0207676_10063832 | |||
| 1226 | Ga0207676_10157362 | |||
| 1227 | Ga0207676_10163118 | |||
| 1228 | Ga0207676_10488279 | |||
| 1229 | Ga0207674_10000024 | |||
| 1230 | Ga0207674_10167372 | |||
| 1231 | Ga0207674_10177594 | |||
| 1232 | Ga0207674_10589564 | |||
| 1233 | Ga0207675_100006134 | |||
| 1234 | Ga0207675_100016641 | |||
| 1235 | Ga0207698_10099794 | |||
| 1236 | Ga0207428_10002708 | |||
| 1237 | Ga0207428_10015560 | |||
| 1238 | Ga0207428_10055116 | |||
| 1239 | Ga0268265_10108291 | |||
| 1240 | Ga0268265_10228261 | |||
| 1241 | Ga0268264_10087620 | |||
| 1242 | Ga0268264_10310703 | |||
| 1243 | Ga0268264_10406812 | |||
| 1244 | Ga0265319_1002362 | |||
| 1245 | Ga0265318_10000036 | |||
| 1246 | Ga0307517_10020061 | |||
| 1247 | Ga0307515_10107653 | |||
| 1248 | Ga0237817_10047 | |||
| 1249 | Ga0237817_10073 | |||
| 1250 | Ga0265330_10000407 | |||
| 1251 | Ga0265332_10000240 | |||
| 1252 | Ga0265320_10001850 | |||
| 1253 | Ga0265329_10000794 | |||
| 1254 | Ga0265340_10001802 | |||
| 1255 | Ga0265331_10021528 | |||
| 1256 | Ga0265327_10000038 | |||
| 1257 | Ga0265327_10000234 | |||
| 1258 | Ga0265316_10027785 | |||
| 1259 | Ga0307408_100452078 | |||
| 1260 | Ga0265313_10000046 | |||
| 1261 | Ga0265313_10001489 | |||
| 1262 | Ga0307508_10126913 | |||
| 1263 | Ga0265314_10051165 | |||
| 1264 | Ga0265342_10000174 | |||
| 1265 | Ga0265342_10042225 | |||
| 1266 | Ga0307405_10171810 | |||
| 1267 | Ga0307405_10339041 | |||
| 1268 | Ga0307413_10115999 | |||
| 1269 | Ga0307406_10195438 | |||
| 1270 | Ga0307412_10037502 | |||
| 1271 | Ga0307412_10182230 | |||
| 1272 | Ga0307414_10001140 | |||
| 1273 | Ga0307414_10511769 | |||
| 1274 | Ga0307415_100038633 | |||
| 1275 | Ga0307510_10060386 | |||
| 1276 | Ga0373951_0000254 | |||
| 1277 | Ga0373951_0024006 | |||
| 1278 | Ga0373932_0053892 | |||
| 1279 | Ga0373941_0003155 | |||
| 1280 | Ga0395899_0001025 | |||
| 1281 | Ga0395900_0131399 | |||
| 1282 | Ga0395900_0590639 | |||
| 1283 | Ga0395898_0284061 | |||
| 1284 | Ga0237819_00181 | |||
| 1285 | Ga0237819_00325 | |||
| 1286 | Ga0400489_74505 | |||
| 1287 | Ga0436365_0591950 | |||
| 1288 | Ga0451577_0346541 | |||
| 1289 | Ga0466969_0065576 | |||
| 1290 | Ga0453683_0012148 | |||
| 1291 | Ga0466966_0002402 | |||
| 1292 | Ga0466970_0021342 | |||
| 1293 | Ga0466959_0046529 | |||
| 1294 | Ga0451576_0073094 | |||
| 1295 | Ga0451576_0124662 | |||
| 1296 | Ga0466958_0004917 | |||
| 1297 | Ga0466967_0000820 | |||
| 1298 | Ga0495650_0000081 | |||
| 1299 | Ga0495580_0232281 | |||
| 1300 | Ga0495585_0000036 | |||
| 1301 | Ga0495596_0021225 | |||
| 1302 | Ga0495606_0000034 | |||
| 1303 | Ga0495606_0007210 | |||
| 1304 | Ga0495606_0021571 | |||
| 1305 | Ga0495610_0003276 | |||
| 1306 | Ga0495616_0008353 | |||
| 1307 | Ga0495620_0061159 | |||
| 1308 | Ga0495631_0015081 | |||
| 1309 | Ga0495632_0035043 | |||
| 1310 | Ga0495637_0033076 | |||
| 1311 | Ga0495598_0002140 | |||
| 1312 | Ga0495621_0000749 | |||
| 1313 | Ga0495625_0000049 | |||
| 1314 | Ga0495625_0020849 | |||
| 1315 | Ga0495661_0003026 | |||
| 1316 | Ga0495661_0079747 | |||
| 1317 | Ga0495647_0097594 | |||
| 1318 | Ga0495649_0000014 | |||
| 1319 | Ga0495649_0127154 | |||
| 1320 | Ga0495660_0014741 | |||
| 1321 | Ga0495636_0023277 | |||
| 1322 | Ga0495687_000249 | |||
| 1323 | Ga0495686_0004135 | |||
| 1324 | Ga0496101_0060411 | |||
| 1325 | Ga0496102_0031481 | |||
| 1326 | Ga0496104_0199606 | |||
| 1327 | Ga0496106_0135447 | |||
| 1328 | Ga0496106_0255966 | |||
| 1329 | Ga0496108_0046069 | |||
| 1330 | Ga0496108_0071982 | |||
| 1331 | Ga0496109_0000097 | |||
| 1332 | Ga0496112_0082158 | |||
| 1333 | Ga0496112_0108511 | |||
| 1334 | Ga0496112_0135114 | |||
| 1335 | Ga0496112_0441625 | |||
| 1336 | Ga0496113_0409726 | |||
| 1337 | Ga0501308_010861 | |||
| 1338 | Ga0495678_006696 | |||
| 1339 | Ga0501298_005299 | |||
| 1340 | Ga0501299_005418 | |||
| 1341 | Ga0501031_0137827 | |||
| 1342 | Ga0501034_0377583 | |||
| 1343 | Ga0501038_0038497 | |||
| 1344 | Ga0501046_0202580 | |||
| 1345 | Ga0501048_0083945 | |||
| 1346 | Ga0501067_0008718 | |||
| 1347 | Ga0501069_0020991 | |||
| 1348 | Ga0501072_0064829 | |||
| 1349 | Ga0501075_0012195 | |||
| 1350 | Ga0501076_0196961 | |||
| 1351 | Ga0501206_001020 | |||
| 1352 | Ga0501207_000108 | |||
| 1353 | Ga0501207_006923 | |||
| 1354 | Ga0501217_000307 | |||
| 1355 | Ga0501217_011657 | |||
| 1356 | Ga0501223_001008 | |||
| 1357 | Ga0501224_001484 | |||
| 1358 | Ga0501233_001558 | |||
| 1359 | Ga0501233_001714 | |||
| 1360 | Ga0501240_000955 | |||
| 1361 | Ga0501240_005790 | |||
| 1362 | Ga0501242_004100 | |||
| 1363 | Ga0501243_001346 | |||
| 1364 | Ga0501243_005916 | |||
| 1365 | Ga0501256_001338 | |||
| 1366 | Ga0501257_001905 | |||
| 1367 | Ga0501259_000262 | |||
| 1368 | Ga0501221_000246 | |||
| 1369 | Ga0501221_011851 | |||
| 1370 | Ga0501221_013765 | |||
| 1371 | Ga0501225_0001425 | |||
| 1372 | Ga0501234_001984 | |||
| 1373 | Ga0501079_0023586 | |||
| 1374 | Ga0501080_0109114 | |||
| 1375 | Ga0501283_003061 | |||
| 1376 | Ga0501045_0021143 | |||
| 1377 | Ga0501212_000907 | |||
| 1378 | nmdc:mga0k408_1201_c1 | |||
| 1379 | nmdc:mga0k408_1481_c1 | |||
| 1380 | nmdc:mga0k408_609_c1 | |||
| 1381 | nmdc:mga05p37_202765_c1 | |||
| 1382 | nmdc:mga05p37_22121_c1 | |||
| 1383 | nmdc:mga05p37_30492_c1 | |||
| 1384 | nmdc:mga05p37_49159_c1 | |||
| 1385 | nmdc:mga05p37_699_c1 | |||
| 1386 | nmdc:mga05p37_8917_c1 | |||
| 1387 | nmdc:mga09592_196566_c1 | |||
| 1388 | nmdc:mga09592_4409_c1 | |||
| 1389 | nmdc:mga0qj67_31079_c1 | |||
| 1390 | nmdc:mga0qj67_7926_c1 | |||
| 1391 | nmdc:mga06r32_111123_c1 | |||
| 1392 | nmdc:mga06r32_157545_c1 | |||
| 1393 | nmdc:mga06r32_162_c1 | |||
| 1394 | nmdc:mga08y16_255458_c1 | |||
| 1395 | nmdc:mga08y16_39125_c1 | |||
| 1396 | nmdc:mga08y16_42768_c1 | |||
| 1397 | nmdc:mga08y16_78613_c1 | |||
| 1398 | nmdc:mga0n895_161819_c1 | |||
| 1399 | nmdc:mga0n895_183479_c1 | |||
| 1400 | nmdc:mga0n895_4428_c1 | |||
| 1401 | nmdc:mga0n895_68243_c1 | |||
| 1402 | nmdc:mga0rr50_108835_c1 | |||
| 1403 | nmdc:mga0rr50_158766_c1 | |||
| 1404 | nmdc:mga0rr50_362323_c1 | |||
| 1405 | nmdc:mga08x19_1903_c1 | |||
| 1406 | nmdc:mga08x19_2_c1 | |||
| 1407 | nmdc:mga08x19_37044_c1 | |||
| 1408 | nmdc:mga0a205_121134_c1 | |||
| 1409 | nmdc:mga0a205_133791_c1 | |||
| 1410 | nmdc:mga0a205_162390_c1 | |||
| 1411 | nmdc:mga0a205_170898_c1 | |||
| 1412 | nmdc:mga0a205_19597_c1 | |||
| 1413 | nmdc:mga0a205_227272_c1 | |||
| 1414 | nmdc:mga0a205_331679_c1 | |||
| 1415 | nmdc:mga0a205_368438_c1 | |||
| 1416 | nmdc:mga0a205_46214_c1 | |||
| 1417 | nmdc:mga0a205_68530_c1 | |||
| 1418 | Ga0495601_0157526 | |||
| 1419 | Ga0500555_003266 | |||
| 1420 | Ga0500608_001731 | |||
| 1421 | Ga0500559_0047211 | |||
| 1422 | Ga0500622_0003605 | |||
| 1423 | Ga0500622_0124835 | |||
| 1424 | Ga0500624_000472 | |||
| 1425 | Ga0501084_0011717 | |||
| 1426 | Ga0501084_0393320 | |||
| 1427 | Ga0501082_0279701 | |||
| 1428 | Ga0530510_0161773 | |||
| 1429 | 2553392815 | |||
| 1430 | 2595088194 | |||
| 1431 | 2599481925 | |||
| 1432 | 2644704573 | |||
| 1433 | 2644709267 | |||
| 1434 | 2685149997 | |||
| 1435 | 2698323202 | |||
| 1436 | 2705994038 | |||
| 1437 | 2721505362 | |||
| 1438 | 2738817158 | |||
| 1439 | 2739159281 | |||
| 1440 | 2739211941 | |||
| 1441 | 2739267884 | |||
| 1442 | 2740031142 | |||
| 1443 | 2745167198 | |||
| 1444 | 2777839786 | |||
| 1445 | 2817616760 | |||
| 1446 | 2819571535 | |||
| 1447 | 2819578853 | |||
| 1448 | 2857587228 | |||
| 1449 | 2881958022 | |||
| 1450 | 2919190727 | |||
| 1451 | 2919419038 | |||
| 1452 | 2919440579 | |||
| 1453 | 2928084084 | |||
| 1454 | 2928152851 | |||
| 1455 | 2929235263 | |||
| 1456 | 2932087433 | |||
| 1457 | 2936363868 | |||
| 1458 | 2938919445 | |||
| 1459 | 2939597748 | |||
| 1460 | 2939669063 | |||
| 1461 | 2947428805 | |||
| 1462 | 2965763308 | |||
| 1463 | 2977259658 | |||
| 1464 | 2979085760 | |||
| 1465 | 2990275517 | |||
| 1466 | 3001894146 | |||
| 1467 | 3006978528 | |||
| 1468 | 3006979975 | |||
| 1469 | 8022625736 | |||
| 1470 | 8023444192 | |||
| 1471 | 8023449644 | |||
| 1472 | 8054282759 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2r44-assembly1.cif.gz_A | crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution | 0.903 | 14 | 327 |
| 2r44-assembly1.cif.gz_A | crystal structure of a putative atpase (chu_0153) from cytophaga hutchinsonii atcc 33406 at 2.00 a resolution | 0.8664 | 14 | 327 |
| 4upb-assembly1.cif.gz_C | electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci | 0.8119 | 13 | 318 |
| 4upb-assembly1.cif.gz_E | electron cryo-microscopy of the complex formed between the hexameric atpase rava and the decameric inducible decarboxylase ldci | 0.8101 | 13 | 323 |
| 3nbx-assembly1.cif.gz_X | crystal structure of e. coli rava (regulatory atpase variant a) in complex with adp | 0.8024 | 13 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q79FN7_37_232_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9514 | 18 | 211 | 3.40.50.300 |
| af_O53314_205_312_1.10.8.80 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain | 0.9321 | 223 | 321 | 1.10.8.80 |
| af_Q79FN7_37_232_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9281 | 18 | 211 | 3.40.50.300 |
| af_I6YGX9_248_354_1.10.8.80 | Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Magnesium chelatase subunit I, C-Terminal domain | 0.9194 | 223 | 323 | 1.10.8.80 |
| 2r44A02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8906 | 42 | 196 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X5N5M0-F1-model_v4 | AAA family ATPase | 0.9836 | 79 | 151 |
GO:0005524
GO:0016887 |
| AF-A0A661W0D5-F1-model_v4 | AAA family ATPase | 0.9833 | 17 | 278 |
GO:0005524
GO:0016887 |
| AF-A0A349KL67-F1-model_v4 | AAA family ATPase | 0.9812 | 21 | 158 |
GO:0005524
GO:0016887 |
| AF-A0A800CGM2-F1-model_v4 | MoxR family ATPase | 0.9799 | 15 | 301 |
GO:0005524
GO:0016887 |
| AF-A0A3D4CJH3-F1-model_v4 | Magnesium chelatase | 0.9797 | 81 | 163 |
GO:0005524
GO:0016887 |