F478263

General Info

Members Datasets Scaffolds Average Seq Length
736 385 735 121

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10541086|Ga0157371_105410861
Length 148
Sequence MATILTVDDSPSIRQMIKVVLGPAGHNVLEASDGAQGLEAAKSAKPDLVITDLNMPVMNGMELIKALRKQPSLVGLPIVFLTTESNDATKQEAKAAGATGWITKPFKPEQLLAVVSKLVRTCRHWIRLMSSDRKQASSSKFSKGPCWI

Samples

Sample ID Description Type Environment
1 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
68 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
102 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
161 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
162 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
163 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
164 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
165 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
172 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
198 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
203 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
204 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
231 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
232 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
233 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
256 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
261 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
262 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
263 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
264 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
265 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
266 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
267 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
268 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
269 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
270 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
271 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
283 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
284 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
285 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
286 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
294 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
297 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
298 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
299 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
300 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
301 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
302 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
303 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
329 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
330 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
335 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
338 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
339 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
340 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
341 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
342 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
343 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
344 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
345 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
346 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
347 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
348 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
349 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
350 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
351 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
352 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
353 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
354 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
355 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
356 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
357 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
358 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
359 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
360 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
361 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
362 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
363 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
364 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
365 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
366 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
367 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
368 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
369 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
370 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
371 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
372 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
373 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
374 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
375 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
376 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
377 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
378 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
379 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
380 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
381 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
382 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
383 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
384 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
385 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.52
Nodule 1.22
Rhizoplane 3.94
Rhizosphere 65.35
Stem 0
Stem Tuber 0
Unclassified 8.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1063606 3300001904 Bacteria 572
2 JGI24739J22299_10100083 3300001989 Bacteria 875
3 JGI24737J22298_10135173 3300001990 Bacteria 728
4 JGI24735J21928_10147995 3300002067 Bacteria 678
5 JGI25153J46596_10000633 3300003215 Bacteria 21490
6 JGI25153J46596_10000651 3300003215 Bacteria 21219
7 JGI25153J46596_10006525 3300003215 Bacteria 5888
8 JGI25153J46596_10011915 3300003215 Bacteria 3805
9 JGI25153J46596_10037547 3300003215 Bacteria 1538
10 JGI25153J46596_10089491 3300003215 Bacteria 747
11 rootH1_10201646 3300003323 Bacteria 1334
12 JGI25160J50197_1056197 3300003354 Bacteria 807
13 Ga0055526_1036046 3300003771 Bacteria 1320
14 Ga0055524_1007998 3300003775 Bacteria 4435
15 Ga0055524_1059930 3300003775 Bacteria 796
16 Ga0055531_10005412 3300003794 Bacteria 7481
17 Ga0065165_1000054 3300005262 Bacteria 187351
18 Ga0065165_1001857 3300005262 Bacteria 20523
19 Ga0065165_1002497 3300005262 Bacteria 15404
20 Ga0065165_1061509 3300005262 Bacteria 1027
21 Ga0070683_100038089 3300005329 Bacteria 4405
22 Ga0070683_100057527 3300005329 Bacteria 3612
23 Ga0070683_100765555 3300005329 Bacteria 925
24 Ga0070670_101423776 3300005331 Bacteria 636
25 Ga0070680_100094782 3300005336 Bacteria 2474
26 Ga0070682_101804299 3300005337 Bacteria 534
27 Ga0068868_100357737 3300005338 Bacteria 1252
28 Ga0070660_100294597 3300005339 Bacteria 1329
29 Ga0070660_101761265 3300005339 Bacteria 528
30 Ga0070691_10030518 3300005341 Bacteria 2525
31 Ga0070671_100289106 3300005355 Bacteria 1395
32 Ga0070667_100930754 3300005367 Bacteria 810
33 Ga0070709_10001267 3300005434 Bacteria 13836
34 Ga0070709_11017313 3300005434 Bacteria 660
35 Ga0070714_100135360 3300005435 Bacteria 2206
36 Ga0070714_100213431 3300005435 Bacteria 1770
37 Ga0070713_100006642 3300005436 Bacteria 8044
38 Ga0070710_10001610 3300005437 Bacteria 10663
39 Ga0070711_100002880 3300005439 Bacteria 9907
40 Ga0070663_100063537 3300005455 Bacteria 2666
41 Ga0070663_100666177 3300005455 Bacteria 881
42 Ga0070681_10229924 3300005458 Bacteria 1769
43 Ga0070681_11349987 3300005458 Bacteria 636
44 Ga0070679_100195528 3300005530 Bacteria 1990
45 Ga0070679_100214870 3300005530 Bacteria 1886
46 Ga0070679_101845899 3300005530 Bacteria 553
47 Ga0070684_100032985 3300005535 Bacteria 4418
48 Ga0070684_100610185 3300005535 Bacteria 1015
49 Ga0068853_100295866 3300005539 Bacteria 1495
50 Ga0068853_100469902 3300005539 Bacteria 1185
51 Ga0068853_100516200 3300005539 Bacteria 1129
52 Ga0068853_100794613 3300005539 Bacteria 906
53 Ga0068853_101628346 3300005539 Bacteria 626
54 Ga0068855_100080309 3300005563 Bacteria 3782
55 Ga0068855_101935132 3300005563 Bacteria 597
56 Ga0070664_100705062 3300005564 Bacteria 940
57 Ga0068857_100265926 3300005577 Bacteria 1575
58 Ga0068857_100444308 3300005577 Bacteria 1212
59 Ga0068857_100732826 3300005577 Bacteria 941
60 Ga0068854_100328560 3300005578 Bacteria 1245
61 Ga0068856_100375959 3300005614 Bacteria 1440
62 Ga0068856_101597303 3300005614 Bacteria 665
63 Ga0068852_100001747 3300005616 Bacteria 14801
64 Ga0068859_100108929 3300005617 Bacteria 2831
65 Ga0068864_100000060 3300005618 Bacteria 124506
66 Ga0068864_100208399 3300005618 Bacteria 1799
67 Ga0068864_100398976 3300005618 Bacteria 1307
68 Ga0068851_10183858 3300005834 Bacteria 1159
69 Ga0068870_10512580 3300005840 Bacteria 801
70 Ga0068863_100000023 3300005841 Bacteria 186490
71 Ga0068863_100182757 3300005841 Bacteria 2013
72 Ga0068863_100216415 3300005841 Bacteria 1845
73 Ga0068858_100011301 3300005842 Bacteria 8435
74 Ga0068860_100608105 3300005843 Bacteria 1099
75 Ga0068860_100626215 3300005843 Bacteria 1083
76 Ga0068860_101235463 3300005843 Bacteria 768
77 Ga0068862_100966501 3300005844 Bacteria 841
78 Ga0081455_10106377 3300005937 Bacteria 2239
79 Ga0081540_1048867 3300005983 Bacteria 2115
80 Ga0070717_10128448 3300006028 Bacteria 2178
81 Ga0070717_10238080 3300006028 Bacteria 1604
82 Ga0075365_10012541 3300006038 Bacteria 5038
83 Ga0075365_10039785 3300006038 Bacteria 3063
84 Ga0075365_10100286 3300006038 Bacteria 1982
85 Ga0075368_10283293 3300006042 Bacteria 712
86 Ga0075363_100019810 3300006048 Bacteria 3368
87 Ga0075363_100373654 3300006048 Bacteria 835
88 Ga0075363_101003995 3300006048 Bacteria 514
89 Ga0075364_10523514 3300006051 Bacteria 811
90 Ga0070715_10569651 3300006163 Bacteria 659
91 Ga0070716_100001907 3300006173 Bacteria 9470
92 Ga0070712_100022694 3300006175 Bacteria 4137
93 Ga0075362_10060294 3300006177 Bacteria 1715
94 Ga0075362_10183579 3300006177 Bacteria 1014
95 Ga0075362_10598125 3300006177 Bacteria 570
96 Ga0075367_10096852 3300006178 Bacteria 1799
97 Ga0075367_10099824 3300006178 Bacteria 1773
98 Ga0075367_10127753 3300006178 Bacteria 1570
99 Ga0075367_10972276 3300006178 Bacteria 542
100 Ga0075369_10100669 3300006186 Bacteria 1296
101 Ga0075369_10120731 3300006186 Bacteria 1186
102 Ga0075366_10008786 3300006195 Bacteria 5626
103 Ga0097621_101899187 3300006237 Bacteria 568
104 Ga0075370_10047941 3300006353 Bacteria 2420
105 Ga0075370_10133086 3300006353 Bacteria 1451
106 Ga0068871_100635702 3300006358 Bacteria 973
107 Ga0075433_11578652 3300006852 Unclassified 566
108 Ga0075434_100248208 3300006871 Bacteria 1799
109 Ga0075436_100889635 3300006914 Bacteria 666
110 Ga0097620_100108929 3300006931 Bacteria 2831
111 Ga0099824_1024667 3300006942 Bacteria 3458
112 Ga0099823_1070945 3300006944 Bacteria 1547
113 Ga0105251_10063426 3300009011 Bacteria 1734
114 Ga0105251_10210083 3300009011 Bacteria 876
115 Ga0105244_10397525 3300009036 Bacteria 634
116 Ga0105250_10012457 3300009092 Bacteria 3510
117 Ga0105240_10008853 3300009093 Bacteria 14333
118 Ga0105240_10020641 3300009093 Bacteria 8781
119 Ga0105240_10164739 3300009093 Bacteria 2630
120 Ga0105240_10465050 3300009093 Bacteria 1412
121 Ga0105240_11113435 3300009093 Bacteria 840
122 Ga0105245_10336467 3300009098 Bacteria 1491
123 Ga0105245_10877220 3300009098 Bacteria 938
124 Ga0105247_10122059 3300009101 Bacteria 1689
125 Ga0105247_10396142 3300009101 Bacteria 982
126 Ga0105247_10803452 3300009101 Bacteria 718
127 Ga0105247_10937133 3300009101 Bacteria 671
128 Ga0105243_10139868 3300009148 Bacteria 2064
129 Ga0105243_10917821 3300009148 Bacteria 872
130 Ga0105241_11457722 3300009174 Bacteria 657
131 Ga0105242_10949479 3300009176 Bacteria 864
132 Ga0105248_10001464 3300009177 Bacteria 26304
133 Ga0105248_10800750 3300009177 Bacteria 1064
134 Ga0105248_10860246 3300009177 Bacteria 1024
135 Ga0105248_12313384 3300009177 Bacteria 612
136 Ga0105237_10014235 3300009545 Bacteria 8329
137 Ga0105237_10042891 3300009545 Bacteria 4559
138 Ga0105237_10139035 3300009545 Bacteria 2423
139 Ga0105237_10265701 3300009545 Bacteria 1719
140 Ga0105237_10644094 3300009545 Bacteria 1066
141 Ga0105237_11725061 3300009545 Bacteria 634
142 Ga0105238_10063440 3300009551 Bacteria 3695
143 Ga0105238_10374439 3300009551 Bacteria 1415
144 Ga0105238_10712014 3300009551 Bacteria 1016
145 Ga0105238_10791518 3300009551 Bacteria 963
146 Ga0105238_11255130 3300009551 Bacteria 766
147 Ga0105249_10339575 3300009553 Bacteria 1518
148 Ga0105239_10039622 3300010375 Bacteria 5161
149 Ga0105239_10079622 3300010375 Bacteria 3605
150 Ga0105239_10079805 3300010375 Bacteria 3601
151 Ga0105239_13536518 3300010375 Bacteria 508
152 Ga0105246_10015578 3300011119 Bacteria 4804
153 Ga0157373_10307542 3300013100 Bacteria 1126
154 Ga0157371_10541086 3300013102 Bacteria 863
155 Ga0157371_11115882 3300013102 Bacteria 605
156 Ga0157370_10050197 3300013104 Bacteria 3988
157 Ga0157370_11160226 3300013104 Bacteria 697
158 Ga0157369_10007758 3300013105 Bacteria 12344
159 Ga0157369_10009352 3300013105 Bacteria 11208
160 Ga0157369_10484841 3300013105 Bacteria 1279
161 Ga0157369_10729188 3300013105 Bacteria 1020
162 Ga0157374_10457643 3300013296 Bacteria 1278
163 Ga0157374_10885120 3300013296 Bacteria 910
164 Ga0157378_10433232 3300013297 Bacteria 1302
165 Ga0163162_10165287 3300013306 Bacteria 2336
166 Ga0157372_10213404 3300013307 Bacteria 2237
167 Ga0157372_10476886 3300013307 Bacteria 1454
168 Ga0157375_10136536 3300013308 Bacteria 2577
169 Ga0163163_10071930 3300014325 Bacteria 3447
170 Ga0163163_10536565 3300014325 Bacteria 1232
171 Ga0163163_10975280 3300014325 Bacteria 911
172 Ga0182008_10855741 3300014497 Bacteria 532
173 Ga0157379_10058879 3300014968 Bacteria 3435
174 Ga0157379_10603277 3300014968 Bacteria 1025
175 Ga0157379_11221694 3300014968 Bacteria 723
176 Ga0157379_12117066 3300014968 Bacteria 558
177 Ga0157376_10096295 3300014969 Bacteria 2575
178 Ga0213873_10010521 3300021358 Bacteria 1953
179 Ga0213872_10004165 3300021361 Bacteria 7775
180 Ga0213872_10031833 3300021361 Bacteria 2417
181 Ga0213872_10370683 3300021361 Bacteria 584
182 Ga0213876_10065160 3300021384 Bacteria 1923
183 Ga0213876_10103445 3300021384 Bacteria 1510
184 Ga0213875_10119834 3300021388 Bacteria 1229
185 Ga0213875_10122984 3300021388 Bacteria 1213
186 Ga0213871_10007632 3300021441 Bacteria 2350
187 Ga0207425_1010576 3300025245 Bacteria 2239
188 Ga0209148_1000421 3300025254 Bacteria 47524
189 Ga0209148_1016562 3300025254 Bacteria 1266
190 Ga0209148_1043097 3300025254 Bacteria 615
191 Ga0209233_1002484 3300025261 Bacteria 6755
192 Ga0209233_1002615 3300025261 Bacteria 6539
193 Ga0209233_1017000 3300025261 Bacteria 1990
194 Ga0209455_1007536 3300025272 Bacteria 3062
195 Ga0209130_1081120 3300025284 Bacteria 522
196 Ga0209564_1000044 3300025295 Bacteria 381017
197 Ga0209564_1004705 3300025295 Bacteria 8182
198 Ga0209564_1014807 3300025295 Bacteria 3216
199 Ga0209758_1000117 3300025297 Bacteria 198325
200 Ga0209758_1000506 3300025297 Bacteria 63135
201 Ga0209758_1001068 3300025297 Bacteria 35664
202 Ga0209758_1001793 3300025297 Bacteria 23709
203 Ga0209758_1003491 3300025297 Bacteria 14222
204 Ga0209758_1007058 3300025297 Bacteria 7792
205 Ga0209050_1070340 3300025298 Bacteria 784
206 Ga0209256_1000740 3300025299 Bacteria 42806
207 Ga0209256_1007255 3300025299 Bacteria 5533
208 Ga0209256_1008199 3300025299 Bacteria 4906
209 Ga0207426_1000467 3300025302 Bacteria 62488
210 Ga0207426_1000508 3300025302 Bacteria 57035
211 Ga0207426_1006582 3300025302 Bacteria 5014
212 Ga0207426_1023419 3300025302 Bacteria 2107
213 Ga0207426_1075361 3300025302 Bacteria 929
214 Ga0207426_1103153 3300025302 Bacteria 732
215 Ga0209051_1030114 3300025303 Bacteria 2111
216 Ga0209257_1000158 3300025304 Bacteria 180079
217 Ga0209257_1023507 3300025304 Bacteria 2164
218 Ga0207692_10001796 3300025898 Bacteria 8136
219 Ga0207710_10023967 3300025900 Bacteria 2626
220 Ga0207710_10318232 3300025900 Bacteria 788
221 Ga0207688_10138968 3300025901 Bacteria 1429
222 Ga0207680_10052867 3300025903 Bacteria 2436
223 Ga0207647_10006024 3300025904 Bacteria 8837
224 Ga0207647_10146688 3300025904 Bacteria 1380
225 Ga0207685_10315612 3300025905 Bacteria 778
226 Ga0207699_10000749 3300025906 Bacteria 15507
227 Ga0207707_10660765 3300025912 Bacteria 880
228 Ga0207695_10000136 3300025913 Bacteria 217596
229 Ga0207695_10019551 3300025913 Bacteria 7793
230 Ga0207695_10113023 3300025913 Bacteria 2692
231 Ga0207695_10201059 3300025913 Bacteria 1907
232 Ga0207695_11137786 3300025913 Bacteria 661
233 Ga0207671_10000202 3300025914 Bacteria 90868
234 Ga0207671_10136125 3300025914 Bacteria 1889
235 Ga0207671_10171842 3300025914 Bacteria 1683
236 Ga0207671_10285439 3300025914 Bacteria 1302
237 Ga0207671_10556070 3300025914 Bacteria 915
238 Ga0207693_10176854 3300025915 Bacteria 1679
239 Ga0207693_10227360 3300025915 Bacteria 1465
240 Ga0207663_10001805 3300025916 Bacteria 10114
241 Ga0207660_10435695 3300025917 Bacteria 1059
242 Ga0207657_10304669 3300025919 Bacteria 1262
243 Ga0207657_10332726 3300025919 Bacteria 1199
244 Ga0207657_10392953 3300025919 Bacteria 1091
245 Ga0207649_10874190 3300025920 Bacteria 704
246 Ga0207652_10150356 3300025921 Bacteria 2085
247 Ga0207652_10313972 3300025921 Bacteria 1415
248 Ga0207681_10762870 3300025923 Bacteria 807
249 Ga0207694_10079372 3300025924 Bacteria 2574
250 Ga0207694_10092566 3300025924 Bacteria 2387
251 Ga0207694_10934411 3300025924 Bacteria 734
252 Ga0207694_11431450 3300025924 Bacteria 584
253 Ga0207650_10212832 3300025925 Bacteria 1553
254 Ga0207650_11610041 3300025925 Bacteria 551
255 Ga0207687_10652712 3300025927 Bacteria 890
256 Ga0207700_10004852 3300025928 Bacteria 7985
257 Ga0207700_10169014 3300025928 Bacteria 1822
258 Ga0207700_11201268 3300025928 Bacteria 677
259 Ga0207664_10053425 3300025929 Bacteria 3198
260 Ga0207664_10151837 3300025929 Bacteria 1968
261 Ga0207690_10106076 3300025932 Bacteria 2016
262 Ga0207706_10100034 3300025933 Bacteria 2551
263 Ga0207686_10905971 3300025934 Bacteria 712
264 Ga0207709_10130291 3300025935 Bacteria 1713
265 Ga0207709_10611520 3300025935 Bacteria 864
266 Ga0207665_10002001 3300025939 Bacteria 13745
267 Ga0207711_10001333 3300025941 Bacteria 23353
268 Ga0207711_10567296 3300025941 Bacteria 1059
269 Ga0207689_10634348 3300025942 Bacteria 900
270 Ga0207661_10013432 3300025944 Bacteria 5981
271 Ga0207661_10062354 3300025944 Bacteria 3016
272 Ga0207661_11599670 3300025944 Bacteria 596
273 Ga0207667_10441570 3300025949 Bacteria 1323
274 Ga0207667_10707351 3300025949 Bacteria 1009
275 Ga0207651_10220893 3300025960 Bacteria 1532
276 Ga0207712_10907609 3300025961 Bacteria 779
277 Ga0207668_11197751 3300025972 Bacteria 682
278 Ga0207640_10514171 3300025981 Bacteria 1000
279 Ga0207703_10000571 3300026035 Bacteria 37816
280 Ga0207639_10186688 3300026041 Bacteria 1768
281 Ga0207639_10277379 3300026041 Bacteria 1473
282 Ga0207639_10729666 3300026041 Bacteria 920
283 Ga0207639_11020290 3300026041 Bacteria 775
284 Ga0207678_10055007 3300026067 Bacteria 3428
285 Ga0207678_10066190 3300026067 Bacteria 3103
286 Ga0207678_10202709 3300026067 Bacteria 1697
287 Ga0207678_10883620 3300026067 Bacteria 790
288 Ga0207678_11713587 3300026067 Bacteria 552
289 Ga0207708_11822248 3300026075 Bacteria 534
290 Ga0207702_10283974 3300026078 Bacteria 1566
291 Ga0207641_10000067 3300026088 Bacteria 155379
292 Ga0207641_10180966 3300026088 Bacteria 1931
293 Ga0207641_10221377 3300026088 Bacteria 1755
294 Ga0207648_10105282 3300026089 Bacteria 2475
295 Ga0207676_10001977 3300026095 Bacteria 14926
296 Ga0207676_10743709 3300026095 Bacteria 953
297 Ga0207676_11361098 3300026095 Bacteria 705
298 Ga0207676_11816878 3300026095 Bacteria 608
299 Ga0207676_12502286 3300026095 Bacteria 513
300 Ga0207674_10295232 3300026116 Bacteria 1569
301 Ga0207674_10851309 3300026116 Bacteria 879
302 Ga0207675_100260059 3300026118 Bacteria 1682
303 Ga0207683_10091813 3300026121 Bacteria 2705
304 Ga0209281_1027067 3300027111 Bacteria 1053
305 Ga0209389_1000056 3300027296 Bacteria 107673
306 Ga0209389_1000206 3300027296 Bacteria 42342
307 Ga0209589_1000034 3300027357 Bacteria 138086
308 Ga0209489_100009 3300027361 Bacteria 263873
309 Ga0209489_103071 3300027361 Bacteria 33029
310 Ga0209700_100471 3300027363 Bacteria 75447
311 Ga0209813_10107735 3300027866 Bacteria 956
312 Ga0209813_10144029 3300027866 Bacteria 848
313 Ga0268266_10133830 3300028379 Bacteria 2219
314 Ga0268266_10933498 3300028379 Bacteria 839
315 Ga0268265_10149380 3300028380 Bacteria 1969
316 Ga0268264_10473708 3300028381 Bacteria 1217
317 Ga0268264_10664299 3300028381 Bacteria 1032
318 Ga0307515_10303528 3300028794 Bacteria 1279
319 Ga0265338_10009258 3300028800 Bacteria 11784
320 Ga0265324_10202588 3300029957 Bacteria 674
321 Ga0265330_10034992 3300031235 Bacteria 2242
322 Ga0265330_10039393 3300031235 Bacteria 2099
323 Ga0265330_10062578 3300031235 Bacteria 1618
324 Ga0265328_10015517 3300031239 Bacteria 2982
325 Ga0265325_10025516 3300031241 Bacteria 3208
326 Ga0265325_10043185 3300031241 Bacteria 2353
327 Ga0265325_10266042 3300031241 Bacteria 772
328 Ga0265340_10009354 3300031247 Bacteria 5263
329 Ga0265340_10327074 3300031247 Bacteria 678
330 Ga0265339_10014821 3300031249 Bacteria 4690
331 Ga0265316_10256633 3300031344 Bacteria 1282
332 Ga0265313_10176613 3300031595 Bacteria 899
333 Ga0265313_10291340 3300031595 Bacteria 658
334 Ga0265314_10035527 3300031711 Bacteria 3631
335 Ga0265314_10054932 3300031711 Bacteria 2753
336 Ga0265314_10126958 3300031711 Bacteria 1596
337 Ga0265314_10442368 3300031711 Bacteria 694
338 Ga0265342_10100271 3300031712 Bacteria 1650
339 Ga0265342_10102084 3300031712 Bacteria 1632
340 Ga0265342_10169122 3300031712 Bacteria 1204
341 Ga0307406_10109482 3300031901 Bacteria 1899
342 Ga0307406_10339551 3300031901 Bacteria 1169
343 Ga0307409_100840991 3300031995 Bacteria 928
344 Ga0307510_10063444 3300033180 Bacteria 3763
345 Ga0373928_0003582 3300035084 Bacteria 2962
346 Ga0373932_0016697 3300035112 Bacteria 1876
347 Ga0373943_0848637 3300035170 Bacteria 545
348 Ga0373931_0375875 3300035691 Bacteria 895
349 Ga0373925_0065376 3300037068 Bacteria 2740
350 Ga0395899_0112185 3300037312 Bacteria 1959
351 Ga0395899_0206251 3300037312 Bacteria 1368
352 Ga0395900_0003815 3300037418 Bacteria 16114
353 Ga0395900_0033307 3300037418 Bacteria 5303
354 Ga0395900_0057751 3300037418 Bacteria 3995
355 Ga0395900_0723873 3300037418 Bacteria 927
356 Ga0395900_0904579 3300037418 Bacteria 806
357 Ga0395898_0007171 3300037466 Bacteria 11834
358 Ga0395898_0022885 3300037466 Bacteria 6320
359 Ga0395898_0097903 3300037466 Bacteria 2817
360 Ga0395905_0637162 3300037471 Bacteria 968
361 Ga0395905_0894013 3300037471 Bacteria 791
362 Ga0436364_0487949 3300037853 Bacteria 2019
363 Ga0436364_0646122 3300037853 Bacteria 1983
364 Ga0436364_0899392 3300037853 Bacteria 3249
365 Ga0436364_1201854 3300037853 Bacteria 1207
366 Ga0395901_0017745 3300038443 Bacteria 7264
367 Ga0395901_0072187 3300038443 Bacteria 3598
368 Ga0436365_0167269 3300039437 Bacteria 1661
369 Ga0436365_0642071 3300039437 Bacteria 2101
370 Ga0436365_0817878 3300039437 Bacteria 1149
371 Ga0436365_1667821 3300039437 Bacteria 1026
372 Ga0436360_0463479 3300039438 Bacteria 2612
373 Ga0436360_0628778 3300039438 Bacteria 1406
374 Ga0436361_0077944 3300039447 Bacteria 3047
375 Ga0436361_0238145 3300039447 Bacteria 6517
376 Ga0436361_0274756 3300039447 Bacteria 52927
377 Ga0436361_0488424 3300039447 Bacteria 3382
378 Ga0436361_0489737 3300039447 Bacteria 10225
379 Ga0436361_1115272 3300039447 Bacteria 2984
380 Ga0436363_0656246 3300039450 Bacteria 572
381 Ga0436363_1420126 3300039450 Bacteria 903
382 Ga0436362_0085232 3300039453 Bacteria 5983
383 Ga0436362_0120734 3300039453 Bacteria 805
384 Ga0451843_0121359 3300041509 Bacteria 791
385 Ga0451853_2243521 3300041512 Bacteria 1862
386 Ga0439448_0145914 3300042005 Bacteria 820
387 Ga0439455_0091643 3300042012 Bacteria 834
388 Ga0466972_0013574 3300044658 Bacteria 4088
389 Ga0466972_0060680 3300044658 Bacteria 1814
390 Ga0466972_0148323 3300044658 Bacteria 1103
391 Ga0453683_0016715 3300044673 Bacteria 4729
392 Ga0453683_0071616 3300044673 Bacteria 2169
393 Ga0453683_0650408 3300044673 Unclassified 689
394 Ga0466965_0014378 3300044683 Bacteria 3744
395 Ga0466965_0126215 3300044683 Bacteria 1324
396 Ga0466966_0000101 3300044684 Bacteria 51920
397 Ga0466966_0033392 3300044684 Bacteria 3332
398 Ga0466966_0152405 3300044684 Bacteria 1409
399 Ga0466966_0529581 3300044684 Bacteria 709
400 Ga0466961_0000031 3300044693 Bacteria 85869
401 Ga0466961_0389363 3300044693 Bacteria 846
402 Ga0466961_0614709 3300044693 Bacteria 653
403 Ga0466963_0071739 3300044694 Bacteria 2331
404 Ga0466964_0062459 3300044706 Bacteria 1553
405 Ga0466964_0559434 3300044706 Bacteria 622
406 Ga0466964_0583370 3300044706 Bacteria 611
407 Ga0453684_0010072 3300044712 Bacteria 16242
408 Ga0453684_0178352 3300044712 Bacteria 2496
409 Ga0453684_0400155 3300044712 Unclassified 1538
410 Ga0466971_0188836 3300044719 Bacteria 970
411 Ga0466968_0007772 3300044735 Bacteria 4086
412 Ga0466968_0059574 3300044735 Bacteria 1645
413 Ga0466968_0379882 3300044735 Bacteria 690
414 Ga0466968_0589379 3300044735 Bacteria 560
415 Ga0466970_0085392 3300044765 Bacteria 1710
416 Ga0466970_0250820 3300044765 Bacteria 992
417 Ga0466970_0752107 3300044765 Bacteria 570
418 Ga0466957_0063501 3300044842 Bacteria 2270
419 Ga0466957_0363544 3300044842 Bacteria 984
420 Ga0466957_0417676 3300044842 Bacteria 920
421 Ga0466960_0097023 3300044901 Bacteria 1512
422 Ga0466960_0262608 3300044901 Bacteria 962
423 Ga0466960_0300008 3300044901 Bacteria 905
424 Ga0466960_0480463 3300044901 Bacteria 726
425 Ga0466960_0588463 3300044901 Bacteria 659
426 Ga0466959_0002151 3300045049 Bacteria 12504
427 Ga0466959_0002988 3300045049 Bacteria 10928
428 Ga0466959_0083616 3300045049 Bacteria 2298
429 Ga0466959_0698176 3300045049 Bacteria 680
430 Ga0466959_0785759 3300045049 Bacteria 637
431 Ga0451576_0014014 3300045051 Bacteria 8937
432 Ga0451576_0186023 3300045051 Unclassified 2169
433 Ga0451576_0824550 3300045051 Bacteria 974
434 Ga0451576_1546787 3300045051 Bacteria 689
435 Ga0451576_2733516 3300045051 Bacteria 502
436 Ga0466958_0241916 3300045836 Bacteria 1153
437 Ga0466958_0369547 3300045836 Bacteria 924
438 Ga0466967_0332903 3300045976 Bacteria 1466
439 Ga0466967_1234914 3300045976 Bacteria 744
440 Ga0495592_0636056 3300046454 Bacteria 648
441 Ga0495603_0153940 3300046455 Bacteria 1335
442 Ga0495629_0002586 3300046459 Bacteria 13860
443 Ga0495638_0094972 3300046460 Bacteria 1791
444 Ga0495638_0293832 3300046460 Bacteria 878
445 Ga0495638_0339974 3300046460 Bacteria 796
446 Ga0495641_0222418 3300046461 Bacteria 847
447 Ga0495653_0458474 3300046463 Bacteria 801
448 Ga0495582_0345380 3300046473 Bacteria 857
449 Ga0495605_0036646 3300046474 Bacteria 2472
450 Ga0495584_0321586 3300046491 Bacteria 785
451 Ga0495585_0132759 3300046492 Bacteria 1309
452 Ga0495585_0593259 3300046492 Bacteria 521
453 Ga0495594_0329073 3300046499 Bacteria 870
454 Ga0495607_0265039 3300046501 Bacteria 821
455 Ga0495606_0359973 3300046507 Bacteria 769
456 Ga0495608_0132808 3300046511 Bacteria 1592
457 Ga0495610_0041005 3300046512 Bacteria 2328
458 Ga0495618_0183521 3300046514 Bacteria 1329
459 Ga0495620_0101613 3300046515 Bacteria 1146
460 Ga0495620_0147040 3300046515 Bacteria 920
461 Ga0495628_0127789 3300046516 Bacteria 1946
462 Ga0495628_0516394 3300046516 Bacteria 861
463 Ga0495631_0178471 3300046518 Bacteria 910
464 Ga0495632_0267632 3300046519 Bacteria 763
465 Ga0495643_0014632 3300046522 Bacteria 4662
466 Ga0495643_0112256 3300046522 Bacteria 1385
467 Ga0495648_0191101 3300046524 Bacteria 1033
468 Ga0495666_0446195 3300046526 Bacteria 580
469 Ga0495652_0642276 3300046529 Bacteria 720
470 Ga0495654_0071188 3300046530 Bacteria 1648
471 Ga0495640_0038244 3300046533 Bacteria 3376
472 Ga0495609_0064268 3300046538 Bacteria 1619
473 Ga0495597_0068827 3300046542 Bacteria 1529
474 Ga0495622_0145679 3300046557 Bacteria 1073
475 Ga0495668_0256370 3300046616 Bacteria 957
476 Ga0495611_0052320 3300046648 Bacteria 1842
477 Ga0495625_0396047 3300046660 Bacteria 864
478 Ga0495625_0830418 3300046660 Bacteria 535
479 Ga0495661_0275948 3300046665 Bacteria 849
480 Ga0495588_0013855 3300046674 Bacteria 3849
481 Ga0495588_0258802 3300046674 Bacteria 917
482 Ga0495657_0013301 3300046675 Bacteria 6076
483 Ga0495646_0115628 3300046680 Bacteria 1523
484 Ga0495658_0213925 3300046683 Bacteria 1205
485 Ga0495613_0050253 3300046689 Bacteria 3075
486 Ga0495624_0043108 3300046690 Bacteria 2879
487 Ga0495671_0428953 3300046692 Bacteria 632
488 Ga0495649_0155091 3300046694 Bacteria 1202
489 Ga0495649_0382430 3300046694 Bacteria 708
490 Ga0495589_0063125 3300046794 Bacteria 1817
491 Ga0495600_0185527 3300046809 Bacteria 1339
492 Ga0495660_0283013 3300046810 Bacteria 758
493 Ga0495581_0106771 3300047315 Bacteria 1627
494 Ga0495604_0061880 3300047317 Bacteria 2861
495 Ga0495674_0404264 3300047319 Bacteria 1102
496 Ga0495672_0044926 3300047320 Bacteria 2647
497 Ga0495672_0090267 3300047320 Bacteria 1684
498 Ga0495672_0228800 3300047320 Bacteria 914
499 Ga0495672_0268228 3300047320 Bacteria 821
500 Ga0495676_0063382 3300047321 Bacteria 2881
501 Ga0495683_0144990 3300047323 Bacteria 1110
502 Ga0495687_083087 3300047443 Bacteria 1248
503 Ga0495687_097577 3300047443 Bacteria 1110
504 Ga0495673_0062574 3300047469 Bacteria 1589
505 Ga0495602_0109321 3300048088 Bacteria 2249
506 Ga0495626_0170316 3300048091 Bacteria 908
507 Ga0496100_0615052 3300048903 Bacteria 844
508 Ga0496101_0163326 3300048904 Bacteria 1709
509 Ga0496102_0074188 3300048905 Bacteria 3127
510 Ga0496102_0712961 3300048905 Bacteria 926
511 Ga0496102_1042382 3300048905 Bacteria 738
512 Ga0496103_0241856 3300048906 Bacteria 1161
513 Ga0496103_0261166 3300048906 Bacteria 1114
514 Ga0496104_0001655 3300048907 Bacteria 19236
515 Ga0496104_0057112 3300048907 Bacteria 3693
516 Ga0496104_0903684 3300048907 Bacteria 788
517 Ga0496105_0015424 3300048908 Bacteria 6089
518 Ga0496106_0094426 3300048909 Bacteria 2312
519 Ga0496108_0505547 3300048911 Bacteria 1055
520 Ga0496109_0754511 3300048912 Bacteria 911
521 Ga0496109_1859875 3300048912 Bacteria 535
522 Ga0496110_0157888 3300048913 Bacteria 2055
523 Ga0496110_0880568 3300048913 Bacteria 801
524 Ga0496110_1558871 3300048913 Bacteria 570
525 Ga0496111_0711005 3300048914 Bacteria 730
526 Ga0496111_1031510 3300048914 Bacteria 588
527 Ga0496112_0064774 3300048915 Bacteria 3607
528 Ga0496112_0390349 3300048915 Bacteria 1332
529 Ga0496113_0119847 3300048916 Bacteria 2056
530 Ga0496113_0179175 3300048916 Bacteria 1680
531 Ga0496113_0347813 3300048916 Bacteria 1189
532 Ga0496114_0392099 3300048917 Bacteria 1230
533 Ga0496114_0769788 3300048917 Bacteria 840
534 Ga0496115_0059021 3300048918 Bacteria 3089
535 Ga0496115_0154337 3300048918 Bacteria 1896
536 Ga0496116_0009012 3300048919 Bacteria 8574
537 Ga0496116_0053528 3300048919 Bacteria 2665
538 Ga0496117_0014560 3300048920 Bacteria 6768
539 Ga0496117_0033443 3300048920 Bacteria 3887
540 Ga0496117_0243084 3300048920 Bacteria 987
541 Ga0496117_0418051 3300048920 Bacteria 671
542 Ga0496118_0024327 3300048921 Bacteria 5230
543 Ga0496118_0025294 3300048921 Bacteria 5096
544 Ga0496118_0087742 3300048921 Bacteria 2156
545 Ga0496118_0222622 3300048921 Bacteria 1097
546 Ga0496119_0011533 3300048922 Bacteria 7303
547 Ga0496119_0016058 3300048922 Bacteria 5721
548 Ga0496119_0113437 3300048922 Bacteria 1501
549 Ga0496119_0342863 3300048922 Bacteria 726
550 Ga0496119_0360104 3300048922 Bacteria 702
551 Ga0496119_0388918 3300048922 Bacteria 667
552 Ga0496120_0003849 3300048923 Bacteria 13184
553 Ga0496120_0173894 3300048923 Bacteria 1063
554 Ga0496120_0393946 3300048923 Bacteria 613
555 Ga0496121_0000152 3300048924 Bacteria 150767
556 Ga0496121_0013561 3300048924 Bacteria 8740
557 Ga0496121_0014668 3300048924 Bacteria 8286
558 Ga0496121_0026715 3300048924 Bacteria 5426
559 Ga0496121_0043563 3300048924 Bacteria 3885
560 Ga0496121_0049950 3300048924 Bacteria 3539
561 Ga0496121_0121794 3300048924 Bacteria 1969
562 Ga0496122_0021585 3300048925 Bacteria 5757
563 Ga0496122_0047803 3300048925 Bacteria 3298
564 Ga0496122_0297606 3300048925 Bacteria 872
565 Ga0496122_0314650 3300048925 Bacteria 836
566 Ga0496123_0084176 3300048926 Bacteria 1919
567 Ga0496124_0371906 3300048927 Bacteria 1003
568 Ga0496124_0576293 3300048927 Bacteria 737
569 Ga0496124_0934270 3300048927 Bacteria 523
570 Ga0496125_0016187 3300048928 Bacteria 7170
571 Ga0496126_0002980 3300048929 Bacteria 21982
572 Ga0496126_0016467 3300048929 Bacteria 7391
573 Ga0496126_0026746 3300048929 Bacteria 5525
574 Ga0496126_0030510 3300048929 Bacteria 5106
575 Ga0496126_0076527 3300048929 Bacteria 2969
576 Ga0496126_0142002 3300048929 Bacteria 2066
577 Ga0496126_0173888 3300048929 Bacteria 1833
578 Ga0496126_0182774 3300048929 Bacteria 1780
579 Ga0496126_0194501 3300048929 Bacteria 1716
580 Ga0496126_0422071 3300048929 Bacteria 1078
581 Ga0496126_0470127 3300048929 Bacteria 1009
582 Ga0495678_089501 3300049459 Bacteria 1087
583 Ga0495682_0127700 3300049460 Bacteria 910
584 Ga0501031_0001041 3300049568 Bacteria 16832
585 Ga0501031_0065591 3300049568 Bacteria 2365
586 Ga0501032_0000040 3300049569 Bacteria 115662
587 Ga0501032_0003556 3300049569 Bacteria 11884
588 Ga0501033_0000128 3300049570 Bacteria 73419
589 Ga0501033_0000392 3300049570 Bacteria 42128
590 Ga0501033_0187684 3300049570 Bacteria 1480
591 Ga0501034_0000254 3300049571 Bacteria 97896
592 Ga0501034_0050101 3300049571 Bacteria 4212
593 Ga0501036_0000088 3300049572 Bacteria 57888
594 Ga0501036_0000375 3300049572 Bacteria 31541
595 Ga0501036_0239652 3300049572 Bacteria 1521
596 Ga0501037_0000041 3300049573 Bacteria 118457
597 Ga0501037_0008655 3300049573 Bacteria 7463
598 Ga0501038_0000057 3300049574 Bacteria 92766
599 Ga0501038_0001549 3300049574 Bacteria 21233
600 Ga0501039_0000084 3300049575 Bacteria 71542
601 Ga0501039_0015337 3300049575 Bacteria 5865
602 Ga0501042_0000506 3300049578 Bacteria 20296
603 Ga0501043_0000184 3300049579 Bacteria 56470
604 Ga0501043_0022975 3300049579 Bacteria 4890
605 Ga0501043_0186112 3300049579 Bacteria 1617
606 Ga0501043_0439183 3300049579 Bacteria 982
607 Ga0501046_0000072 3300049580 Bacteria 106407
608 Ga0501046_0000402 3300049580 Bacteria 43356
609 Ga0501047_0000044 3300049581 Bacteria 174789
610 Ga0501047_0009182 3300049581 Bacteria 9337
611 Ga0501047_0017239 3300049581 Bacteria 6914
612 Ga0501047_0038560 3300049581 Bacteria 4622
613 Ga0501047_0047785 3300049581 Bacteria 4134
614 Ga0501048_0000295 3300049582 Bacteria 33908
615 Ga0501048_0001365 3300049582 Bacteria 18477
616 Ga0501048_0068744 3300049582 Bacteria 2501
617 Ga0501067_0039211 3300049583 Bacteria 2630
618 Ga0501067_0154729 3300049583 Bacteria 1277
619 Ga0501068_0000113 3300049584 Bacteria 34900
620 Ga0501069_0021434 3300049585 Bacteria 3507
621 Ga0501069_0211197 3300049585 Bacteria 1126
622 Ga0501070_0000310 3300049586 Bacteria 44627
623 Ga0501070_0021229 3300049586 Bacteria 5450
624 Ga0501070_0885236 3300049586 Bacteria 697
625 Ga0501070_1392272 3300049586 Bacteria 533
626 Ga0501071_0278852 3300049587 Bacteria 1265
627 Ga0501072_0000156 3300049588 Bacteria 50717
628 Ga0501073_0000043 3300049589 Bacteria 80142
629 Ga0501073_0150523 3300049589 Bacteria 1613
630 Ga0501073_0185555 3300049589 Bacteria 1439
631 Ga0501074_0000035 3300049590 Bacteria 64770
632 Ga0501074_0156084 3300049590 Bacteria 1630
633 Ga0501079_0000839 3300049741 Bacteria 20917
634 Ga0501080_0000600 3300049742 Bacteria 28483
635 Ga0501080_0079232 3300049742 Bacteria 3054
636 Ga0501080_0099770 3300049742 Bacteria 2694
637 Ga0501083_0147261 3300049744 Bacteria 1542
638 Ga0501083_0223232 3300049744 Bacteria 1227
639 Ga0501035_0000128 3300049822 Bacteria 92297
640 Ga0501035_0000269 3300049822 Bacteria 61583
641 Ga0501035_0225361 3300049822 Bacteria 1599
642 Ga0501035_1208039 3300049822 Bacteria 586
643 Ga0501044_0000108 3300049823 Bacteria 100968
644 Ga0501044_0046026 3300049823 Bacteria 4518
645 Ga0501044_0323740 3300049823 Bacteria 1465
646 nmdc:mga03683_146362_c1 3300050489 Bacteria 1064
647 nmdc:mga03683_223452_c1 3300050489 Bacteria 869
648 nmdc:mga03n38_190319_c1 3300050490 Bacteria 1057
649 nmdc:mga00v17_438966_c1 3300050491 Bacteria 848
650 nmdc:mga00v17_77157_c1 3300050491 Bacteria 2074
651 nmdc:mga0yw44_3454_c1 3300050492 Bacteria 7016
652 nmdc:mga0yw44_528656_c1 3300050492 Bacteria 801
653 nmdc:mga0k408_11705_c1 3300050493 Bacteria 4783
654 nmdc:mga06z11_149191_c1 3300050494 Bacteria 1328
655 nmdc:mga06z11_244146_c1 3300050494 Bacteria 1056
656 nmdc:mga06z11_520846_c1 3300050494 Bacteria 721
657 nmdc:mga04h51_50221_c1 3300050495 Bacteria 1397
658 nmdc:mga07m45_174323_c1 3300050496 Bacteria 1250
659 nmdc:mga07m45_506363_c1 3300050496 Bacteria 699
660 nmdc:mga07m45_63911_c1 3300050496 Bacteria 1768
661 nmdc:mga08x19_425231_c1 3300050514 Bacteria 933
662 nmdc:mga0sz30_107435_c1 3300050516 Bacteria 1221
663 nmdc:mga0sz30_237724_c1 3300050516 Bacteria 811
664 nmdc:mga0sz30_48827_c1 3300050516 Bacteria 1792
665 Ga0495619_0412108 3300053085 Bacteria 933
666 Ga0500578_0186870 3300053086 Bacteria 1274
667 Ga0500643_000095 3300053087 Bacteria 92535
668 Ga0500644_0283517 3300053088 Bacteria 706
669 Ga0500651_0001437 3300053093 Bacteria 11972
670 Ga0500651_0211368 3300053093 Bacteria 1141
671 Ga0500566_0000123 3300053094 Bacteria 40138
672 Ga0500640_202490 3300053095 Bacteria 691
673 Ga0500641_0108970 3300053096 Bacteria 1191
674 Ga0500641_0372331 3300053096 Bacteria 568
675 Ga0500650_0087519 3300053098 Bacteria 1458
676 Ga0500554_138171 3300053102 Bacteria 824
677 Ga0500555_004703 3300053103 Bacteria 3878
678 Ga0500556_0048984 3300053104 Bacteria 1521
679 Ga0500557_000036 3300053105 Bacteria 71169
680 Ga0500562_034684 3300053108 Bacteria 1335
681 Ga0500569_003011 3300053109 Bacteria 3387
682 Ga0500569_267237 3300053109 Bacteria 579
683 Ga0500572_019168 3300053111 Bacteria 1783
684 Ga0500592_025841 3300053116 Bacteria 947
685 Ga0500592_030759 3300053116 Bacteria 866
686 Ga0500593_000585 3300053117 Bacteria 13998
687 Ga0500594_0223209 3300053118 Bacteria 623
688 Ga0500595_000839 3300053119 Bacteria 17559
689 Ga0500595_001859 3300053119 Bacteria 10918
690 Ga0500595_014588 3300053119 Bacteria 2978
691 Ga0500595_029117 3300053119 Bacteria 1876
692 Ga0500595_044588 3300053119 Bacteria 1404
693 Ga0500595_088852 3300053119 Bacteria 896
694 Ga0500607_055382 3300053121 Bacteria 2096
695 Ga0500608_019066 3300053122 Bacteria 3139
696 Ga0500642_0000103 3300053130 Bacteria 40846
697 Ga0500642_0037896 3300053130 Bacteria 2063
698 Ga0500642_0088219 3300053130 Bacteria 1431
699 Ga0500652_140334 3300053131 Bacteria 1006
700 Ga0500652_310827 3300053131 Bacteria 607
701 Ga0500658_0040012 3300053134 Bacteria 1876
702 Ga0500559_0002826 3300053136 Bacteria 8770
703 Ga0500559_0030423 3300053136 Bacteria 2314
704 Ga0500568_0008926 3300053139 Bacteria 4796
705 Ga0500568_0041288 3300053139 Bacteria 1854
706 Ga0500568_0059411 3300053139 Bacteria 1483
707 Ga0500568_0074207 3300053139 Bacteria 1298
708 Ga0500568_0260100 3300053139 Bacteria 631
709 Ga0500577_0317831 3300053142 Bacteria 680
710 Ga0500588_0179590 3300053146 Bacteria 778
711 Ga0500590_126829 3300053148 Bacteria 1187
712 Ga0500616_0017085 3300053153 Bacteria 4120
713 Ga0500616_0297568 3300053153 Bacteria 671
714 Ga0500619_019397 3300053154 Bacteria 1926
715 Ga0500620_036935 3300053155 Bacteria 1582
716 Ga0500622_0012724 3300053156 Bacteria 4551
717 Ga0500622_0020063 3300053156 Bacteria 3549
718 Ga0500627_0361680 3300053158 Bacteria 624
719 Ga0500638_118669 3300053162 Bacteria 1212
720 Ga0500638_139954 3300053162 Bacteria 1088
721 Ga0500636_0002571 3300053177 Bacteria 10091
722 Ga0500636_0005712 3300053177 Bacteria 7114
723 Ga0500637_0073623 3300053178 Bacteria 1967
724 Ga0500570_066843 3300053724 Bacteria 1703
725 Ga0500625_000325 3300053729 Bacteria 11897
726 Ga0500609_001599 3300053731 Bacteria 3303
727 Ga0500599_007228 3300053736 Bacteria 1426
728 Ga0500601_000445 3300053737 Bacteria 6725
729 Ga0500601_035212 3300053737 Bacteria 601
730 Ga0501084_0025559 3300054114 Bacteria 4926
731 Ga0500661_011309 3300055283 Bacteria 1614
732 Ga0501082_0158442 3300060353 Bacteria 1967
733 Ga0466962_0092498 3300061719 Bacteria 1450
734 Ga0466962_0132351 3300061719 Bacteria 1206
735 Ga0466962_0157047 3300061719 Bacteria 1105

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2786546940 2788437587 118
2 3300014968 Ga0157379_11221694 Ga0157379_112216941 119
3 3300005617 Ga0068859_100108929 Ga0068859_1001089292 120
4 3300005618 Ga0068864_100398976 Ga0068864_1003989762 120
5 3300005841 Ga0068863_100182757 Ga0068863_1001827572 120
6 3300005843 Ga0068860_101235463 Ga0068860_1012354632 120
7 3300006852 Ga0075433_11578652 Ga0075433_115786521 120
8 3300006871 Ga0075434_100248208 Ga0075434_1002482082 120
9 3300006931 Ga0097620_100108929 Ga0097620_1001089292 120
10 3300009101 Ga0105247_10937133 Ga0105247_109371332 120
11 3300009148 Ga0105243_10917821 Ga0105243_109178211 120
12 3300009551 Ga0105238_10712014 Ga0105238_107120142 120
13 3300013296 Ga0157374_10885120 Ga0157374_108851202 120
14 3300014325 Ga0163163_10975280 Ga0163163_109752802 120
15 3300021361 Ga0213872_10004165 Ga0213872_100041654 120
16 3300021361 Ga0213872_10031833 Ga0213872_100318332 120
17 3300025917 Ga0207660_10435695 Ga0207660_104356952 120
18 3300025935 Ga0207709_10611520 Ga0207709_106115201 120
19 3300026088 Ga0207641_10221377 Ga0207641_102213772 120
20 3300026095 Ga0207676_10743709 Ga0207676_107437092 120
21 3300028381 Ga0268264_10664299 Ga0268264_106642992 120
22 3300028794 Ga0307515_10303528 Ga0307515_103035282 120
23 3300029957 Ga0265324_10202588 Ga0265324_102025882 120
24 3300031235 Ga0265330_10034992 Ga0265330_100349923 120
25 3300031235 Ga0265330_10039393 Ga0265330_100393932 120
26 3300031235 Ga0265330_10062578 Ga0265330_100625782 120
27 3300031239 Ga0265328_10015517 Ga0265328_100155173 120
28 3300031241 Ga0265325_10025516 Ga0265325_100255162 120
29 3300031241 Ga0265325_10043185 Ga0265325_100431852 120
30 3300031241 Ga0265325_10266042 Ga0265325_102660422 120
31 3300031247 Ga0265340_10009354 Ga0265340_100093544 120
32 3300031247 Ga0265340_10327074 Ga0265340_103270742 120
33 3300031249 Ga0265339_10014821 Ga0265339_100148216 120
34 3300031344 Ga0265316_10256633 Ga0265316_102566332 120
35 3300031595 Ga0265313_10176613 Ga0265313_101766132 120
36 3300031595 Ga0265313_10291340 Ga0265313_102913401 120
37 3300031711 Ga0265314_10035527 Ga0265314_100355274 120
38 3300031711 Ga0265314_10054932 Ga0265314_100549322 120
39 3300031711 Ga0265314_10126958 Ga0265314_101269582 120
40 3300031711 Ga0265314_10442368 Ga0265314_104423682 120
41 3300031712 Ga0265342_10100271 Ga0265342_101002712 120
42 3300031712 Ga0265342_10102084 Ga0265342_101020843 120
43 3300031712 Ga0265342_10169122 Ga0265342_101691222 120
44 3300035084 Ga0373928_0003582 Ga0373928_0003582_2226_2591 120
45 3300035112 Ga0373932_0016697 Ga0373932_0016697_1130_1495 120
46 3300039447 Ga0436361_0077944 Ga0436361_0077944_1682_2044 120
47 3300039447 Ga0436361_0274756 Ga0436361_0274756_26191_26553 120
48 3300039447 Ga0436361_0489737 Ga0436361_0489737_2780_3142 120
49 3300039447 Ga0436361_1115272 Ga0436361_1115272_2431_2793 120
50 3300044673 Ga0453683_0016715 Ga0453683_0016715_1362_1727 120
51 3300044673 Ga0453683_0071616 Ga0453683_0071616_1712_2077 120
52 3300044673 Ga0453683_0650408 Ga0453683_0650408_47_412 120
53 3300044684 Ga0466966_0033392 Ga0466966_0033392_424_786 120
54 3300044684 Ga0466966_0152405 Ga0466966_0152405_844_1209 120
55 3300044712 Ga0453684_0010072 Ga0453684_0010072_2113_2496 120
56 3300044712 Ga0453684_0400155 Ga0453684_0400155_497_862 120
57 3300044719 Ga0466971_0188836 Ga0466971_0188836_414_779 120
58 3300044765 Ga0466970_0085392 Ga0466970_0085392_530_892 120
59 3300044842 Ga0466957_0417676 Ga0466957_0417676_272_637 120
60 3300045049 Ga0466959_0002151 Ga0466959_0002151_4365_4730 120
61 3300045051 Ga0451576_0186023 Ga0451576_0186023_1671_2036 120
62 3300045051 Ga0451576_0824550 Ga0451576_0824550_585_950 120
63 3300045051 Ga0451576_1546787 Ga0451576_1546787_281_646 120
64 3300045051 Ga0451576_2733516 Ga0451576_2733516_27_392 120
65 3300045836 Ga0466958_0369547 Ga0466958_0369547_197_562 120
66 3300046665 Ga0495661_0275948 Ga0495661_0275948_439_801 120
67 3300048920 Ga0496117_0033443 Ga0496117_0033443_2555_2917 120
68 3300048922 Ga0496119_0113437 Ga0496119_0113437_200_562 120
69 3300048923 Ga0496120_0393946 Ga0496120_0393946_171_533 120
70 3300048925 Ga0496122_0021585 Ga0496122_0021585_4712_5074 120
71 3300049568 Ga0501031_0065591 Ga0501031_0065591_1253_1618 120
72 3300049569 Ga0501032_0003556 Ga0501032_0003556_3593_3958 120
73 3300049570 Ga0501033_0000392 Ga0501033_0000392_1890_2255 120
74 3300049571 Ga0501034_0050101 Ga0501034_0050101_2409_2774 120
75 3300049572 Ga0501036_0000088 Ga0501036_0000088_56727_57092 120
76 3300049573 Ga0501037_0008655 Ga0501037_0008655_621_986 120
77 3300049574 Ga0501038_0001549 Ga0501038_0001549_545_910 120
78 3300049575 Ga0501039_0015337 Ga0501039_0015337_2110_2475 120
79 3300049578 Ga0501042_0000506 Ga0501042_0000506_796_1161 120
80 3300049579 Ga0501043_0022975 Ga0501043_0022975_4185_4550 120
81 3300049580 Ga0501046_0000402 Ga0501046_0000402_2248_2613 120
82 3300049581 Ga0501047_0038560 Ga0501047_0038560_51_416 120
83 3300049582 Ga0501048_0001365 Ga0501048_0001365_13890_14252 120
84 3300049582 Ga0501048_0068744 Ga0501048_0068744_1679_2044 120
85 3300049589 Ga0501073_0150523 Ga0501073_0150523_15_380 120
86 3300049742 Ga0501080_0079232 Ga0501080_0079232_2620_2985 120
87 3300049744 Ga0501083_0147261 Ga0501083_0147261_991_1356 120
88 3300049822 Ga0501035_0000269 Ga0501035_0000269_60266_60631 120
89 3300049823 Ga0501044_0046026 Ga0501044_0046026_1890_2255 120
90 3300060353 Ga0501082_0158442 Ga0501082_0158442_1039_1404 120
91 3300061719 Ga0466962_0092498 Ga0466962_0092498_840_1205 120
92 3300001904 JGI24736J21556_1063606 JGI24736J21556_10636062 121
93 3300001989 JGI24739J22299_10100083 JGI24739J22299_101000831 121
94 3300001990 JGI24737J22298_10135173 JGI24737J22298_101351732 121
95 3300002067 JGI24735J21928_10147995 JGI24735J21928_101479952 121
96 3300003215 JGI25153J46596_10000633 JGI25153J46596_1000063317 121
97 3300003215 JGI25153J46596_10000651 JGI25153J46596_100006516 121
98 3300003215 JGI25153J46596_10006525 JGI25153J46596_100065256 121
99 3300003215 JGI25153J46596_10011915 JGI25153J46596_100119151 121
100 3300003215 JGI25153J46596_10037547 JGI25153J46596_100375473 121
101 3300003215 JGI25153J46596_10089491 JGI25153J46596_100894912 121
102 3300003323 rootH1_10201646 rootH1_102016463 121
103 3300003354 JGI25160J50197_1056197 JGI25160J50197_10561971 121
104 3300003771 Ga0055526_1036046 Ga0055526_10360462 121
105 3300003775 Ga0055524_1007998 Ga0055524_10079983 121
106 3300003775 Ga0055524_1059930 Ga0055524_10599302 121
107 3300003794 Ga0055531_10005412 Ga0055531_100054122 121
108 3300005262 Ga0065165_1000054 Ga0065165_1000054112 121
109 3300005262 Ga0065165_1001857 Ga0065165_100185716 121
110 3300005262 Ga0065165_1002497 Ga0065165_10024976 121
111 3300005262 Ga0065165_1061509 Ga0065165_10615092 121
112 3300005329 Ga0070683_100038089 Ga0070683_1000380892 121
113 3300005329 Ga0070683_100057527 Ga0070683_1000575272 121
114 3300005329 Ga0070683_100765555 Ga0070683_1007655552 121
115 3300005331 Ga0070670_101423776 Ga0070670_1014237762 121
116 3300005336 Ga0070680_100094782 Ga0070680_1000947822 121
117 3300005337 Ga0070682_101804299 Ga0070682_1018042991 121
118 3300005338 Ga0068868_100357737 Ga0068868_1003577373 121
119 3300005339 Ga0070660_100294597 Ga0070660_1002945974 121
120 3300005339 Ga0070660_101761265 Ga0070660_1017612651 121
121 3300005341 Ga0070691_10030518 Ga0070691_100305183 121
122 3300005355 Ga0070671_100289106 Ga0070671_1002891062 121
123 3300005367 Ga0070667_100930754 Ga0070667_1009307541 121
124 3300005434 Ga0070709_10001267 Ga0070709_100012674 121
125 3300005434 Ga0070709_11017313 Ga0070709_110173132 121
126 3300005435 Ga0070714_100135360 Ga0070714_1001353602 121
127 3300005435 Ga0070714_100213431 Ga0070714_1002134313 121
128 3300005436 Ga0070713_100006642 Ga0070713_1000066422 121
129 3300005437 Ga0070710_10001610 Ga0070710_100016108 121
130 3300005439 Ga0070711_100002880 Ga0070711_1000028806 121
131 3300005455 Ga0070663_100063537 Ga0070663_1000635372 121
132 3300005455 Ga0070663_100666177 Ga0070663_1006661772 121
133 3300005458 Ga0070681_10229924 Ga0070681_102299243 121
134 3300005458 Ga0070681_11349987 Ga0070681_113499872 121
135 3300005530 Ga0070679_100195528 Ga0070679_1001955282 121
136 3300005530 Ga0070679_100214870 Ga0070679_1002148702 121
137 3300005530 Ga0070679_101845899 Ga0070679_1018458992 121
138 3300005535 Ga0070684_100032985 Ga0070684_1000329852 121
139 3300005535 Ga0070684_100610185 Ga0070684_1006101852 121
140 3300005539 Ga0068853_100295866 Ga0068853_1002958663 121
141 3300005539 Ga0068853_100469902 Ga0068853_1004699022 121
142 3300005539 Ga0068853_100516200 Ga0068853_1005162002 121
143 3300005539 Ga0068853_100794613 Ga0068853_1007946132 121
144 3300005539 Ga0068853_101628346 Ga0068853_1016283461 121
145 3300005563 Ga0068855_100080309 Ga0068855_1000803094 121
146 3300005563 Ga0068855_101935132 Ga0068855_1019351322 121
147 3300005564 Ga0070664_100705062 Ga0070664_1007050622 121
148 3300005577 Ga0068857_100265926 Ga0068857_1002659264 121
149 3300005577 Ga0068857_100444308 Ga0068857_1004443082 121
150 3300005577 Ga0068857_100732826 Ga0068857_1007328262 121
151 3300005578 Ga0068854_100328560 Ga0068854_1003285601 121
152 3300005614 Ga0068856_100375959 Ga0068856_1003759592 121
153 3300005614 Ga0068856_101597303 Ga0068856_1015973032 121
154 3300005616 Ga0068852_100001747 Ga0068852_1000017472 121
155 3300005618 Ga0068864_100000060 Ga0068864_1000000605 121
156 3300005618 Ga0068864_100208399 Ga0068864_1002083992 121
157 3300005834 Ga0068851_10183858 Ga0068851_101838584 121
158 3300005840 Ga0068870_10512580 Ga0068870_105125802 121
159 3300005841 Ga0068863_100000023 Ga0068863_100000023125 121
160 3300005841 Ga0068863_100216415 Ga0068863_1002164154 121
161 3300005842 Ga0068858_100011301 Ga0068858_1000113015 121
162 3300005843 Ga0068860_100608105 Ga0068860_1006081052 121
163 3300005843 Ga0068860_100626215 Ga0068860_1006262152 121
164 3300005844 Ga0068862_100966501 Ga0068862_1009665011 121
165 3300005937 Ga0081455_10106377 Ga0081455_101063772 121
166 3300005983 Ga0081540_1048867 Ga0081540_10488673 121
167 3300006028 Ga0070717_10128448 Ga0070717_101284483 121
168 3300006028 Ga0070717_10238080 Ga0070717_102380802 121
169 3300006038 Ga0075365_10012541 Ga0075365_100125414 121
170 3300006038 Ga0075365_10039785 Ga0075365_100397852 121
171 3300006038 Ga0075365_10100286 Ga0075365_101002862 121
172 3300006042 Ga0075368_10283293 Ga0075368_102832932 121
173 3300006048 Ga0075363_100019810 Ga0075363_1000198104 121
174 3300006048 Ga0075363_100373654 Ga0075363_1003736542 121
175 3300006048 Ga0075363_101003995 Ga0075363_1010039951 121
176 3300006051 Ga0075364_10523514 Ga0075364_105235142 121
177 3300006163 Ga0070715_10569651 Ga0070715_105696512 121
178 3300006173 Ga0070716_100001907 Ga0070716_1000019075 121
179 3300006175 Ga0070712_100022694 Ga0070712_1000226943 121
180 3300006177 Ga0075362_10060294 Ga0075362_100602942 121
181 3300006177 Ga0075362_10183579 Ga0075362_101835792 121
182 3300006177 Ga0075362_10598125 Ga0075362_105981252 121
183 3300006178 Ga0075367_10096852 Ga0075367_100968522 121
184 3300006178 Ga0075367_10099824 Ga0075367_100998243 121
185 3300006178 Ga0075367_10127753 Ga0075367_101277533 121
186 3300006178 Ga0075367_10972276 Ga0075367_109722762 121
187 3300006186 Ga0075369_10100669 Ga0075369_101006693 121
188 3300006186 Ga0075369_10120731 Ga0075369_101207312 121
189 3300006195 Ga0075366_10008786 Ga0075366_100087864 121
190 3300006237 Ga0097621_101899187 Ga0097621_1018991872 121
191 3300006353 Ga0075370_10047941 Ga0075370_100479412 121
192 3300006353 Ga0075370_10133086 Ga0075370_101330862 121
193 3300006358 Ga0068871_100635702 Ga0068871_1006357022 121
194 3300006914 Ga0075436_100889635 Ga0075436_1008896351 121
195 3300006942 Ga0099824_1024667 Ga0099824_10246671 121
196 3300006944 Ga0099823_1070945 Ga0099823_10709452 121
197 3300009011 Ga0105251_10063426 Ga0105251_100634263 121
198 3300009011 Ga0105251_10210083 Ga0105251_102100832 121
199 3300009036 Ga0105244_10397525 Ga0105244_103975252 121
200 3300009092 Ga0105250_10012457 Ga0105250_100124572 121
201 3300009093 Ga0105240_10008853 Ga0105240_100088537 121
202 3300009093 Ga0105240_10020641 Ga0105240_100206416 121
203 3300009093 Ga0105240_10164739 Ga0105240_101647392 121
204 3300009093 Ga0105240_10465050 Ga0105240_104650502 121
205 3300009093 Ga0105240_11113435 Ga0105240_111134352 121
206 3300009098 Ga0105245_10336467 Ga0105245_103364672 121
207 3300009098 Ga0105245_10877220 Ga0105245_108772202 121
208 3300009101 Ga0105247_10122059 Ga0105247_101220593 121
209 3300009101 Ga0105247_10396142 Ga0105247_103961422 121
210 3300009101 Ga0105247_10803452 Ga0105247_108034521 121
211 3300009148 Ga0105243_10139868 Ga0105243_101398682 121
212 3300009174 Ga0105241_11457722 Ga0105241_114577222 121
213 3300009176 Ga0105242_10949479 Ga0105242_109494791 121
214 3300009177 Ga0105248_10001464 Ga0105248_100014642 121
215 3300009177 Ga0105248_10800750 Ga0105248_108007502 121
216 3300009177 Ga0105248_10860246 Ga0105248_108602462 121
217 3300009177 Ga0105248_12313384 Ga0105248_123133842 121
218 3300009545 Ga0105237_10014235 Ga0105237_100142352 121
219 3300009545 Ga0105237_10042891 Ga0105237_100428914 121
220 3300009545 Ga0105237_10139035 Ga0105237_101390353 121
221 3300009545 Ga0105237_10265701 Ga0105237_102657012 121
222 3300009545 Ga0105237_10644094 Ga0105237_106440942 121
223 3300009545 Ga0105237_11725061 Ga0105237_117250612 121
224 3300009551 Ga0105238_10063440 Ga0105238_100634403 121
225 3300009551 Ga0105238_10374439 Ga0105238_103744392 121
226 3300009551 Ga0105238_10791518 Ga0105238_107915182 121
227 3300009551 Ga0105238_11255130 Ga0105238_112551301 121
228 3300009553 Ga0105249_10339575 Ga0105249_103395753 121
229 3300010375 Ga0105239_10039622 Ga0105239_100396224 121
230 3300010375 Ga0105239_10079622 Ga0105239_100796225 121
231 3300010375 Ga0105239_10079805 Ga0105239_100798053 121
232 3300010375 Ga0105239_13536518 Ga0105239_135365181 121
233 3300011119 Ga0105246_10015578 Ga0105246_100155782 121
234 3300013100 Ga0157373_10307542 Ga0157373_103075422 121
235 3300013102 Ga0157371_10541086 Ga0157371_105410861 121
236 3300013102 Ga0157371_11115882 Ga0157371_111158822 121
237 3300013104 Ga0157370_10050197 Ga0157370_100501973 121
238 3300013104 Ga0157370_11160226 Ga0157370_111602262 121
239 3300013105 Ga0157369_10007758 Ga0157369_100077584 121
240 3300013105 Ga0157369_10009352 Ga0157369_100093526 121
241 3300013105 Ga0157369_10484841 Ga0157369_104848412 121
242 3300013105 Ga0157369_10729188 Ga0157369_107291882 121
243 3300013296 Ga0157374_10457643 Ga0157374_104576432 121
244 3300013297 Ga0157378_10433232 Ga0157378_104332322 121
245 3300013306 Ga0163162_10165287 Ga0163162_101652873 121
246 3300013307 Ga0157372_10213404 Ga0157372_102134042 121
247 3300013307 Ga0157372_10476886 Ga0157372_104768862 121
248 3300013308 Ga0157375_10136536 Ga0157375_101365364 121
249 3300014325 Ga0163163_10071930 Ga0163163_100719304 121
250 3300014325 Ga0163163_10536565 Ga0163163_105365652 121
251 3300014497 Ga0182008_10855741 Ga0182008_108557411 121
252 3300014968 Ga0157379_10058879 Ga0157379_100588792 121
253 3300014968 Ga0157379_10603277 Ga0157379_106032772 121
254 3300014968 Ga0157379_12117066 Ga0157379_121170661 121
255 3300014969 Ga0157376_10096295 Ga0157376_100962953 121
256 3300021358 Ga0213873_10010521 Ga0213873_100105212 121
257 3300021361 Ga0213872_10370683 Ga0213872_103706832 121
258 3300021384 Ga0213876_10065160 Ga0213876_100651603 121
259 3300021384 Ga0213876_10103445 Ga0213876_101034452 121
260 3300021388 Ga0213875_10119834 Ga0213875_101198342 121
261 3300021388 Ga0213875_10122984 Ga0213875_101229841 121
262 3300021441 Ga0213871_10007632 Ga0213871_100076323 121
263 3300025245 Ga0207425_1010576 Ga0207425_10105762 121
264 3300025254 Ga0209148_1000421 Ga0209148_100042125 121
265 3300025254 Ga0209148_1016562 Ga0209148_10165622 121
266 3300025254 Ga0209148_1043097 Ga0209148_10430971 121
267 3300025261 Ga0209233_1002484 Ga0209233_10024844 121
268 3300025261 Ga0209233_1002615 Ga0209233_10026154 121
269 3300025261 Ga0209233_1017000 Ga0209233_10170003 121
270 3300025272 Ga0209455_1007536 Ga0209455_10075362 121
271 3300025284 Ga0209130_1081120 Ga0209130_10811202 121
272 3300025295 Ga0209564_1000044 Ga0209564_1000044159 121
273 3300025295 Ga0209564_1004705 Ga0209564_10047056 121
274 3300025295 Ga0209564_1014807 Ga0209564_10148074 121
275 3300025297 Ga0209758_1000117 Ga0209758_100011749 121
276 3300025297 Ga0209758_1000506 Ga0209758_100050645 121
277 3300025297 Ga0209758_1001068 Ga0209758_100106811 121
278 3300025297 Ga0209758_1001793 Ga0209758_100179311 121
279 3300025297 Ga0209758_1003491 Ga0209758_10034916 121
280 3300025297 Ga0209758_1007058 Ga0209758_10070583 121
281 3300025298 Ga0209050_1070340 Ga0209050_10703402 121
282 3300025299 Ga0209256_1000740 Ga0209256_100074034 121
283 3300025299 Ga0209256_1007255 Ga0209256_10072552 121
284 3300025299 Ga0209256_1008199 Ga0209256_10081995 121
285 3300025302 Ga0207426_1000467 Ga0207426_100046755 121
286 3300025302 Ga0207426_1000508 Ga0207426_100050836 121
287 3300025302 Ga0207426_1006582 Ga0207426_10065822 121
288 3300025302 Ga0207426_1023419 Ga0207426_10234193 121
289 3300025302 Ga0207426_1075361 Ga0207426_10753612 121
290 3300025302 Ga0207426_1103153 Ga0207426_11031532 121
291 3300025303 Ga0209051_1030114 Ga0209051_10301142 121
292 3300025304 Ga0209257_1000158 Ga0209257_1000158142 121
293 3300025304 Ga0209257_1023507 Ga0209257_10235073 121
294 3300025898 Ga0207692_10001796 Ga0207692_100017964 121
295 3300025900 Ga0207710_10023967 Ga0207710_100239672 121
296 3300025900 Ga0207710_10318232 Ga0207710_103182322 121
297 3300025901 Ga0207688_10138968 Ga0207688_101389682 121
298 3300025903 Ga0207680_10052867 Ga0207680_100528673 121
299 3300025904 Ga0207647_10006024 Ga0207647_100060242 121
300 3300025904 Ga0207647_10146688 Ga0207647_101466882 121
301 3300025905 Ga0207685_10315612 Ga0207685_103156122 121
302 3300025906 Ga0207699_10000749 Ga0207699_1000074911 121
303 3300025912 Ga0207707_10660765 Ga0207707_106607651 121
304 3300025913 Ga0207695_10000136 Ga0207695_1000013658 121
305 3300025913 Ga0207695_10019551 Ga0207695_100195514 121
306 3300025913 Ga0207695_10113023 Ga0207695_101130233 121
307 3300025913 Ga0207695_10201059 Ga0207695_102010593 121
308 3300025913 Ga0207695_11137786 Ga0207695_111377861 121
309 3300025914 Ga0207671_10000202 Ga0207671_1000020227 121
310 3300025914 Ga0207671_10136125 Ga0207671_101361252 121
311 3300025914 Ga0207671_10171842 Ga0207671_101718422 121
312 3300025914 Ga0207671_10285439 Ga0207671_102854392 121
313 3300025914 Ga0207671_10556070 Ga0207671_105560702 121
314 3300025915 Ga0207693_10176854 Ga0207693_101768542 121
315 3300025915 Ga0207693_10227360 Ga0207693_102273601 121
316 3300025916 Ga0207663_10001805 Ga0207663_100018052 121
317 3300025919 Ga0207657_10304669 Ga0207657_103046692 121
318 3300025919 Ga0207657_10332726 Ga0207657_103327262 121
319 3300025919 Ga0207657_10392953 Ga0207657_103929533 121
320 3300025920 Ga0207649_10874190 Ga0207649_108741902 121
321 3300025921 Ga0207652_10150356 Ga0207652_101503562 121
322 3300025921 Ga0207652_10313972 Ga0207652_103139722 121
323 3300025923 Ga0207681_10762870 Ga0207681_107628701 121
324 3300025924 Ga0207694_10079372 Ga0207694_100793722 121
325 3300025924 Ga0207694_10092566 Ga0207694_100925664 121
326 3300025924 Ga0207694_10934411 Ga0207694_109344112 121
327 3300025924 Ga0207694_11431450 Ga0207694_114314501 121
328 3300025925 Ga0207650_10212832 Ga0207650_102128322 121
329 3300025925 Ga0207650_11610041 Ga0207650_116100411 121
330 3300025927 Ga0207687_10652712 Ga0207687_106527122 121
331 3300025928 Ga0207700_10004852 Ga0207700_100048524 121
332 3300025928 Ga0207700_10169014 Ga0207700_101690142 121
333 3300025928 Ga0207700_11201268 Ga0207700_112012682 121
334 3300025929 Ga0207664_10053425 Ga0207664_100534254 121
335 3300025929 Ga0207664_10151837 Ga0207664_101518372 121
336 3300025932 Ga0207690_10106076 Ga0207690_101060762 121
337 3300025933 Ga0207706_10100034 Ga0207706_101000343 121
338 3300025934 Ga0207686_10905971 Ga0207686_109059712 121
339 3300025935 Ga0207709_10130291 Ga0207709_101302912 121
340 3300025939 Ga0207665_10002001 Ga0207665_100020019 121
341 3300025941 Ga0207711_10001333 Ga0207711_100013332 121
342 3300025941 Ga0207711_10567296 Ga0207711_105672961 121
343 3300025942 Ga0207689_10634348 Ga0207689_106343482 121
344 3300025944 Ga0207661_10013432 Ga0207661_100134324 121
345 3300025944 Ga0207661_10062354 Ga0207661_100623543 121
346 3300025944 Ga0207661_11599670 Ga0207661_115996702 121
347 3300025949 Ga0207667_10441570 Ga0207667_104415702 121
348 3300025949 Ga0207667_10707351 Ga0207667_107073512 121
349 3300025960 Ga0207651_10220893 Ga0207651_102208932 121
350 3300025961 Ga0207712_10907609 Ga0207712_109076092 121
351 3300025972 Ga0207668_11197751 Ga0207668_111977512 121
352 3300025981 Ga0207640_10514171 Ga0207640_105141711 121
353 3300026035 Ga0207703_10000571 Ga0207703_1000057114 121
354 3300026041 Ga0207639_10186688 Ga0207639_101866882 121
355 3300026041 Ga0207639_10277379 Ga0207639_102773792 121
356 3300026041 Ga0207639_10729666 Ga0207639_107296662 121
357 3300026041 Ga0207639_11020290 Ga0207639_110202902 121
358 3300026067 Ga0207678_10055007 Ga0207678_100550072 121
359 3300026067 Ga0207678_10066190 Ga0207678_100661903 121
360 3300026067 Ga0207678_10202709 Ga0207678_102027092 121
361 3300026067 Ga0207678_10883620 Ga0207678_108836202 121
362 3300026067 Ga0207678_11713587 Ga0207678_117135872 121
363 3300026075 Ga0207708_11822248 Ga0207708_118222481 121
364 3300026078 Ga0207702_10283974 Ga0207702_102839742 121
365 3300026088 Ga0207641_10000067 Ga0207641_10000067152 121
366 3300026088 Ga0207641_10180966 Ga0207641_101809662 121
367 3300026089 Ga0207648_10105282 Ga0207648_101052823 121
368 3300026095 Ga0207676_10001977 Ga0207676_1000197712 121
369 3300026095 Ga0207676_11361098 Ga0207676_113610982 121
370 3300026095 Ga0207676_11816878 Ga0207676_118168782 121
371 3300026095 Ga0207676_12502286 Ga0207676_125022861 121
372 3300026116 Ga0207674_10295232 Ga0207674_102952323 121
373 3300026116 Ga0207674_10851309 Ga0207674_108513092 121
374 3300026118 Ga0207675_100260059 Ga0207675_1002600593 121
375 3300026121 Ga0207683_10091813 Ga0207683_100918132 121
376 3300027111 Ga0209281_1027067 Ga0209281_10270672 121
377 3300027296 Ga0209389_1000056 Ga0209389_100005635 121
378 3300027296 Ga0209389_1000206 Ga0209389_100020633 121
379 3300027357 Ga0209589_1000034 Ga0209589_1000034109 121
380 3300027361 Ga0209489_100009 Ga0209489_10000975 121
381 3300027361 Ga0209489_103071 Ga0209489_10307122 121
382 3300027363 Ga0209700_100471 Ga0209700_10047113 121
383 3300027866 Ga0209813_10107735 Ga0209813_101077352 121
384 3300027866 Ga0209813_10144029 Ga0209813_101440292 121
385 3300028379 Ga0268266_10133830 Ga0268266_101338302 121
386 3300028379 Ga0268266_10933498 Ga0268266_109334982 121
387 3300028380 Ga0268265_10149380 Ga0268265_101493802 121
388 3300028381 Ga0268264_10473708 Ga0268264_104737082 121
389 3300028800 Ga0265338_10009258 Ga0265338_100092583 121
390 3300031901 Ga0307406_10109482 Ga0307406_101094822 121
391 3300031901 Ga0307406_10339551 Ga0307406_103395512 121
392 3300031995 Ga0307409_100840991 Ga0307409_1008409911 121
393 3300033180 Ga0307510_10063444 Ga0307510_100634445 121
394 3300035170 Ga0373943_0848637 Ga0373943_0848637_149_514 121
395 3300035691 Ga0373931_0375875 Ga0373931_0375875_234_599 121
396 3300037068 Ga0373925_0065376 Ga0373925_0065376_1477_1842 121
397 3300037312 Ga0395899_0112185 Ga0395899_0112185_934_1299 121
398 3300037312 Ga0395899_0206251 Ga0395899_0206251_141_506 121
399 3300037418 Ga0395900_0003815 Ga0395900_0003815_256_621 121
400 3300037418 Ga0395900_0033307 Ga0395900_0033307_3451_3816 121
401 3300037418 Ga0395900_0057751 Ga0395900_0057751_2131_2496 121
402 3300037418 Ga0395900_0723873 Ga0395900_0723873_189_554 121
403 3300037418 Ga0395900_0904579 Ga0395900_0904579_426_791 121
404 3300037466 Ga0395898_0007171 Ga0395898_0007171_3265_3630 121
405 3300037466 Ga0395898_0022885 Ga0395898_0022885_4852_5217 121
406 3300037466 Ga0395898_0097903 Ga0395898_0097903_1313_1678 121
407 3300037471 Ga0395905_0637162 Ga0395905_0637162_275_640 121
408 3300037471 Ga0395905_0894013 Ga0395905_0894013_249_614 121
409 3300037853 Ga0436364_0487949 Ga0436364_0487949_1623_1988 121
410 3300037853 Ga0436364_0646122 Ga0436364_0646122_1198_1563 121
411 3300037853 Ga0436364_0899392 Ga0436364_0899392_2530_2895 121
412 3300037853 Ga0436364_1201854 Ga0436364_1201854_466_831 121
413 3300038443 Ga0395901_0017745 Ga0395901_0017745_3666_4031 121
414 3300038443 Ga0395901_0072187 Ga0395901_0072187_1609_1974 121
415 3300039437 Ga0436365_0167269 Ga0436365_0167269_168_533 121
416 3300039437 Ga0436365_0642071 Ga0436365_0642071_1185_1550 121
417 3300039437 Ga0436365_0817878 Ga0436365_0817878_154_519 121
418 3300039437 Ga0436365_1667821 Ga0436365_1667821_296_664 121
419 3300039438 Ga0436360_0463479 Ga0436360_0463479_1211_1576 121
420 3300039438 Ga0436360_0628778 Ga0436360_0628778_427_792 121
421 3300039447 Ga0436361_0238145 Ga0436361_0238145_6077_6442 121
422 3300039447 Ga0436361_0488424 Ga0436361_0488424_1406_1771 121
423 3300039450 Ga0436363_0656246 Ga0436363_0656246_177_542 121
424 3300039450 Ga0436363_1420126 Ga0436363_1420126_410_775 121
425 3300039453 Ga0436362_0085232 Ga0436362_0085232_1749_2114 121
426 3300039453 Ga0436362_0120734 Ga0436362_0120734_193_558 121
427 3300041509 Ga0451843_0121359 Ga0451843_0121359_13_378 121
428 3300041512 Ga0451853_2243521 Ga0451853_2243521_256_621 121
429 3300042005 Ga0439448_0145914 Ga0439448_0145914_334_699 121
430 3300042012 Ga0439455_0091643 Ga0439455_0091643_455_820 121
431 3300044658 Ga0466972_0013574 Ga0466972_0013574_3340_3705 121
432 3300044658 Ga0466972_0060680 Ga0466972_0060680_120_485 121
433 3300044658 Ga0466972_0148323 Ga0466972_0148323_167_532 121
434 3300044683 Ga0466965_0014378 Ga0466965_0014378_2699_3064 121
435 3300044683 Ga0466965_0126215 Ga0466965_0126215_380_745 121
436 3300044684 Ga0466966_0000101 Ga0466966_0000101_5571_5936 121
437 3300044684 Ga0466966_0529581 Ga0466966_0529581_273_638 121
438 3300044693 Ga0466961_0000031 Ga0466961_0000031_37994_38359 121
439 3300044693 Ga0466961_0389363 Ga0466961_0389363_211_576 121
440 3300044693 Ga0466961_0614709 Ga0466961_0614709_188_553 121
441 3300044694 Ga0466963_0071739 Ga0466963_0071739_867_1232 121
442 3300044706 Ga0466964_0062459 Ga0466964_0062459_1023_1388 121
443 3300044706 Ga0466964_0559434 Ga0466964_0559434_238_603 121
444 3300044706 Ga0466964_0583370 Ga0466964_0583370_24_389 121
445 3300044712 Ga0453684_0178352 Ga0453684_0178352_396_773 121
446 3300044735 Ga0466968_0007772 Ga0466968_0007772_947_1312 121
447 3300044735 Ga0466968_0059574 Ga0466968_0059574_291_656 121
448 3300044735 Ga0466968_0379882 Ga0466968_0379882_25_390 121
449 3300044735 Ga0466968_0589379 Ga0466968_0589379_159_524 121
450 3300044765 Ga0466970_0250820 Ga0466970_0250820_418_783 121
451 3300044765 Ga0466970_0752107 Ga0466970_0752107_153_518 121
452 3300044842 Ga0466957_0063501 Ga0466957_0063501_972_1337 121
453 3300044842 Ga0466957_0363544 Ga0466957_0363544_374_739 121
454 3300044901 Ga0466960_0097023 Ga0466960_0097023_469_834 121
455 3300044901 Ga0466960_0262608 Ga0466960_0262608_202_567 121
456 3300044901 Ga0466960_0300008 Ga0466960_0300008_516_881 121
457 3300044901 Ga0466960_0480463 Ga0466960_0480463_319_684 121
458 3300044901 Ga0466960_0588463 Ga0466960_0588463_216_581 121
459 3300045049 Ga0466959_0002988 Ga0466959_0002988_4820_5185 121
460 3300045049 Ga0466959_0083616 Ga0466959_0083616_332_697 121
461 3300045049 Ga0466959_0698176 Ga0466959_0698176_96_461 121
462 3300045049 Ga0466959_0785759 Ga0466959_0785759_198_566 121
463 3300045051 Ga0451576_0014014 Ga0451576_0014014_8489_8866 121
464 3300045836 Ga0466958_0241916 Ga0466958_0241916_622_987 121
465 3300045976 Ga0466967_0332903 Ga0466967_0332903_684_1049 121
466 3300045976 Ga0466967_1234914 Ga0466967_1234914_143_508 121
467 3300046454 Ga0495592_0636056 Ga0495592_0636056_121_486 121
468 3300046455 Ga0495603_0153940 Ga0495603_0153940_330_695 121
469 3300046459 Ga0495629_0002586 Ga0495629_0002586_4343_4708 121
470 3300046460 Ga0495638_0094972 Ga0495638_0094972_11_376 121
471 3300046460 Ga0495638_0293832 Ga0495638_0293832_98_463 121
472 3300046460 Ga0495638_0339974 Ga0495638_0339974_151_516 121
473 3300046461 Ga0495641_0222418 Ga0495641_0222418_334_699 121
474 3300046463 Ga0495653_0458474 Ga0495653_0458474_386_751 121
475 3300046473 Ga0495582_0345380 Ga0495582_0345380_333_698 121
476 3300046474 Ga0495605_0036646 Ga0495605_0036646_1688_2053 121
477 3300046491 Ga0495584_0321586 Ga0495584_0321586_331_696 121
478 3300046492 Ga0495585_0132759 Ga0495585_0132759_640_1005 121
479 3300046492 Ga0495585_0593259 Ga0495585_0593259_57_422 121
480 3300046499 Ga0495594_0329073 Ga0495594_0329073_365_730 121
481 3300046501 Ga0495607_0265039 Ga0495607_0265039_391_756 121
482 3300046507 Ga0495606_0359973 Ga0495606_0359973_224_589 121
483 3300046511 Ga0495608_0132808 Ga0495608_0132808_1057_1422 121
484 3300046512 Ga0495610_0041005 Ga0495610_0041005_1741_2106 121
485 3300046514 Ga0495618_0183521 Ga0495618_0183521_530_895 121
486 3300046515 Ga0495620_0101613 Ga0495620_0101613_437_802 121
487 3300046515 Ga0495620_0147040 Ga0495620_0147040_371_736 121
488 3300046516 Ga0495628_0127789 Ga0495628_0127789_154_519 121
489 3300046516 Ga0495628_0516394 Ga0495628_0516394_261_626 121
490 3300046518 Ga0495631_0178471 Ga0495631_0178471_304_669 121
491 3300046519 Ga0495632_0267632 Ga0495632_0267632_177_542 121
492 3300046522 Ga0495643_0014632 Ga0495643_0014632_3010_3375 121
493 3300046522 Ga0495643_0112256 Ga0495643_0112256_965_1330 121
494 3300046524 Ga0495648_0191101 Ga0495648_0191101_87_452 121
495 3300046526 Ga0495666_0446195 Ga0495666_0446195_42_407 121
496 3300046529 Ga0495652_0642276 Ga0495652_0642276_76_441 121
497 3300046530 Ga0495654_0071188 Ga0495654_0071188_627_992 121
498 3300046533 Ga0495640_0038244 Ga0495640_0038244_1738_2103 121
499 3300046538 Ga0495609_0064268 Ga0495609_0064268_702_1067 121
500 3300046542 Ga0495597_0068827 Ga0495597_0068827_595_960 121
501 3300046557 Ga0495622_0145679 Ga0495622_0145679_122_487 121
502 3300046616 Ga0495668_0256370 Ga0495668_0256370_408_773 121
503 3300046648 Ga0495611_0052320 Ga0495611_0052320_952_1317 121
504 3300046660 Ga0495625_0396047 Ga0495625_0396047_371_736 121
505 3300046660 Ga0495625_0830418 Ga0495625_0830418_130_495 121
506 3300046674 Ga0495588_0013855 Ga0495588_0013855_1666_2031 121
507 3300046674 Ga0495588_0258802 Ga0495588_0258802_301_666 121
508 3300046675 Ga0495657_0013301 Ga0495657_0013301_445_810 121
509 3300046680 Ga0495646_0115628 Ga0495646_0115628_513_878 121
510 3300046683 Ga0495658_0213925 Ga0495658_0213925_276_641 121
511 3300046689 Ga0495613_0050253 Ga0495613_0050253_1865_2230 121
512 3300046690 Ga0495624_0043108 Ga0495624_0043108_16_381 121
513 3300046692 Ga0495671_0428953 Ga0495671_0428953_100_465 121
514 3300046694 Ga0495649_0155091 Ga0495649_0155091_349_714 121
515 3300046694 Ga0495649_0382430 Ga0495649_0382430_311_676 121
516 3300046794 Ga0495589_0063125 Ga0495589_0063125_832_1197 121
517 3300046809 Ga0495600_0185527 Ga0495600_0185527_23_388 121
518 3300046810 Ga0495660_0283013 Ga0495660_0283013_219_584 121
519 3300047315 Ga0495581_0106771 Ga0495581_0106771_845_1210 121
520 3300047317 Ga0495604_0061880 Ga0495604_0061880_132_497 121
521 3300047319 Ga0495674_0404264 Ga0495674_0404264_319_684 121
522 3300047320 Ga0495672_0044926 Ga0495672_0044926_218_583 121
523 3300047320 Ga0495672_0090267 Ga0495672_0090267_830_1195 121
524 3300047320 Ga0495672_0228800 Ga0495672_0228800_126_491 121
525 3300047320 Ga0495672_0268228 Ga0495672_0268228_402_770 121
526 3300047321 Ga0495676_0063382 Ga0495676_0063382_1475_1840 121
527 3300047323 Ga0495683_0144990 Ga0495683_0144990_24_389 121
528 3300047443 Ga0495687_083087 Ga0495687_083087_717_1082 121
529 3300047443 Ga0495687_097577 Ga0495687_097577_485_850 121
530 3300047469 Ga0495673_0062574 Ga0495673_0062574_557_922 121
531 3300048088 Ga0495602_0109321 Ga0495602_0109321_401_766 121
532 3300048091 Ga0495626_0170316 Ga0495626_0170316_433_798 121
533 3300048903 Ga0496100_0615052 Ga0496100_0615052_57_422 121
534 3300048904 Ga0496101_0163326 Ga0496101_0163326_122_487 121
535 3300048905 Ga0496102_0074188 Ga0496102_0074188_1618_1983 121
536 3300048905 Ga0496102_0712961 Ga0496102_0712961_461_826 121
537 3300048905 Ga0496102_1042382 Ga0496102_1042382_234_599 121
538 3300048906 Ga0496103_0241856 Ga0496103_0241856_253_618 121
539 3300048906 Ga0496103_0261166 Ga0496103_0261166_187_552 121
540 3300048907 Ga0496104_0001655 Ga0496104_0001655_4526_4891 121
541 3300048907 Ga0496104_0057112 Ga0496104_0057112_1902_2267 121
542 3300048907 Ga0496104_0903684 Ga0496104_0903684_312_677 121
543 3300048908 Ga0496105_0015424 Ga0496105_0015424_5681_6046 121
544 3300048909 Ga0496106_0094426 Ga0496106_0094426_1515_1880 121
545 3300048911 Ga0496108_0505547 Ga0496108_0505547_388_753 121
546 3300048912 Ga0496109_0754511 Ga0496109_0754511_316_681 121
547 3300048912 Ga0496109_1859875 Ga0496109_1859875_11_376 121
548 3300048913 Ga0496110_0157888 Ga0496110_0157888_1205_1570 121
549 3300048913 Ga0496110_0880568 Ga0496110_0880568_273_638 121
550 3300048913 Ga0496110_1558871 Ga0496110_1558871_171_536 121
551 3300048914 Ga0496111_0711005 Ga0496111_0711005_176_541 121
552 3300048914 Ga0496111_1031510 Ga0496111_1031510_119_484 121
553 3300048915 Ga0496112_0064774 Ga0496112_0064774_1163_1528 121
554 3300048915 Ga0496112_0390349 Ga0496112_0390349_101_466 121
555 3300048916 Ga0496113_0119847 Ga0496113_0119847_64_429 121
556 3300048916 Ga0496113_0179175 Ga0496113_0179175_1174_1539 121
557 3300048916 Ga0496113_0347813 Ga0496113_0347813_598_963 121
558 3300048917 Ga0496114_0392099 Ga0496114_0392099_564_929 121
559 3300048917 Ga0496114_0769788 Ga0496114_0769788_94_459 121
560 3300048918 Ga0496115_0059021 Ga0496115_0059021_342_707 121
561 3300048918 Ga0496115_0154337 Ga0496115_0154337_820_1185 121
562 3300048919 Ga0496116_0009012 Ga0496116_0009012_5936_6301 121
563 3300048919 Ga0496116_0053528 Ga0496116_0053528_10_375 121
564 3300048920 Ga0496117_0014560 Ga0496117_0014560_2846_3211 121
565 3300048920 Ga0496117_0243084 Ga0496117_0243084_113_478 121
566 3300048920 Ga0496117_0418051 Ga0496117_0418051_282_647 121
567 3300048921 Ga0496118_0024327 Ga0496118_0024327_599_964 121
568 3300048921 Ga0496118_0025294 Ga0496118_0025294_1139_1504 121
569 3300048921 Ga0496118_0087742 Ga0496118_0087742_1108_1473 121
570 3300048921 Ga0496118_0222622 Ga0496118_0222622_214_579 121
571 3300048922 Ga0496119_0011533 Ga0496119_0011533_6114_6479 121
572 3300048922 Ga0496119_0016058 Ga0496119_0016058_921_1286 121
573 3300048922 Ga0496119_0342863 Ga0496119_0342863_38_403 121
574 3300048922 Ga0496119_0360104 Ga0496119_0360104_134_499 121
575 3300048922 Ga0496119_0388918 Ga0496119_0388918_54_419 121
576 3300048923 Ga0496120_0003849 Ga0496120_0003849_5723_6088 121
577 3300048923 Ga0496120_0173894 Ga0496120_0173894_98_463 121
578 3300048924 Ga0496121_0000152 Ga0496121_0000152_80419_80784 121
579 3300048924 Ga0496121_0013561 Ga0496121_0013561_5010_5375 121
580 3300048924 Ga0496121_0014668 Ga0496121_0014668_1905_2270 121
581 3300048924 Ga0496121_0026715 Ga0496121_0026715_4769_5134 121
582 3300048924 Ga0496121_0043563 Ga0496121_0043563_1047_1412 121
583 3300048924 Ga0496121_0049950 Ga0496121_0049950_24_389 121
584 3300048924 Ga0496121_0121794 Ga0496121_0121794_1310_1675 121
585 3300048925 Ga0496122_0047803 Ga0496122_0047803_1656_2021 121
586 3300048925 Ga0496122_0297606 Ga0496122_0297606_303_668 121
587 3300048925 Ga0496122_0314650 Ga0496122_0314650_174_539 121
588 3300048926 Ga0496123_0084176 Ga0496123_0084176_47_412 121
589 3300048927 Ga0496124_0371906 Ga0496124_0371906_165_530 121
590 3300048927 Ga0496124_0576293 Ga0496124_0576293_97_462 121
591 3300048927 Ga0496124_0934270 Ga0496124_0934270_108_473 121
592 3300048928 Ga0496125_0016187 Ga0496125_0016187_4836_5201 121
593 3300048929 Ga0496126_0002980 Ga0496126_0002980_14205_14570 121
594 3300048929 Ga0496126_0016467 Ga0496126_0016467_5172_5537 121
595 3300048929 Ga0496126_0026746 Ga0496126_0026746_2398_2763 121
596 3300048929 Ga0496126_0030510 Ga0496126_0030510_3078_3443 121
597 3300048929 Ga0496126_0076527 Ga0496126_0076527_1392_1757 121
598 3300048929 Ga0496126_0142002 Ga0496126_0142002_487_852 121
599 3300048929 Ga0496126_0173888 Ga0496126_0173888_1195_1560 121
600 3300048929 Ga0496126_0182774 Ga0496126_0182774_1303_1668 121
601 3300048929 Ga0496126_0194501 Ga0496126_0194501_747_1112 121
602 3300048929 Ga0496126_0422071 Ga0496126_0422071_187_552 121
603 3300048929 Ga0496126_0470127 Ga0496126_0470127_174_539 121
604 3300049459 Ga0495678_089501 Ga0495678_089501_473_838 121
605 3300049460 Ga0495682_0127700 Ga0495682_0127700_33_398 121
606 3300049568 Ga0501031_0001041 Ga0501031_0001041_1721_2086 121
607 3300049569 Ga0501032_0000040 Ga0501032_0000040_70175_70540 121
608 3300049570 Ga0501033_0000128 Ga0501033_0000128_67469_67834 121
609 3300049570 Ga0501033_0187684 Ga0501033_0187684_388_753 121
610 3300049571 Ga0501034_0000254 Ga0501034_0000254_33035_33400 121
611 3300049572 Ga0501036_0000375 Ga0501036_0000375_5586_5951 121
612 3300049572 Ga0501036_0239652 Ga0501036_0239652_1014_1379 121
613 3300049573 Ga0501037_0000041 Ga0501037_0000041_70075_70440 121
614 3300049574 Ga0501038_0000057 Ga0501038_0000057_41483_41848 121
615 3300049575 Ga0501039_0000084 Ga0501039_0000084_44208_44573 121
616 3300049579 Ga0501043_0000184 Ga0501043_0000184_38927_39292 121
617 3300049579 Ga0501043_0186112 Ga0501043_0186112_532_897 121
618 3300049579 Ga0501043_0439183 Ga0501043_0439183_51_416 121
619 3300049580 Ga0501046_0000072 Ga0501046_0000072_35844_36209 121
620 3300049581 Ga0501047_0000044 Ga0501047_0000044_70157_70522 121
621 3300049581 Ga0501047_0009182 Ga0501047_0009182_5324_5689 121
622 3300049581 Ga0501047_0017239 Ga0501047_0017239_1068_1433 121
623 3300049581 Ga0501047_0047785 Ga0501047_0047785_3550_3915 121
624 3300049582 Ga0501048_0000295 Ga0501048_0000295_9016_9381 121
625 3300049583 Ga0501067_0039211 Ga0501067_0039211_441_806 121
626 3300049583 Ga0501067_0154729 Ga0501067_0154729_828_1193 121
627 3300049584 Ga0501068_0000113 Ga0501068_0000113_4714_5079 121
628 3300049585 Ga0501069_0021434 Ga0501069_0021434_930_1295 121
629 3300049585 Ga0501069_0211197 Ga0501069_0211197_371_736 121
630 3300049586 Ga0501070_0000310 Ga0501070_0000310_18302_18667 121
631 3300049586 Ga0501070_0021229 Ga0501070_0021229_552_917 121
632 3300049586 Ga0501070_0885236 Ga0501070_0885236_256_621 121
633 3300049586 Ga0501070_1392272 Ga0501070_1392272_147_512 121
634 3300049587 Ga0501071_0278852 Ga0501071_0278852_279_644 121
635 3300049588 Ga0501072_0000156 Ga0501072_0000156_47860_48225 121
636 3300049589 Ga0501073_0000043 Ga0501073_0000043_22965_23330 121
637 3300049589 Ga0501073_0185555 Ga0501073_0185555_418_783 121
638 3300049590 Ga0501074_0000035 Ga0501074_0000035_6063_6428 121
639 3300049590 Ga0501074_0156084 Ga0501074_0156084_641_1006 121
640 3300049741 Ga0501079_0000839 Ga0501079_0000839_9002_9367 121
641 3300049742 Ga0501080_0000600 Ga0501080_0000600_3594_3959 121
642 3300049742 Ga0501080_0099770 Ga0501080_0099770_959_1324 121
643 3300049744 Ga0501083_0223232 Ga0501083_0223232_114_479 121
644 3300049822 Ga0501035_0000128 Ga0501035_0000128_34159_34524 121
645 3300049822 Ga0501035_0225361 Ga0501035_0225361_534_899 121
646 3300049822 Ga0501035_1208039 Ga0501035_1208039_116_481 121
647 3300049823 Ga0501044_0000108 Ga0501044_0000108_3378_3743 121
648 3300049823 Ga0501044_0323740 Ga0501044_0323740_417_782 121
649 3300050489 nmdc:mga03683_146362_c1 nmdc:mga03683_146362_c1_242_607 121
650 3300050489 nmdc:mga03683_223452_c1 nmdc:mga03683_223452_c1_447_812 121
651 3300050490 nmdc:mga03n38_190319_c1 nmdc:mga03n38_190319_c1_24_389 121
652 3300050491 nmdc:mga00v17_438966_c1 nmdc:mga00v17_438966_c1_170_535 121
653 3300050491 nmdc:mga00v17_77157_c1 nmdc:mga00v17_77157_c1_578_943 121
654 3300050492 nmdc:mga0yw44_3454_c1 nmdc:mga0yw44_3454_c1_4460_4825 121
655 3300050492 nmdc:mga0yw44_528656_c1 nmdc:mga0yw44_528656_c1_248_613 121
656 3300050493 nmdc:mga0k408_11705_c1 nmdc:mga0k408_11705_c1_439_804 121
657 3300050494 nmdc:mga06z11_149191_c1 nmdc:mga06z11_149191_c1_518_883 121
658 3300050494 nmdc:mga06z11_244146_c1 nmdc:mga06z11_244146_c1_317_682 121
659 3300050494 nmdc:mga06z11_520846_c1 nmdc:mga06z11_520846_c1_266_631 121
660 3300050495 nmdc:mga04h51_50221_c1 nmdc:mga04h51_50221_c1_234_599 121
661 3300050496 nmdc:mga07m45_174323_c1 nmdc:mga07m45_174323_c1_662_1030 121
662 3300050496 nmdc:mga07m45_506363_c1 nmdc:mga07m45_506363_c1_83_448 121
663 3300050496 nmdc:mga07m45_63911_c1 nmdc:mga07m45_63911_c1_615_980 121
664 3300050514 nmdc:mga08x19_425231_c1 nmdc:mga08x19_425231_c1_44_409 121
665 3300050516 nmdc:mga0sz30_107435_c1 nmdc:mga0sz30_107435_c1_515_880 121
666 3300050516 nmdc:mga0sz30_237724_c1 nmdc:mga0sz30_237724_c1_98_463 121
667 3300050516 nmdc:mga0sz30_48827_c1 nmdc:mga0sz30_48827_c1_24_389 121
668 3300053085 Ga0495619_0412108 Ga0495619_0412108_473_838 121
669 3300053086 Ga0500578_0186870 Ga0500578_0186870_764_1129 121
670 3300053087 Ga0500643_000095 Ga0500643_000095_55612_55977 121
671 3300053088 Ga0500644_0283517 Ga0500644_0283517_210_575 121
672 3300053093 Ga0500651_0001437 Ga0500651_0001437_6384_6749 121
673 3300053093 Ga0500651_0211368 Ga0500651_0211368_644_1009 121
674 3300053094 Ga0500566_0000123 Ga0500566_0000123_13900_14265 121
675 3300053095 Ga0500640_202490 Ga0500640_202490_196_561 121
676 3300053096 Ga0500641_0108970 Ga0500641_0108970_701_1066 121
677 3300053096 Ga0500641_0372331 Ga0500641_0372331_123_491 121
678 3300053098 Ga0500650_0087519 Ga0500650_0087519_429_794 121
679 3300053102 Ga0500554_138171 Ga0500554_138171_35_400 121
680 3300053103 Ga0500555_004703 Ga0500555_004703_3145_3510 121
681 3300053104 Ga0500556_0048984 Ga0500556_0048984_777_1142 121
682 3300053105 Ga0500557_000036 Ga0500557_000036_51442_51807 121
683 3300053108 Ga0500562_034684 Ga0500562_034684_387_752 121
684 3300053109 Ga0500569_003011 Ga0500569_003011_759_1124 121
685 3300053109 Ga0500569_267237 Ga0500569_267237_52_417 121
686 3300053111 Ga0500572_019168 Ga0500572_019168_1343_1708 121
687 3300053116 Ga0500592_025841 Ga0500592_025841_370_735 121
688 3300053116 Ga0500592_030759 Ga0500592_030759_321_686 121
689 3300053117 Ga0500593_000585 Ga0500593_000585_10070_10438 121
690 3300053118 Ga0500594_0223209 Ga0500594_0223209_101_466 121
691 3300053119 Ga0500595_000839 Ga0500595_000839_3715_4080 121
692 3300053119 Ga0500595_001859 Ga0500595_001859_1170_1535 121
693 3300053119 Ga0500595_014588 Ga0500595_014588_1343_1708 121
694 3300053119 Ga0500595_029117 Ga0500595_029117_433_798 121
695 3300053119 Ga0500595_044588 Ga0500595_044588_984_1349 121
696 3300053119 Ga0500595_088852 Ga0500595_088852_335_700 121
697 3300053121 Ga0500607_055382 Ga0500607_055382_663_1028 121
698 3300053122 Ga0500608_019066 Ga0500608_019066_196_561 121
699 3300053130 Ga0500642_0000103 Ga0500642_0000103_16427_16792 121
700 3300053130 Ga0500642_0037896 Ga0500642_0037896_1590_1955 121
701 3300053130 Ga0500642_0088219 Ga0500642_0088219_524_889 121
702 3300053131 Ga0500652_140334 Ga0500652_140334_630_995 121
703 3300053131 Ga0500652_310827 Ga0500652_310827_224_589 121
704 3300053134 Ga0500658_0040012 Ga0500658_0040012_1401_1766 121
705 3300053136 Ga0500559_0002826 Ga0500559_0002826_1468_1833 121
706 3300053136 Ga0500559_0030423 Ga0500559_0030423_1887_2252 121
707 3300053139 Ga0500568_0008926 Ga0500568_0008926_3594_3959 121
708 3300053139 Ga0500568_0041288 Ga0500568_0041288_964_1329 121
709 3300053139 Ga0500568_0059411 Ga0500568_0059411_846_1211 121
710 3300053139 Ga0500568_0074207 Ga0500568_0074207_474_839 121
711 3300053139 Ga0500568_0260100 Ga0500568_0260100_127_492 121
712 3300053142 Ga0500577_0317831 Ga0500577_0317831_200_565 121
713 3300053146 Ga0500588_0179590 Ga0500588_0179590_269_634 121
714 3300053148 Ga0500590_126829 Ga0500590_126829_85_450 121
715 3300053153 Ga0500616_0017085 Ga0500616_0017085_3209_3574 121
716 3300053153 Ga0500616_0297568 Ga0500616_0297568_285_650 121
717 3300053154 Ga0500619_019397 Ga0500619_019397_660_1025 121
718 3300053155 Ga0500620_036935 Ga0500620_036935_933_1298 121
719 3300053156 Ga0500622_0012724 Ga0500622_0012724_2978_3343 121
720 3300053156 Ga0500622_0020063 Ga0500622_0020063_1538_1903 121
721 3300053158 Ga0500627_0361680 Ga0500627_0361680_25_390 121
722 3300053162 Ga0500638_118669 Ga0500638_118669_658_1023 121
723 3300053162 Ga0500638_139954 Ga0500638_139954_477_842 121
724 3300053177 Ga0500636_0002571 Ga0500636_0002571_8655_9020 121
725 3300053177 Ga0500636_0005712 Ga0500636_0005712_6096_6461 121
726 3300053178 Ga0500637_0073623 Ga0500637_0073623_1456_1821 121
727 3300053724 Ga0500570_066843 Ga0500570_066843_92_457 121
728 3300053729 Ga0500625_000325 Ga0500625_000325_8829_9194 121
729 3300053731 Ga0500609_001599 Ga0500609_001599_1248_1613 121
730 3300053736 Ga0500599_007228 Ga0500599_007228_1001_1366 121
731 3300053737 Ga0500601_000445 Ga0500601_000445_4844_5209 121
732 3300053737 Ga0500601_035212 Ga0500601_035212_208_573 121
733 3300054114 Ga0501084_0025559 Ga0501084_0025559_2885_3250 121
734 3300055283 Ga0500661_011309 Ga0500661_011309_664_1029 121
735 3300061719 Ga0466962_0132351 Ga0466962_0132351_15_380 121
736 3300061719 Ga0466962_0157047 Ga0466962_0157047_363_728 121

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

4

116

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h60-assembly1.cif.gz_A high resolution structure of vibrio cholerae chemotaxis protein chey4 crystallized in low ph (4.0) condition 0.973 1 118
4hnr-assembly1.cif.gz_A high resolution structure of chemotaxis response regulator chey4 of vibrio cholerae 0.9701 1 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9699 1 120
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9674 3 120
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9672 3 120
ID Description Score Start End Superfamily
af_P9WGN1_2_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9714 3 82 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9701 1 82 3.40.50.2300
4hnrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9701 1 118 3.40.50.2300
af_Q5A4X5_425_557_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.969 4 118 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9655 1 120 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7V8ITQ6-F1-model_v4 deleted 0.9912 2 119
AF-A7BZ01-F1-model_v4 deleted 0.9893 1 120
AF-B7RJ06-F1-model_v4 Chemotaxis response regulator, CheY4 0.9883 1 121 GO:0000160
AF-A0A545TIN6-F1-model_v4 Response regulator 0.9878 1 120 GO:0000160
AF-A0A2E0FLD5-F1-model_v4 Response regulatory domain-containing protein 0.9873 2 120 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
88.3 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map