F478263
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 736 | 385 | 735 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300013102|Ga0157371_10541086|Ga0157371_105410861 |
| Length | 148 |
| Sequence | MATILTVDDSPSIRQMIKVVLGPAGHNVLEASDGAQGLEAAKSAKPDLVITDLNMPVMNGMELIKALRKQPSLVGLPIVFLTTESNDATKQEAKAAGATGWITKPFKPEQLLAVVSKLVRTCRHWIRLMSSDRKQASSSKFSKGPCWI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2786546940 | Opitutaceae bacterium EW11 | Isolate | Unclassified |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 9 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 37 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 38 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 39 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 40 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 41 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 42 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 43 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 44 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 45 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 46 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 47 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 58 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 59 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 68 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 69 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 98 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 101 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 102 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 161 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 162 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 163 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 165 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 172 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 174 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 175 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 184 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 185 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 197 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 198 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 199 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 200 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 201 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 202 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 203 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 204 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 205 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 206 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 207 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 208 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 211 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 285 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 286 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 287 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 288 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 289 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 290 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 291 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 292 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 293 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 294 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 295 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 296 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 297 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 298 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 299 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 300 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 301 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 330 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 331 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 332 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 333 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 334 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 335 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 336 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 337 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 341 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 342 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 343 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 344 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 346 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 347 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 348 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 349 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 350 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 351 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 352 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 353 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 354 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 355 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 356 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 357 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 358 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 359 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 360 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 361 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 362 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 363 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 364 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 365 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 367 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 368 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 369 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 370 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 371 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 372 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 373 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 374 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 375 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 376 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 377 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 378 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 379 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 380 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 381 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 382 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 384 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.52 |
| Nodule | 1.22 |
| Rhizoplane | 3.94 |
| Rhizosphere | 65.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1063606 | 3300001904 | Bacteria | 572 |
| 2 | JGI24739J22299_10100083 | 3300001989 | Bacteria | 875 |
| 3 | JGI24737J22298_10135173 | 3300001990 | Bacteria | 728 |
| 4 | JGI24735J21928_10147995 | 3300002067 | Bacteria | 678 |
| 5 | JGI25153J46596_10000633 | 3300003215 | Bacteria | 21490 |
| 6 | JGI25153J46596_10000651 | 3300003215 | Bacteria | 21219 |
| 7 | JGI25153J46596_10006525 | 3300003215 | Bacteria | 5888 |
| 8 | JGI25153J46596_10011915 | 3300003215 | Bacteria | 3805 |
| 9 | JGI25153J46596_10037547 | 3300003215 | Bacteria | 1538 |
| 10 | JGI25153J46596_10089491 | 3300003215 | Bacteria | 747 |
| 11 | rootH1_10201646 | 3300003323 | Bacteria | 1334 |
| 12 | JGI25160J50197_1056197 | 3300003354 | Bacteria | 807 |
| 13 | Ga0055526_1036046 | 3300003771 | Bacteria | 1320 |
| 14 | Ga0055524_1007998 | 3300003775 | Bacteria | 4435 |
| 15 | Ga0055524_1059930 | 3300003775 | Bacteria | 796 |
| 16 | Ga0055531_10005412 | 3300003794 | Bacteria | 7481 |
| 17 | Ga0065165_1000054 | 3300005262 | Bacteria | 187351 |
| 18 | Ga0065165_1001857 | 3300005262 | Bacteria | 20523 |
| 19 | Ga0065165_1002497 | 3300005262 | Bacteria | 15404 |
| 20 | Ga0065165_1061509 | 3300005262 | Bacteria | 1027 |
| 21 | Ga0070683_100038089 | 3300005329 | Bacteria | 4405 |
| 22 | Ga0070683_100057527 | 3300005329 | Bacteria | 3612 |
| 23 | Ga0070683_100765555 | 3300005329 | Bacteria | 925 |
| 24 | Ga0070670_101423776 | 3300005331 | Bacteria | 636 |
| 25 | Ga0070680_100094782 | 3300005336 | Bacteria | 2474 |
| 26 | Ga0070682_101804299 | 3300005337 | Bacteria | 534 |
| 27 | Ga0068868_100357737 | 3300005338 | Bacteria | 1252 |
| 28 | Ga0070660_100294597 | 3300005339 | Bacteria | 1329 |
| 29 | Ga0070660_101761265 | 3300005339 | Bacteria | 528 |
| 30 | Ga0070691_10030518 | 3300005341 | Bacteria | 2525 |
| 31 | Ga0070671_100289106 | 3300005355 | Bacteria | 1395 |
| 32 | Ga0070667_100930754 | 3300005367 | Bacteria | 810 |
| 33 | Ga0070709_10001267 | 3300005434 | Bacteria | 13836 |
| 34 | Ga0070709_11017313 | 3300005434 | Bacteria | 660 |
| 35 | Ga0070714_100135360 | 3300005435 | Bacteria | 2206 |
| 36 | Ga0070714_100213431 | 3300005435 | Bacteria | 1770 |
| 37 | Ga0070713_100006642 | 3300005436 | Bacteria | 8044 |
| 38 | Ga0070710_10001610 | 3300005437 | Bacteria | 10663 |
| 39 | Ga0070711_100002880 | 3300005439 | Bacteria | 9907 |
| 40 | Ga0070663_100063537 | 3300005455 | Bacteria | 2666 |
| 41 | Ga0070663_100666177 | 3300005455 | Bacteria | 881 |
| 42 | Ga0070681_10229924 | 3300005458 | Bacteria | 1769 |
| 43 | Ga0070681_11349987 | 3300005458 | Bacteria | 636 |
| 44 | Ga0070679_100195528 | 3300005530 | Bacteria | 1990 |
| 45 | Ga0070679_100214870 | 3300005530 | Bacteria | 1886 |
| 46 | Ga0070679_101845899 | 3300005530 | Bacteria | 553 |
| 47 | Ga0070684_100032985 | 3300005535 | Bacteria | 4418 |
| 48 | Ga0070684_100610185 | 3300005535 | Bacteria | 1015 |
| 49 | Ga0068853_100295866 | 3300005539 | Bacteria | 1495 |
| 50 | Ga0068853_100469902 | 3300005539 | Bacteria | 1185 |
| 51 | Ga0068853_100516200 | 3300005539 | Bacteria | 1129 |
| 52 | Ga0068853_100794613 | 3300005539 | Bacteria | 906 |
| 53 | Ga0068853_101628346 | 3300005539 | Bacteria | 626 |
| 54 | Ga0068855_100080309 | 3300005563 | Bacteria | 3782 |
| 55 | Ga0068855_101935132 | 3300005563 | Bacteria | 597 |
| 56 | Ga0070664_100705062 | 3300005564 | Bacteria | 940 |
| 57 | Ga0068857_100265926 | 3300005577 | Bacteria | 1575 |
| 58 | Ga0068857_100444308 | 3300005577 | Bacteria | 1212 |
| 59 | Ga0068857_100732826 | 3300005577 | Bacteria | 941 |
| 60 | Ga0068854_100328560 | 3300005578 | Bacteria | 1245 |
| 61 | Ga0068856_100375959 | 3300005614 | Bacteria | 1440 |
| 62 | Ga0068856_101597303 | 3300005614 | Bacteria | 665 |
| 63 | Ga0068852_100001747 | 3300005616 | Bacteria | 14801 |
| 64 | Ga0068859_100108929 | 3300005617 | Bacteria | 2831 |
| 65 | Ga0068864_100000060 | 3300005618 | Bacteria | 124506 |
| 66 | Ga0068864_100208399 | 3300005618 | Bacteria | 1799 |
| 67 | Ga0068864_100398976 | 3300005618 | Bacteria | 1307 |
| 68 | Ga0068851_10183858 | 3300005834 | Bacteria | 1159 |
| 69 | Ga0068870_10512580 | 3300005840 | Bacteria | 801 |
| 70 | Ga0068863_100000023 | 3300005841 | Bacteria | 186490 |
| 71 | Ga0068863_100182757 | 3300005841 | Bacteria | 2013 |
| 72 | Ga0068863_100216415 | 3300005841 | Bacteria | 1845 |
| 73 | Ga0068858_100011301 | 3300005842 | Bacteria | 8435 |
| 74 | Ga0068860_100608105 | 3300005843 | Bacteria | 1099 |
| 75 | Ga0068860_100626215 | 3300005843 | Bacteria | 1083 |
| 76 | Ga0068860_101235463 | 3300005843 | Bacteria | 768 |
| 77 | Ga0068862_100966501 | 3300005844 | Bacteria | 841 |
| 78 | Ga0081455_10106377 | 3300005937 | Bacteria | 2239 |
| 79 | Ga0081540_1048867 | 3300005983 | Bacteria | 2115 |
| 80 | Ga0070717_10128448 | 3300006028 | Bacteria | 2178 |
| 81 | Ga0070717_10238080 | 3300006028 | Bacteria | 1604 |
| 82 | Ga0075365_10012541 | 3300006038 | Bacteria | 5038 |
| 83 | Ga0075365_10039785 | 3300006038 | Bacteria | 3063 |
| 84 | Ga0075365_10100286 | 3300006038 | Bacteria | 1982 |
| 85 | Ga0075368_10283293 | 3300006042 | Bacteria | 712 |
| 86 | Ga0075363_100019810 | 3300006048 | Bacteria | 3368 |
| 87 | Ga0075363_100373654 | 3300006048 | Bacteria | 835 |
| 88 | Ga0075363_101003995 | 3300006048 | Bacteria | 514 |
| 89 | Ga0075364_10523514 | 3300006051 | Bacteria | 811 |
| 90 | Ga0070715_10569651 | 3300006163 | Bacteria | 659 |
| 91 | Ga0070716_100001907 | 3300006173 | Bacteria | 9470 |
| 92 | Ga0070712_100022694 | 3300006175 | Bacteria | 4137 |
| 93 | Ga0075362_10060294 | 3300006177 | Bacteria | 1715 |
| 94 | Ga0075362_10183579 | 3300006177 | Bacteria | 1014 |
| 95 | Ga0075362_10598125 | 3300006177 | Bacteria | 570 |
| 96 | Ga0075367_10096852 | 3300006178 | Bacteria | 1799 |
| 97 | Ga0075367_10099824 | 3300006178 | Bacteria | 1773 |
| 98 | Ga0075367_10127753 | 3300006178 | Bacteria | 1570 |
| 99 | Ga0075367_10972276 | 3300006178 | Bacteria | 542 |
| 100 | Ga0075369_10100669 | 3300006186 | Bacteria | 1296 |
| 101 | Ga0075369_10120731 | 3300006186 | Bacteria | 1186 |
| 102 | Ga0075366_10008786 | 3300006195 | Bacteria | 5626 |
| 103 | Ga0097621_101899187 | 3300006237 | Bacteria | 568 |
| 104 | Ga0075370_10047941 | 3300006353 | Bacteria | 2420 |
| 105 | Ga0075370_10133086 | 3300006353 | Bacteria | 1451 |
| 106 | Ga0068871_100635702 | 3300006358 | Bacteria | 973 |
| 107 | Ga0075433_11578652 | 3300006852 | Unclassified | 566 |
| 108 | Ga0075434_100248208 | 3300006871 | Bacteria | 1799 |
| 109 | Ga0075436_100889635 | 3300006914 | Bacteria | 666 |
| 110 | Ga0097620_100108929 | 3300006931 | Bacteria | 2831 |
| 111 | Ga0099824_1024667 | 3300006942 | Bacteria | 3458 |
| 112 | Ga0099823_1070945 | 3300006944 | Bacteria | 1547 |
| 113 | Ga0105251_10063426 | 3300009011 | Bacteria | 1734 |
| 114 | Ga0105251_10210083 | 3300009011 | Bacteria | 876 |
| 115 | Ga0105244_10397525 | 3300009036 | Bacteria | 634 |
| 116 | Ga0105250_10012457 | 3300009092 | Bacteria | 3510 |
| 117 | Ga0105240_10008853 | 3300009093 | Bacteria | 14333 |
| 118 | Ga0105240_10020641 | 3300009093 | Bacteria | 8781 |
| 119 | Ga0105240_10164739 | 3300009093 | Bacteria | 2630 |
| 120 | Ga0105240_10465050 | 3300009093 | Bacteria | 1412 |
| 121 | Ga0105240_11113435 | 3300009093 | Bacteria | 840 |
| 122 | Ga0105245_10336467 | 3300009098 | Bacteria | 1491 |
| 123 | Ga0105245_10877220 | 3300009098 | Bacteria | 938 |
| 124 | Ga0105247_10122059 | 3300009101 | Bacteria | 1689 |
| 125 | Ga0105247_10396142 | 3300009101 | Bacteria | 982 |
| 126 | Ga0105247_10803452 | 3300009101 | Bacteria | 718 |
| 127 | Ga0105247_10937133 | 3300009101 | Bacteria | 671 |
| 128 | Ga0105243_10139868 | 3300009148 | Bacteria | 2064 |
| 129 | Ga0105243_10917821 | 3300009148 | Bacteria | 872 |
| 130 | Ga0105241_11457722 | 3300009174 | Bacteria | 657 |
| 131 | Ga0105242_10949479 | 3300009176 | Bacteria | 864 |
| 132 | Ga0105248_10001464 | 3300009177 | Bacteria | 26304 |
| 133 | Ga0105248_10800750 | 3300009177 | Bacteria | 1064 |
| 134 | Ga0105248_10860246 | 3300009177 | Bacteria | 1024 |
| 135 | Ga0105248_12313384 | 3300009177 | Bacteria | 612 |
| 136 | Ga0105237_10014235 | 3300009545 | Bacteria | 8329 |
| 137 | Ga0105237_10042891 | 3300009545 | Bacteria | 4559 |
| 138 | Ga0105237_10139035 | 3300009545 | Bacteria | 2423 |
| 139 | Ga0105237_10265701 | 3300009545 | Bacteria | 1719 |
| 140 | Ga0105237_10644094 | 3300009545 | Bacteria | 1066 |
| 141 | Ga0105237_11725061 | 3300009545 | Bacteria | 634 |
| 142 | Ga0105238_10063440 | 3300009551 | Bacteria | 3695 |
| 143 | Ga0105238_10374439 | 3300009551 | Bacteria | 1415 |
| 144 | Ga0105238_10712014 | 3300009551 | Bacteria | 1016 |
| 145 | Ga0105238_10791518 | 3300009551 | Bacteria | 963 |
| 146 | Ga0105238_11255130 | 3300009551 | Bacteria | 766 |
| 147 | Ga0105249_10339575 | 3300009553 | Bacteria | 1518 |
| 148 | Ga0105239_10039622 | 3300010375 | Bacteria | 5161 |
| 149 | Ga0105239_10079622 | 3300010375 | Bacteria | 3605 |
| 150 | Ga0105239_10079805 | 3300010375 | Bacteria | 3601 |
| 151 | Ga0105239_13536518 | 3300010375 | Bacteria | 508 |
| 152 | Ga0105246_10015578 | 3300011119 | Bacteria | 4804 |
| 153 | Ga0157373_10307542 | 3300013100 | Bacteria | 1126 |
| 154 | Ga0157371_10541086 | 3300013102 | Bacteria | 863 |
| 155 | Ga0157371_11115882 | 3300013102 | Bacteria | 605 |
| 156 | Ga0157370_10050197 | 3300013104 | Bacteria | 3988 |
| 157 | Ga0157370_11160226 | 3300013104 | Bacteria | 697 |
| 158 | Ga0157369_10007758 | 3300013105 | Bacteria | 12344 |
| 159 | Ga0157369_10009352 | 3300013105 | Bacteria | 11208 |
| 160 | Ga0157369_10484841 | 3300013105 | Bacteria | 1279 |
| 161 | Ga0157369_10729188 | 3300013105 | Bacteria | 1020 |
| 162 | Ga0157374_10457643 | 3300013296 | Bacteria | 1278 |
| 163 | Ga0157374_10885120 | 3300013296 | Bacteria | 910 |
| 164 | Ga0157378_10433232 | 3300013297 | Bacteria | 1302 |
| 165 | Ga0163162_10165287 | 3300013306 | Bacteria | 2336 |
| 166 | Ga0157372_10213404 | 3300013307 | Bacteria | 2237 |
| 167 | Ga0157372_10476886 | 3300013307 | Bacteria | 1454 |
| 168 | Ga0157375_10136536 | 3300013308 | Bacteria | 2577 |
| 169 | Ga0163163_10071930 | 3300014325 | Bacteria | 3447 |
| 170 | Ga0163163_10536565 | 3300014325 | Bacteria | 1232 |
| 171 | Ga0163163_10975280 | 3300014325 | Bacteria | 911 |
| 172 | Ga0182008_10855741 | 3300014497 | Bacteria | 532 |
| 173 | Ga0157379_10058879 | 3300014968 | Bacteria | 3435 |
| 174 | Ga0157379_10603277 | 3300014968 | Bacteria | 1025 |
| 175 | Ga0157379_11221694 | 3300014968 | Bacteria | 723 |
| 176 | Ga0157379_12117066 | 3300014968 | Bacteria | 558 |
| 177 | Ga0157376_10096295 | 3300014969 | Bacteria | 2575 |
| 178 | Ga0213873_10010521 | 3300021358 | Bacteria | 1953 |
| 179 | Ga0213872_10004165 | 3300021361 | Bacteria | 7775 |
| 180 | Ga0213872_10031833 | 3300021361 | Bacteria | 2417 |
| 181 | Ga0213872_10370683 | 3300021361 | Bacteria | 584 |
| 182 | Ga0213876_10065160 | 3300021384 | Bacteria | 1923 |
| 183 | Ga0213876_10103445 | 3300021384 | Bacteria | 1510 |
| 184 | Ga0213875_10119834 | 3300021388 | Bacteria | 1229 |
| 185 | Ga0213875_10122984 | 3300021388 | Bacteria | 1213 |
| 186 | Ga0213871_10007632 | 3300021441 | Bacteria | 2350 |
| 187 | Ga0207425_1010576 | 3300025245 | Bacteria | 2239 |
| 188 | Ga0209148_1000421 | 3300025254 | Bacteria | 47524 |
| 189 | Ga0209148_1016562 | 3300025254 | Bacteria | 1266 |
| 190 | Ga0209148_1043097 | 3300025254 | Bacteria | 615 |
| 191 | Ga0209233_1002484 | 3300025261 | Bacteria | 6755 |
| 192 | Ga0209233_1002615 | 3300025261 | Bacteria | 6539 |
| 193 | Ga0209233_1017000 | 3300025261 | Bacteria | 1990 |
| 194 | Ga0209455_1007536 | 3300025272 | Bacteria | 3062 |
| 195 | Ga0209130_1081120 | 3300025284 | Bacteria | 522 |
| 196 | Ga0209564_1000044 | 3300025295 | Bacteria | 381017 |
| 197 | Ga0209564_1004705 | 3300025295 | Bacteria | 8182 |
| 198 | Ga0209564_1014807 | 3300025295 | Bacteria | 3216 |
| 199 | Ga0209758_1000117 | 3300025297 | Bacteria | 198325 |
| 200 | Ga0209758_1000506 | 3300025297 | Bacteria | 63135 |
| 201 | Ga0209758_1001068 | 3300025297 | Bacteria | 35664 |
| 202 | Ga0209758_1001793 | 3300025297 | Bacteria | 23709 |
| 203 | Ga0209758_1003491 | 3300025297 | Bacteria | 14222 |
| 204 | Ga0209758_1007058 | 3300025297 | Bacteria | 7792 |
| 205 | Ga0209050_1070340 | 3300025298 | Bacteria | 784 |
| 206 | Ga0209256_1000740 | 3300025299 | Bacteria | 42806 |
| 207 | Ga0209256_1007255 | 3300025299 | Bacteria | 5533 |
| 208 | Ga0209256_1008199 | 3300025299 | Bacteria | 4906 |
| 209 | Ga0207426_1000467 | 3300025302 | Bacteria | 62488 |
| 210 | Ga0207426_1000508 | 3300025302 | Bacteria | 57035 |
| 211 | Ga0207426_1006582 | 3300025302 | Bacteria | 5014 |
| 212 | Ga0207426_1023419 | 3300025302 | Bacteria | 2107 |
| 213 | Ga0207426_1075361 | 3300025302 | Bacteria | 929 |
| 214 | Ga0207426_1103153 | 3300025302 | Bacteria | 732 |
| 215 | Ga0209051_1030114 | 3300025303 | Bacteria | 2111 |
| 216 | Ga0209257_1000158 | 3300025304 | Bacteria | 180079 |
| 217 | Ga0209257_1023507 | 3300025304 | Bacteria | 2164 |
| 218 | Ga0207692_10001796 | 3300025898 | Bacteria | 8136 |
| 219 | Ga0207710_10023967 | 3300025900 | Bacteria | 2626 |
| 220 | Ga0207710_10318232 | 3300025900 | Bacteria | 788 |
| 221 | Ga0207688_10138968 | 3300025901 | Bacteria | 1429 |
| 222 | Ga0207680_10052867 | 3300025903 | Bacteria | 2436 |
| 223 | Ga0207647_10006024 | 3300025904 | Bacteria | 8837 |
| 224 | Ga0207647_10146688 | 3300025904 | Bacteria | 1380 |
| 225 | Ga0207685_10315612 | 3300025905 | Bacteria | 778 |
| 226 | Ga0207699_10000749 | 3300025906 | Bacteria | 15507 |
| 227 | Ga0207707_10660765 | 3300025912 | Bacteria | 880 |
| 228 | Ga0207695_10000136 | 3300025913 | Bacteria | 217596 |
| 229 | Ga0207695_10019551 | 3300025913 | Bacteria | 7793 |
| 230 | Ga0207695_10113023 | 3300025913 | Bacteria | 2692 |
| 231 | Ga0207695_10201059 | 3300025913 | Bacteria | 1907 |
| 232 | Ga0207695_11137786 | 3300025913 | Bacteria | 661 |
| 233 | Ga0207671_10000202 | 3300025914 | Bacteria | 90868 |
| 234 | Ga0207671_10136125 | 3300025914 | Bacteria | 1889 |
| 235 | Ga0207671_10171842 | 3300025914 | Bacteria | 1683 |
| 236 | Ga0207671_10285439 | 3300025914 | Bacteria | 1302 |
| 237 | Ga0207671_10556070 | 3300025914 | Bacteria | 915 |
| 238 | Ga0207693_10176854 | 3300025915 | Bacteria | 1679 |
| 239 | Ga0207693_10227360 | 3300025915 | Bacteria | 1465 |
| 240 | Ga0207663_10001805 | 3300025916 | Bacteria | 10114 |
| 241 | Ga0207660_10435695 | 3300025917 | Bacteria | 1059 |
| 242 | Ga0207657_10304669 | 3300025919 | Bacteria | 1262 |
| 243 | Ga0207657_10332726 | 3300025919 | Bacteria | 1199 |
| 244 | Ga0207657_10392953 | 3300025919 | Bacteria | 1091 |
| 245 | Ga0207649_10874190 | 3300025920 | Bacteria | 704 |
| 246 | Ga0207652_10150356 | 3300025921 | Bacteria | 2085 |
| 247 | Ga0207652_10313972 | 3300025921 | Bacteria | 1415 |
| 248 | Ga0207681_10762870 | 3300025923 | Bacteria | 807 |
| 249 | Ga0207694_10079372 | 3300025924 | Bacteria | 2574 |
| 250 | Ga0207694_10092566 | 3300025924 | Bacteria | 2387 |
| 251 | Ga0207694_10934411 | 3300025924 | Bacteria | 734 |
| 252 | Ga0207694_11431450 | 3300025924 | Bacteria | 584 |
| 253 | Ga0207650_10212832 | 3300025925 | Bacteria | 1553 |
| 254 | Ga0207650_11610041 | 3300025925 | Bacteria | 551 |
| 255 | Ga0207687_10652712 | 3300025927 | Bacteria | 890 |
| 256 | Ga0207700_10004852 | 3300025928 | Bacteria | 7985 |
| 257 | Ga0207700_10169014 | 3300025928 | Bacteria | 1822 |
| 258 | Ga0207700_11201268 | 3300025928 | Bacteria | 677 |
| 259 | Ga0207664_10053425 | 3300025929 | Bacteria | 3198 |
| 260 | Ga0207664_10151837 | 3300025929 | Bacteria | 1968 |
| 261 | Ga0207690_10106076 | 3300025932 | Bacteria | 2016 |
| 262 | Ga0207706_10100034 | 3300025933 | Bacteria | 2551 |
| 263 | Ga0207686_10905971 | 3300025934 | Bacteria | 712 |
| 264 | Ga0207709_10130291 | 3300025935 | Bacteria | 1713 |
| 265 | Ga0207709_10611520 | 3300025935 | Bacteria | 864 |
| 266 | Ga0207665_10002001 | 3300025939 | Bacteria | 13745 |
| 267 | Ga0207711_10001333 | 3300025941 | Bacteria | 23353 |
| 268 | Ga0207711_10567296 | 3300025941 | Bacteria | 1059 |
| 269 | Ga0207689_10634348 | 3300025942 | Bacteria | 900 |
| 270 | Ga0207661_10013432 | 3300025944 | Bacteria | 5981 |
| 271 | Ga0207661_10062354 | 3300025944 | Bacteria | 3016 |
| 272 | Ga0207661_11599670 | 3300025944 | Bacteria | 596 |
| 273 | Ga0207667_10441570 | 3300025949 | Bacteria | 1323 |
| 274 | Ga0207667_10707351 | 3300025949 | Bacteria | 1009 |
| 275 | Ga0207651_10220893 | 3300025960 | Bacteria | 1532 |
| 276 | Ga0207712_10907609 | 3300025961 | Bacteria | 779 |
| 277 | Ga0207668_11197751 | 3300025972 | Bacteria | 682 |
| 278 | Ga0207640_10514171 | 3300025981 | Bacteria | 1000 |
| 279 | Ga0207703_10000571 | 3300026035 | Bacteria | 37816 |
| 280 | Ga0207639_10186688 | 3300026041 | Bacteria | 1768 |
| 281 | Ga0207639_10277379 | 3300026041 | Bacteria | 1473 |
| 282 | Ga0207639_10729666 | 3300026041 | Bacteria | 920 |
| 283 | Ga0207639_11020290 | 3300026041 | Bacteria | 775 |
| 284 | Ga0207678_10055007 | 3300026067 | Bacteria | 3428 |
| 285 | Ga0207678_10066190 | 3300026067 | Bacteria | 3103 |
| 286 | Ga0207678_10202709 | 3300026067 | Bacteria | 1697 |
| 287 | Ga0207678_10883620 | 3300026067 | Bacteria | 790 |
| 288 | Ga0207678_11713587 | 3300026067 | Bacteria | 552 |
| 289 | Ga0207708_11822248 | 3300026075 | Bacteria | 534 |
| 290 | Ga0207702_10283974 | 3300026078 | Bacteria | 1566 |
| 291 | Ga0207641_10000067 | 3300026088 | Bacteria | 155379 |
| 292 | Ga0207641_10180966 | 3300026088 | Bacteria | 1931 |
| 293 | Ga0207641_10221377 | 3300026088 | Bacteria | 1755 |
| 294 | Ga0207648_10105282 | 3300026089 | Bacteria | 2475 |
| 295 | Ga0207676_10001977 | 3300026095 | Bacteria | 14926 |
| 296 | Ga0207676_10743709 | 3300026095 | Bacteria | 953 |
| 297 | Ga0207676_11361098 | 3300026095 | Bacteria | 705 |
| 298 | Ga0207676_11816878 | 3300026095 | Bacteria | 608 |
| 299 | Ga0207676_12502286 | 3300026095 | Bacteria | 513 |
| 300 | Ga0207674_10295232 | 3300026116 | Bacteria | 1569 |
| 301 | Ga0207674_10851309 | 3300026116 | Bacteria | 879 |
| 302 | Ga0207675_100260059 | 3300026118 | Bacteria | 1682 |
| 303 | Ga0207683_10091813 | 3300026121 | Bacteria | 2705 |
| 304 | Ga0209281_1027067 | 3300027111 | Bacteria | 1053 |
| 305 | Ga0209389_1000056 | 3300027296 | Bacteria | 107673 |
| 306 | Ga0209389_1000206 | 3300027296 | Bacteria | 42342 |
| 307 | Ga0209589_1000034 | 3300027357 | Bacteria | 138086 |
| 308 | Ga0209489_100009 | 3300027361 | Bacteria | 263873 |
| 309 | Ga0209489_103071 | 3300027361 | Bacteria | 33029 |
| 310 | Ga0209700_100471 | 3300027363 | Bacteria | 75447 |
| 311 | Ga0209813_10107735 | 3300027866 | Bacteria | 956 |
| 312 | Ga0209813_10144029 | 3300027866 | Bacteria | 848 |
| 313 | Ga0268266_10133830 | 3300028379 | Bacteria | 2219 |
| 314 | Ga0268266_10933498 | 3300028379 | Bacteria | 839 |
| 315 | Ga0268265_10149380 | 3300028380 | Bacteria | 1969 |
| 316 | Ga0268264_10473708 | 3300028381 | Bacteria | 1217 |
| 317 | Ga0268264_10664299 | 3300028381 | Bacteria | 1032 |
| 318 | Ga0307515_10303528 | 3300028794 | Bacteria | 1279 |
| 319 | Ga0265338_10009258 | 3300028800 | Bacteria | 11784 |
| 320 | Ga0265324_10202588 | 3300029957 | Bacteria | 674 |
| 321 | Ga0265330_10034992 | 3300031235 | Bacteria | 2242 |
| 322 | Ga0265330_10039393 | 3300031235 | Bacteria | 2099 |
| 323 | Ga0265330_10062578 | 3300031235 | Bacteria | 1618 |
| 324 | Ga0265328_10015517 | 3300031239 | Bacteria | 2982 |
| 325 | Ga0265325_10025516 | 3300031241 | Bacteria | 3208 |
| 326 | Ga0265325_10043185 | 3300031241 | Bacteria | 2353 |
| 327 | Ga0265325_10266042 | 3300031241 | Bacteria | 772 |
| 328 | Ga0265340_10009354 | 3300031247 | Bacteria | 5263 |
| 329 | Ga0265340_10327074 | 3300031247 | Bacteria | 678 |
| 330 | Ga0265339_10014821 | 3300031249 | Bacteria | 4690 |
| 331 | Ga0265316_10256633 | 3300031344 | Bacteria | 1282 |
| 332 | Ga0265313_10176613 | 3300031595 | Bacteria | 899 |
| 333 | Ga0265313_10291340 | 3300031595 | Bacteria | 658 |
| 334 | Ga0265314_10035527 | 3300031711 | Bacteria | 3631 |
| 335 | Ga0265314_10054932 | 3300031711 | Bacteria | 2753 |
| 336 | Ga0265314_10126958 | 3300031711 | Bacteria | 1596 |
| 337 | Ga0265314_10442368 | 3300031711 | Bacteria | 694 |
| 338 | Ga0265342_10100271 | 3300031712 | Bacteria | 1650 |
| 339 | Ga0265342_10102084 | 3300031712 | Bacteria | 1632 |
| 340 | Ga0265342_10169122 | 3300031712 | Bacteria | 1204 |
| 341 | Ga0307406_10109482 | 3300031901 | Bacteria | 1899 |
| 342 | Ga0307406_10339551 | 3300031901 | Bacteria | 1169 |
| 343 | Ga0307409_100840991 | 3300031995 | Bacteria | 928 |
| 344 | Ga0307510_10063444 | 3300033180 | Bacteria | 3763 |
| 345 | Ga0373928_0003582 | 3300035084 | Bacteria | 2962 |
| 346 | Ga0373932_0016697 | 3300035112 | Bacteria | 1876 |
| 347 | Ga0373943_0848637 | 3300035170 | Bacteria | 545 |
| 348 | Ga0373931_0375875 | 3300035691 | Bacteria | 895 |
| 349 | Ga0373925_0065376 | 3300037068 | Bacteria | 2740 |
| 350 | Ga0395899_0112185 | 3300037312 | Bacteria | 1959 |
| 351 | Ga0395899_0206251 | 3300037312 | Bacteria | 1368 |
| 352 | Ga0395900_0003815 | 3300037418 | Bacteria | 16114 |
| 353 | Ga0395900_0033307 | 3300037418 | Bacteria | 5303 |
| 354 | Ga0395900_0057751 | 3300037418 | Bacteria | 3995 |
| 355 | Ga0395900_0723873 | 3300037418 | Bacteria | 927 |
| 356 | Ga0395900_0904579 | 3300037418 | Bacteria | 806 |
| 357 | Ga0395898_0007171 | 3300037466 | Bacteria | 11834 |
| 358 | Ga0395898_0022885 | 3300037466 | Bacteria | 6320 |
| 359 | Ga0395898_0097903 | 3300037466 | Bacteria | 2817 |
| 360 | Ga0395905_0637162 | 3300037471 | Bacteria | 968 |
| 361 | Ga0395905_0894013 | 3300037471 | Bacteria | 791 |
| 362 | Ga0436364_0487949 | 3300037853 | Bacteria | 2019 |
| 363 | Ga0436364_0646122 | 3300037853 | Bacteria | 1983 |
| 364 | Ga0436364_0899392 | 3300037853 | Bacteria | 3249 |
| 365 | Ga0436364_1201854 | 3300037853 | Bacteria | 1207 |
| 366 | Ga0395901_0017745 | 3300038443 | Bacteria | 7264 |
| 367 | Ga0395901_0072187 | 3300038443 | Bacteria | 3598 |
| 368 | Ga0436365_0167269 | 3300039437 | Bacteria | 1661 |
| 369 | Ga0436365_0642071 | 3300039437 | Bacteria | 2101 |
| 370 | Ga0436365_0817878 | 3300039437 | Bacteria | 1149 |
| 371 | Ga0436365_1667821 | 3300039437 | Bacteria | 1026 |
| 372 | Ga0436360_0463479 | 3300039438 | Bacteria | 2612 |
| 373 | Ga0436360_0628778 | 3300039438 | Bacteria | 1406 |
| 374 | Ga0436361_0077944 | 3300039447 | Bacteria | 3047 |
| 375 | Ga0436361_0238145 | 3300039447 | Bacteria | 6517 |
| 376 | Ga0436361_0274756 | 3300039447 | Bacteria | 52927 |
| 377 | Ga0436361_0488424 | 3300039447 | Bacteria | 3382 |
| 378 | Ga0436361_0489737 | 3300039447 | Bacteria | 10225 |
| 379 | Ga0436361_1115272 | 3300039447 | Bacteria | 2984 |
| 380 | Ga0436363_0656246 | 3300039450 | Bacteria | 572 |
| 381 | Ga0436363_1420126 | 3300039450 | Bacteria | 903 |
| 382 | Ga0436362_0085232 | 3300039453 | Bacteria | 5983 |
| 383 | Ga0436362_0120734 | 3300039453 | Bacteria | 805 |
| 384 | Ga0451843_0121359 | 3300041509 | Bacteria | 791 |
| 385 | Ga0451853_2243521 | 3300041512 | Bacteria | 1862 |
| 386 | Ga0439448_0145914 | 3300042005 | Bacteria | 820 |
| 387 | Ga0439455_0091643 | 3300042012 | Bacteria | 834 |
| 388 | Ga0466972_0013574 | 3300044658 | Bacteria | 4088 |
| 389 | Ga0466972_0060680 | 3300044658 | Bacteria | 1814 |
| 390 | Ga0466972_0148323 | 3300044658 | Bacteria | 1103 |
| 391 | Ga0453683_0016715 | 3300044673 | Bacteria | 4729 |
| 392 | Ga0453683_0071616 | 3300044673 | Bacteria | 2169 |
| 393 | Ga0453683_0650408 | 3300044673 | Unclassified | 689 |
| 394 | Ga0466965_0014378 | 3300044683 | Bacteria | 3744 |
| 395 | Ga0466965_0126215 | 3300044683 | Bacteria | 1324 |
| 396 | Ga0466966_0000101 | 3300044684 | Bacteria | 51920 |
| 397 | Ga0466966_0033392 | 3300044684 | Bacteria | 3332 |
| 398 | Ga0466966_0152405 | 3300044684 | Bacteria | 1409 |
| 399 | Ga0466966_0529581 | 3300044684 | Bacteria | 709 |
| 400 | Ga0466961_0000031 | 3300044693 | Bacteria | 85869 |
| 401 | Ga0466961_0389363 | 3300044693 | Bacteria | 846 |
| 402 | Ga0466961_0614709 | 3300044693 | Bacteria | 653 |
| 403 | Ga0466963_0071739 | 3300044694 | Bacteria | 2331 |
| 404 | Ga0466964_0062459 | 3300044706 | Bacteria | 1553 |
| 405 | Ga0466964_0559434 | 3300044706 | Bacteria | 622 |
| 406 | Ga0466964_0583370 | 3300044706 | Bacteria | 611 |
| 407 | Ga0453684_0010072 | 3300044712 | Bacteria | 16242 |
| 408 | Ga0453684_0178352 | 3300044712 | Bacteria | 2496 |
| 409 | Ga0453684_0400155 | 3300044712 | Unclassified | 1538 |
| 410 | Ga0466971_0188836 | 3300044719 | Bacteria | 970 |
| 411 | Ga0466968_0007772 | 3300044735 | Bacteria | 4086 |
| 412 | Ga0466968_0059574 | 3300044735 | Bacteria | 1645 |
| 413 | Ga0466968_0379882 | 3300044735 | Bacteria | 690 |
| 414 | Ga0466968_0589379 | 3300044735 | Bacteria | 560 |
| 415 | Ga0466970_0085392 | 3300044765 | Bacteria | 1710 |
| 416 | Ga0466970_0250820 | 3300044765 | Bacteria | 992 |
| 417 | Ga0466970_0752107 | 3300044765 | Bacteria | 570 |
| 418 | Ga0466957_0063501 | 3300044842 | Bacteria | 2270 |
| 419 | Ga0466957_0363544 | 3300044842 | Bacteria | 984 |
| 420 | Ga0466957_0417676 | 3300044842 | Bacteria | 920 |
| 421 | Ga0466960_0097023 | 3300044901 | Bacteria | 1512 |
| 422 | Ga0466960_0262608 | 3300044901 | Bacteria | 962 |
| 423 | Ga0466960_0300008 | 3300044901 | Bacteria | 905 |
| 424 | Ga0466960_0480463 | 3300044901 | Bacteria | 726 |
| 425 | Ga0466960_0588463 | 3300044901 | Bacteria | 659 |
| 426 | Ga0466959_0002151 | 3300045049 | Bacteria | 12504 |
| 427 | Ga0466959_0002988 | 3300045049 | Bacteria | 10928 |
| 428 | Ga0466959_0083616 | 3300045049 | Bacteria | 2298 |
| 429 | Ga0466959_0698176 | 3300045049 | Bacteria | 680 |
| 430 | Ga0466959_0785759 | 3300045049 | Bacteria | 637 |
| 431 | Ga0451576_0014014 | 3300045051 | Bacteria | 8937 |
| 432 | Ga0451576_0186023 | 3300045051 | Unclassified | 2169 |
| 433 | Ga0451576_0824550 | 3300045051 | Bacteria | 974 |
| 434 | Ga0451576_1546787 | 3300045051 | Bacteria | 689 |
| 435 | Ga0451576_2733516 | 3300045051 | Bacteria | 502 |
| 436 | Ga0466958_0241916 | 3300045836 | Bacteria | 1153 |
| 437 | Ga0466958_0369547 | 3300045836 | Bacteria | 924 |
| 438 | Ga0466967_0332903 | 3300045976 | Bacteria | 1466 |
| 439 | Ga0466967_1234914 | 3300045976 | Bacteria | 744 |
| 440 | Ga0495592_0636056 | 3300046454 | Bacteria | 648 |
| 441 | Ga0495603_0153940 | 3300046455 | Bacteria | 1335 |
| 442 | Ga0495629_0002586 | 3300046459 | Bacteria | 13860 |
| 443 | Ga0495638_0094972 | 3300046460 | Bacteria | 1791 |
| 444 | Ga0495638_0293832 | 3300046460 | Bacteria | 878 |
| 445 | Ga0495638_0339974 | 3300046460 | Bacteria | 796 |
| 446 | Ga0495641_0222418 | 3300046461 | Bacteria | 847 |
| 447 | Ga0495653_0458474 | 3300046463 | Bacteria | 801 |
| 448 | Ga0495582_0345380 | 3300046473 | Bacteria | 857 |
| 449 | Ga0495605_0036646 | 3300046474 | Bacteria | 2472 |
| 450 | Ga0495584_0321586 | 3300046491 | Bacteria | 785 |
| 451 | Ga0495585_0132759 | 3300046492 | Bacteria | 1309 |
| 452 | Ga0495585_0593259 | 3300046492 | Bacteria | 521 |
| 453 | Ga0495594_0329073 | 3300046499 | Bacteria | 870 |
| 454 | Ga0495607_0265039 | 3300046501 | Bacteria | 821 |
| 455 | Ga0495606_0359973 | 3300046507 | Bacteria | 769 |
| 456 | Ga0495608_0132808 | 3300046511 | Bacteria | 1592 |
| 457 | Ga0495610_0041005 | 3300046512 | Bacteria | 2328 |
| 458 | Ga0495618_0183521 | 3300046514 | Bacteria | 1329 |
| 459 | Ga0495620_0101613 | 3300046515 | Bacteria | 1146 |
| 460 | Ga0495620_0147040 | 3300046515 | Bacteria | 920 |
| 461 | Ga0495628_0127789 | 3300046516 | Bacteria | 1946 |
| 462 | Ga0495628_0516394 | 3300046516 | Bacteria | 861 |
| 463 | Ga0495631_0178471 | 3300046518 | Bacteria | 910 |
| 464 | Ga0495632_0267632 | 3300046519 | Bacteria | 763 |
| 465 | Ga0495643_0014632 | 3300046522 | Bacteria | 4662 |
| 466 | Ga0495643_0112256 | 3300046522 | Bacteria | 1385 |
| 467 | Ga0495648_0191101 | 3300046524 | Bacteria | 1033 |
| 468 | Ga0495666_0446195 | 3300046526 | Bacteria | 580 |
| 469 | Ga0495652_0642276 | 3300046529 | Bacteria | 720 |
| 470 | Ga0495654_0071188 | 3300046530 | Bacteria | 1648 |
| 471 | Ga0495640_0038244 | 3300046533 | Bacteria | 3376 |
| 472 | Ga0495609_0064268 | 3300046538 | Bacteria | 1619 |
| 473 | Ga0495597_0068827 | 3300046542 | Bacteria | 1529 |
| 474 | Ga0495622_0145679 | 3300046557 | Bacteria | 1073 |
| 475 | Ga0495668_0256370 | 3300046616 | Bacteria | 957 |
| 476 | Ga0495611_0052320 | 3300046648 | Bacteria | 1842 |
| 477 | Ga0495625_0396047 | 3300046660 | Bacteria | 864 |
| 478 | Ga0495625_0830418 | 3300046660 | Bacteria | 535 |
| 479 | Ga0495661_0275948 | 3300046665 | Bacteria | 849 |
| 480 | Ga0495588_0013855 | 3300046674 | Bacteria | 3849 |
| 481 | Ga0495588_0258802 | 3300046674 | Bacteria | 917 |
| 482 | Ga0495657_0013301 | 3300046675 | Bacteria | 6076 |
| 483 | Ga0495646_0115628 | 3300046680 | Bacteria | 1523 |
| 484 | Ga0495658_0213925 | 3300046683 | Bacteria | 1205 |
| 485 | Ga0495613_0050253 | 3300046689 | Bacteria | 3075 |
| 486 | Ga0495624_0043108 | 3300046690 | Bacteria | 2879 |
| 487 | Ga0495671_0428953 | 3300046692 | Bacteria | 632 |
| 488 | Ga0495649_0155091 | 3300046694 | Bacteria | 1202 |
| 489 | Ga0495649_0382430 | 3300046694 | Bacteria | 708 |
| 490 | Ga0495589_0063125 | 3300046794 | Bacteria | 1817 |
| 491 | Ga0495600_0185527 | 3300046809 | Bacteria | 1339 |
| 492 | Ga0495660_0283013 | 3300046810 | Bacteria | 758 |
| 493 | Ga0495581_0106771 | 3300047315 | Bacteria | 1627 |
| 494 | Ga0495604_0061880 | 3300047317 | Bacteria | 2861 |
| 495 | Ga0495674_0404264 | 3300047319 | Bacteria | 1102 |
| 496 | Ga0495672_0044926 | 3300047320 | Bacteria | 2647 |
| 497 | Ga0495672_0090267 | 3300047320 | Bacteria | 1684 |
| 498 | Ga0495672_0228800 | 3300047320 | Bacteria | 914 |
| 499 | Ga0495672_0268228 | 3300047320 | Bacteria | 821 |
| 500 | Ga0495676_0063382 | 3300047321 | Bacteria | 2881 |
| 501 | Ga0495683_0144990 | 3300047323 | Bacteria | 1110 |
| 502 | Ga0495687_083087 | 3300047443 | Bacteria | 1248 |
| 503 | Ga0495687_097577 | 3300047443 | Bacteria | 1110 |
| 504 | Ga0495673_0062574 | 3300047469 | Bacteria | 1589 |
| 505 | Ga0495602_0109321 | 3300048088 | Bacteria | 2249 |
| 506 | Ga0495626_0170316 | 3300048091 | Bacteria | 908 |
| 507 | Ga0496100_0615052 | 3300048903 | Bacteria | 844 |
| 508 | Ga0496101_0163326 | 3300048904 | Bacteria | 1709 |
| 509 | Ga0496102_0074188 | 3300048905 | Bacteria | 3127 |
| 510 | Ga0496102_0712961 | 3300048905 | Bacteria | 926 |
| 511 | Ga0496102_1042382 | 3300048905 | Bacteria | 738 |
| 512 | Ga0496103_0241856 | 3300048906 | Bacteria | 1161 |
| 513 | Ga0496103_0261166 | 3300048906 | Bacteria | 1114 |
| 514 | Ga0496104_0001655 | 3300048907 | Bacteria | 19236 |
| 515 | Ga0496104_0057112 | 3300048907 | Bacteria | 3693 |
| 516 | Ga0496104_0903684 | 3300048907 | Bacteria | 788 |
| 517 | Ga0496105_0015424 | 3300048908 | Bacteria | 6089 |
| 518 | Ga0496106_0094426 | 3300048909 | Bacteria | 2312 |
| 519 | Ga0496108_0505547 | 3300048911 | Bacteria | 1055 |
| 520 | Ga0496109_0754511 | 3300048912 | Bacteria | 911 |
| 521 | Ga0496109_1859875 | 3300048912 | Bacteria | 535 |
| 522 | Ga0496110_0157888 | 3300048913 | Bacteria | 2055 |
| 523 | Ga0496110_0880568 | 3300048913 | Bacteria | 801 |
| 524 | Ga0496110_1558871 | 3300048913 | Bacteria | 570 |
| 525 | Ga0496111_0711005 | 3300048914 | Bacteria | 730 |
| 526 | Ga0496111_1031510 | 3300048914 | Bacteria | 588 |
| 527 | Ga0496112_0064774 | 3300048915 | Bacteria | 3607 |
| 528 | Ga0496112_0390349 | 3300048915 | Bacteria | 1332 |
| 529 | Ga0496113_0119847 | 3300048916 | Bacteria | 2056 |
| 530 | Ga0496113_0179175 | 3300048916 | Bacteria | 1680 |
| 531 | Ga0496113_0347813 | 3300048916 | Bacteria | 1189 |
| 532 | Ga0496114_0392099 | 3300048917 | Bacteria | 1230 |
| 533 | Ga0496114_0769788 | 3300048917 | Bacteria | 840 |
| 534 | Ga0496115_0059021 | 3300048918 | Bacteria | 3089 |
| 535 | Ga0496115_0154337 | 3300048918 | Bacteria | 1896 |
| 536 | Ga0496116_0009012 | 3300048919 | Bacteria | 8574 |
| 537 | Ga0496116_0053528 | 3300048919 | Bacteria | 2665 |
| 538 | Ga0496117_0014560 | 3300048920 | Bacteria | 6768 |
| 539 | Ga0496117_0033443 | 3300048920 | Bacteria | 3887 |
| 540 | Ga0496117_0243084 | 3300048920 | Bacteria | 987 |
| 541 | Ga0496117_0418051 | 3300048920 | Bacteria | 671 |
| 542 | Ga0496118_0024327 | 3300048921 | Bacteria | 5230 |
| 543 | Ga0496118_0025294 | 3300048921 | Bacteria | 5096 |
| 544 | Ga0496118_0087742 | 3300048921 | Bacteria | 2156 |
| 545 | Ga0496118_0222622 | 3300048921 | Bacteria | 1097 |
| 546 | Ga0496119_0011533 | 3300048922 | Bacteria | 7303 |
| 547 | Ga0496119_0016058 | 3300048922 | Bacteria | 5721 |
| 548 | Ga0496119_0113437 | 3300048922 | Bacteria | 1501 |
| 549 | Ga0496119_0342863 | 3300048922 | Bacteria | 726 |
| 550 | Ga0496119_0360104 | 3300048922 | Bacteria | 702 |
| 551 | Ga0496119_0388918 | 3300048922 | Bacteria | 667 |
| 552 | Ga0496120_0003849 | 3300048923 | Bacteria | 13184 |
| 553 | Ga0496120_0173894 | 3300048923 | Bacteria | 1063 |
| 554 | Ga0496120_0393946 | 3300048923 | Bacteria | 613 |
| 555 | Ga0496121_0000152 | 3300048924 | Bacteria | 150767 |
| 556 | Ga0496121_0013561 | 3300048924 | Bacteria | 8740 |
| 557 | Ga0496121_0014668 | 3300048924 | Bacteria | 8286 |
| 558 | Ga0496121_0026715 | 3300048924 | Bacteria | 5426 |
| 559 | Ga0496121_0043563 | 3300048924 | Bacteria | 3885 |
| 560 | Ga0496121_0049950 | 3300048924 | Bacteria | 3539 |
| 561 | Ga0496121_0121794 | 3300048924 | Bacteria | 1969 |
| 562 | Ga0496122_0021585 | 3300048925 | Bacteria | 5757 |
| 563 | Ga0496122_0047803 | 3300048925 | Bacteria | 3298 |
| 564 | Ga0496122_0297606 | 3300048925 | Bacteria | 872 |
| 565 | Ga0496122_0314650 | 3300048925 | Bacteria | 836 |
| 566 | Ga0496123_0084176 | 3300048926 | Bacteria | 1919 |
| 567 | Ga0496124_0371906 | 3300048927 | Bacteria | 1003 |
| 568 | Ga0496124_0576293 | 3300048927 | Bacteria | 737 |
| 569 | Ga0496124_0934270 | 3300048927 | Bacteria | 523 |
| 570 | Ga0496125_0016187 | 3300048928 | Bacteria | 7170 |
| 571 | Ga0496126_0002980 | 3300048929 | Bacteria | 21982 |
| 572 | Ga0496126_0016467 | 3300048929 | Bacteria | 7391 |
| 573 | Ga0496126_0026746 | 3300048929 | Bacteria | 5525 |
| 574 | Ga0496126_0030510 | 3300048929 | Bacteria | 5106 |
| 575 | Ga0496126_0076527 | 3300048929 | Bacteria | 2969 |
| 576 | Ga0496126_0142002 | 3300048929 | Bacteria | 2066 |
| 577 | Ga0496126_0173888 | 3300048929 | Bacteria | 1833 |
| 578 | Ga0496126_0182774 | 3300048929 | Bacteria | 1780 |
| 579 | Ga0496126_0194501 | 3300048929 | Bacteria | 1716 |
| 580 | Ga0496126_0422071 | 3300048929 | Bacteria | 1078 |
| 581 | Ga0496126_0470127 | 3300048929 | Bacteria | 1009 |
| 582 | Ga0495678_089501 | 3300049459 | Bacteria | 1087 |
| 583 | Ga0495682_0127700 | 3300049460 | Bacteria | 910 |
| 584 | Ga0501031_0001041 | 3300049568 | Bacteria | 16832 |
| 585 | Ga0501031_0065591 | 3300049568 | Bacteria | 2365 |
| 586 | Ga0501032_0000040 | 3300049569 | Bacteria | 115662 |
| 587 | Ga0501032_0003556 | 3300049569 | Bacteria | 11884 |
| 588 | Ga0501033_0000128 | 3300049570 | Bacteria | 73419 |
| 589 | Ga0501033_0000392 | 3300049570 | Bacteria | 42128 |
| 590 | Ga0501033_0187684 | 3300049570 | Bacteria | 1480 |
| 591 | Ga0501034_0000254 | 3300049571 | Bacteria | 97896 |
| 592 | Ga0501034_0050101 | 3300049571 | Bacteria | 4212 |
| 593 | Ga0501036_0000088 | 3300049572 | Bacteria | 57888 |
| 594 | Ga0501036_0000375 | 3300049572 | Bacteria | 31541 |
| 595 | Ga0501036_0239652 | 3300049572 | Bacteria | 1521 |
| 596 | Ga0501037_0000041 | 3300049573 | Bacteria | 118457 |
| 597 | Ga0501037_0008655 | 3300049573 | Bacteria | 7463 |
| 598 | Ga0501038_0000057 | 3300049574 | Bacteria | 92766 |
| 599 | Ga0501038_0001549 | 3300049574 | Bacteria | 21233 |
| 600 | Ga0501039_0000084 | 3300049575 | Bacteria | 71542 |
| 601 | Ga0501039_0015337 | 3300049575 | Bacteria | 5865 |
| 602 | Ga0501042_0000506 | 3300049578 | Bacteria | 20296 |
| 603 | Ga0501043_0000184 | 3300049579 | Bacteria | 56470 |
| 604 | Ga0501043_0022975 | 3300049579 | Bacteria | 4890 |
| 605 | Ga0501043_0186112 | 3300049579 | Bacteria | 1617 |
| 606 | Ga0501043_0439183 | 3300049579 | Bacteria | 982 |
| 607 | Ga0501046_0000072 | 3300049580 | Bacteria | 106407 |
| 608 | Ga0501046_0000402 | 3300049580 | Bacteria | 43356 |
| 609 | Ga0501047_0000044 | 3300049581 | Bacteria | 174789 |
| 610 | Ga0501047_0009182 | 3300049581 | Bacteria | 9337 |
| 611 | Ga0501047_0017239 | 3300049581 | Bacteria | 6914 |
| 612 | Ga0501047_0038560 | 3300049581 | Bacteria | 4622 |
| 613 | Ga0501047_0047785 | 3300049581 | Bacteria | 4134 |
| 614 | Ga0501048_0000295 | 3300049582 | Bacteria | 33908 |
| 615 | Ga0501048_0001365 | 3300049582 | Bacteria | 18477 |
| 616 | Ga0501048_0068744 | 3300049582 | Bacteria | 2501 |
| 617 | Ga0501067_0039211 | 3300049583 | Bacteria | 2630 |
| 618 | Ga0501067_0154729 | 3300049583 | Bacteria | 1277 |
| 619 | Ga0501068_0000113 | 3300049584 | Bacteria | 34900 |
| 620 | Ga0501069_0021434 | 3300049585 | Bacteria | 3507 |
| 621 | Ga0501069_0211197 | 3300049585 | Bacteria | 1126 |
| 622 | Ga0501070_0000310 | 3300049586 | Bacteria | 44627 |
| 623 | Ga0501070_0021229 | 3300049586 | Bacteria | 5450 |
| 624 | Ga0501070_0885236 | 3300049586 | Bacteria | 697 |
| 625 | Ga0501070_1392272 | 3300049586 | Bacteria | 533 |
| 626 | Ga0501071_0278852 | 3300049587 | Bacteria | 1265 |
| 627 | Ga0501072_0000156 | 3300049588 | Bacteria | 50717 |
| 628 | Ga0501073_0000043 | 3300049589 | Bacteria | 80142 |
| 629 | Ga0501073_0150523 | 3300049589 | Bacteria | 1613 |
| 630 | Ga0501073_0185555 | 3300049589 | Bacteria | 1439 |
| 631 | Ga0501074_0000035 | 3300049590 | Bacteria | 64770 |
| 632 | Ga0501074_0156084 | 3300049590 | Bacteria | 1630 |
| 633 | Ga0501079_0000839 | 3300049741 | Bacteria | 20917 |
| 634 | Ga0501080_0000600 | 3300049742 | Bacteria | 28483 |
| 635 | Ga0501080_0079232 | 3300049742 | Bacteria | 3054 |
| 636 | Ga0501080_0099770 | 3300049742 | Bacteria | 2694 |
| 637 | Ga0501083_0147261 | 3300049744 | Bacteria | 1542 |
| 638 | Ga0501083_0223232 | 3300049744 | Bacteria | 1227 |
| 639 | Ga0501035_0000128 | 3300049822 | Bacteria | 92297 |
| 640 | Ga0501035_0000269 | 3300049822 | Bacteria | 61583 |
| 641 | Ga0501035_0225361 | 3300049822 | Bacteria | 1599 |
| 642 | Ga0501035_1208039 | 3300049822 | Bacteria | 586 |
| 643 | Ga0501044_0000108 | 3300049823 | Bacteria | 100968 |
| 644 | Ga0501044_0046026 | 3300049823 | Bacteria | 4518 |
| 645 | Ga0501044_0323740 | 3300049823 | Bacteria | 1465 |
| 646 | nmdc:mga03683_146362_c1 | 3300050489 | Bacteria | 1064 |
| 647 | nmdc:mga03683_223452_c1 | 3300050489 | Bacteria | 869 |
| 648 | nmdc:mga03n38_190319_c1 | 3300050490 | Bacteria | 1057 |
| 649 | nmdc:mga00v17_438966_c1 | 3300050491 | Bacteria | 848 |
| 650 | nmdc:mga00v17_77157_c1 | 3300050491 | Bacteria | 2074 |
| 651 | nmdc:mga0yw44_3454_c1 | 3300050492 | Bacteria | 7016 |
| 652 | nmdc:mga0yw44_528656_c1 | 3300050492 | Bacteria | 801 |
| 653 | nmdc:mga0k408_11705_c1 | 3300050493 | Bacteria | 4783 |
| 654 | nmdc:mga06z11_149191_c1 | 3300050494 | Bacteria | 1328 |
| 655 | nmdc:mga06z11_244146_c1 | 3300050494 | Bacteria | 1056 |
| 656 | nmdc:mga06z11_520846_c1 | 3300050494 | Bacteria | 721 |
| 657 | nmdc:mga04h51_50221_c1 | 3300050495 | Bacteria | 1397 |
| 658 | nmdc:mga07m45_174323_c1 | 3300050496 | Bacteria | 1250 |
| 659 | nmdc:mga07m45_506363_c1 | 3300050496 | Bacteria | 699 |
| 660 | nmdc:mga07m45_63911_c1 | 3300050496 | Bacteria | 1768 |
| 661 | nmdc:mga08x19_425231_c1 | 3300050514 | Bacteria | 933 |
| 662 | nmdc:mga0sz30_107435_c1 | 3300050516 | Bacteria | 1221 |
| 663 | nmdc:mga0sz30_237724_c1 | 3300050516 | Bacteria | 811 |
| 664 | nmdc:mga0sz30_48827_c1 | 3300050516 | Bacteria | 1792 |
| 665 | Ga0495619_0412108 | 3300053085 | Bacteria | 933 |
| 666 | Ga0500578_0186870 | 3300053086 | Bacteria | 1274 |
| 667 | Ga0500643_000095 | 3300053087 | Bacteria | 92535 |
| 668 | Ga0500644_0283517 | 3300053088 | Bacteria | 706 |
| 669 | Ga0500651_0001437 | 3300053093 | Bacteria | 11972 |
| 670 | Ga0500651_0211368 | 3300053093 | Bacteria | 1141 |
| 671 | Ga0500566_0000123 | 3300053094 | Bacteria | 40138 |
| 672 | Ga0500640_202490 | 3300053095 | Bacteria | 691 |
| 673 | Ga0500641_0108970 | 3300053096 | Bacteria | 1191 |
| 674 | Ga0500641_0372331 | 3300053096 | Bacteria | 568 |
| 675 | Ga0500650_0087519 | 3300053098 | Bacteria | 1458 |
| 676 | Ga0500554_138171 | 3300053102 | Bacteria | 824 |
| 677 | Ga0500555_004703 | 3300053103 | Bacteria | 3878 |
| 678 | Ga0500556_0048984 | 3300053104 | Bacteria | 1521 |
| 679 | Ga0500557_000036 | 3300053105 | Bacteria | 71169 |
| 680 | Ga0500562_034684 | 3300053108 | Bacteria | 1335 |
| 681 | Ga0500569_003011 | 3300053109 | Bacteria | 3387 |
| 682 | Ga0500569_267237 | 3300053109 | Bacteria | 579 |
| 683 | Ga0500572_019168 | 3300053111 | Bacteria | 1783 |
| 684 | Ga0500592_025841 | 3300053116 | Bacteria | 947 |
| 685 | Ga0500592_030759 | 3300053116 | Bacteria | 866 |
| 686 | Ga0500593_000585 | 3300053117 | Bacteria | 13998 |
| 687 | Ga0500594_0223209 | 3300053118 | Bacteria | 623 |
| 688 | Ga0500595_000839 | 3300053119 | Bacteria | 17559 |
| 689 | Ga0500595_001859 | 3300053119 | Bacteria | 10918 |
| 690 | Ga0500595_014588 | 3300053119 | Bacteria | 2978 |
| 691 | Ga0500595_029117 | 3300053119 | Bacteria | 1876 |
| 692 | Ga0500595_044588 | 3300053119 | Bacteria | 1404 |
| 693 | Ga0500595_088852 | 3300053119 | Bacteria | 896 |
| 694 | Ga0500607_055382 | 3300053121 | Bacteria | 2096 |
| 695 | Ga0500608_019066 | 3300053122 | Bacteria | 3139 |
| 696 | Ga0500642_0000103 | 3300053130 | Bacteria | 40846 |
| 697 | Ga0500642_0037896 | 3300053130 | Bacteria | 2063 |
| 698 | Ga0500642_0088219 | 3300053130 | Bacteria | 1431 |
| 699 | Ga0500652_140334 | 3300053131 | Bacteria | 1006 |
| 700 | Ga0500652_310827 | 3300053131 | Bacteria | 607 |
| 701 | Ga0500658_0040012 | 3300053134 | Bacteria | 1876 |
| 702 | Ga0500559_0002826 | 3300053136 | Bacteria | 8770 |
| 703 | Ga0500559_0030423 | 3300053136 | Bacteria | 2314 |
| 704 | Ga0500568_0008926 | 3300053139 | Bacteria | 4796 |
| 705 | Ga0500568_0041288 | 3300053139 | Bacteria | 1854 |
| 706 | Ga0500568_0059411 | 3300053139 | Bacteria | 1483 |
| 707 | Ga0500568_0074207 | 3300053139 | Bacteria | 1298 |
| 708 | Ga0500568_0260100 | 3300053139 | Bacteria | 631 |
| 709 | Ga0500577_0317831 | 3300053142 | Bacteria | 680 |
| 710 | Ga0500588_0179590 | 3300053146 | Bacteria | 778 |
| 711 | Ga0500590_126829 | 3300053148 | Bacteria | 1187 |
| 712 | Ga0500616_0017085 | 3300053153 | Bacteria | 4120 |
| 713 | Ga0500616_0297568 | 3300053153 | Bacteria | 671 |
| 714 | Ga0500619_019397 | 3300053154 | Bacteria | 1926 |
| 715 | Ga0500620_036935 | 3300053155 | Bacteria | 1582 |
| 716 | Ga0500622_0012724 | 3300053156 | Bacteria | 4551 |
| 717 | Ga0500622_0020063 | 3300053156 | Bacteria | 3549 |
| 718 | Ga0500627_0361680 | 3300053158 | Bacteria | 624 |
| 719 | Ga0500638_118669 | 3300053162 | Bacteria | 1212 |
| 720 | Ga0500638_139954 | 3300053162 | Bacteria | 1088 |
| 721 | Ga0500636_0002571 | 3300053177 | Bacteria | 10091 |
| 722 | Ga0500636_0005712 | 3300053177 | Bacteria | 7114 |
| 723 | Ga0500637_0073623 | 3300053178 | Bacteria | 1967 |
| 724 | Ga0500570_066843 | 3300053724 | Bacteria | 1703 |
| 725 | Ga0500625_000325 | 3300053729 | Bacteria | 11897 |
| 726 | Ga0500609_001599 | 3300053731 | Bacteria | 3303 |
| 727 | Ga0500599_007228 | 3300053736 | Bacteria | 1426 |
| 728 | Ga0500601_000445 | 3300053737 | Bacteria | 6725 |
| 729 | Ga0500601_035212 | 3300053737 | Bacteria | 601 |
| 730 | Ga0501084_0025559 | 3300054114 | Bacteria | 4926 |
| 731 | Ga0500661_011309 | 3300055283 | Bacteria | 1614 |
| 732 | Ga0501082_0158442 | 3300060353 | Bacteria | 1967 |
| 733 | Ga0466962_0092498 | 3300061719 | Bacteria | 1450 |
| 734 | Ga0466962_0132351 | 3300061719 | Bacteria | 1206 |
| 735 | Ga0466962_0157047 | 3300061719 | Bacteria | 1105 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2786546940 | 2788437587 | 118 |
| 2 | 3300014968 | Ga0157379_11221694 | Ga0157379_112216941 | 119 |
| 3 | 3300005617 | Ga0068859_100108929 | Ga0068859_1001089292 | 120 |
| 4 | 3300005618 | Ga0068864_100398976 | Ga0068864_1003989762 | 120 |
| 5 | 3300005841 | Ga0068863_100182757 | Ga0068863_1001827572 | 120 |
| 6 | 3300005843 | Ga0068860_101235463 | Ga0068860_1012354632 | 120 |
| 7 | 3300006852 | Ga0075433_11578652 | Ga0075433_115786521 | 120 |
| 8 | 3300006871 | Ga0075434_100248208 | Ga0075434_1002482082 | 120 |
| 9 | 3300006931 | Ga0097620_100108929 | Ga0097620_1001089292 | 120 |
| 10 | 3300009101 | Ga0105247_10937133 | Ga0105247_109371332 | 120 |
| 11 | 3300009148 | Ga0105243_10917821 | Ga0105243_109178211 | 120 |
| 12 | 3300009551 | Ga0105238_10712014 | Ga0105238_107120142 | 120 |
| 13 | 3300013296 | Ga0157374_10885120 | Ga0157374_108851202 | 120 |
| 14 | 3300014325 | Ga0163163_10975280 | Ga0163163_109752802 | 120 |
| 15 | 3300021361 | Ga0213872_10004165 | Ga0213872_100041654 | 120 |
| 16 | 3300021361 | Ga0213872_10031833 | Ga0213872_100318332 | 120 |
| 17 | 3300025917 | Ga0207660_10435695 | Ga0207660_104356952 | 120 |
| 18 | 3300025935 | Ga0207709_10611520 | Ga0207709_106115201 | 120 |
| 19 | 3300026088 | Ga0207641_10221377 | Ga0207641_102213772 | 120 |
| 20 | 3300026095 | Ga0207676_10743709 | Ga0207676_107437092 | 120 |
| 21 | 3300028381 | Ga0268264_10664299 | Ga0268264_106642992 | 120 |
| 22 | 3300028794 | Ga0307515_10303528 | Ga0307515_103035282 | 120 |
| 23 | 3300029957 | Ga0265324_10202588 | Ga0265324_102025882 | 120 |
| 24 | 3300031235 | Ga0265330_10034992 | Ga0265330_100349923 | 120 |
| 25 | 3300031235 | Ga0265330_10039393 | Ga0265330_100393932 | 120 |
| 26 | 3300031235 | Ga0265330_10062578 | Ga0265330_100625782 | 120 |
| 27 | 3300031239 | Ga0265328_10015517 | Ga0265328_100155173 | 120 |
| 28 | 3300031241 | Ga0265325_10025516 | Ga0265325_100255162 | 120 |
| 29 | 3300031241 | Ga0265325_10043185 | Ga0265325_100431852 | 120 |
| 30 | 3300031241 | Ga0265325_10266042 | Ga0265325_102660422 | 120 |
| 31 | 3300031247 | Ga0265340_10009354 | Ga0265340_100093544 | 120 |
| 32 | 3300031247 | Ga0265340_10327074 | Ga0265340_103270742 | 120 |
| 33 | 3300031249 | Ga0265339_10014821 | Ga0265339_100148216 | 120 |
| 34 | 3300031344 | Ga0265316_10256633 | Ga0265316_102566332 | 120 |
| 35 | 3300031595 | Ga0265313_10176613 | Ga0265313_101766132 | 120 |
| 36 | 3300031595 | Ga0265313_10291340 | Ga0265313_102913401 | 120 |
| 37 | 3300031711 | Ga0265314_10035527 | Ga0265314_100355274 | 120 |
| 38 | 3300031711 | Ga0265314_10054932 | Ga0265314_100549322 | 120 |
| 39 | 3300031711 | Ga0265314_10126958 | Ga0265314_101269582 | 120 |
| 40 | 3300031711 | Ga0265314_10442368 | Ga0265314_104423682 | 120 |
| 41 | 3300031712 | Ga0265342_10100271 | Ga0265342_101002712 | 120 |
| 42 | 3300031712 | Ga0265342_10102084 | Ga0265342_101020843 | 120 |
| 43 | 3300031712 | Ga0265342_10169122 | Ga0265342_101691222 | 120 |
| 44 | 3300035084 | Ga0373928_0003582 | Ga0373928_0003582_2226_2591 | 120 |
| 45 | 3300035112 | Ga0373932_0016697 | Ga0373932_0016697_1130_1495 | 120 |
| 46 | 3300039447 | Ga0436361_0077944 | Ga0436361_0077944_1682_2044 | 120 |
| 47 | 3300039447 | Ga0436361_0274756 | Ga0436361_0274756_26191_26553 | 120 |
| 48 | 3300039447 | Ga0436361_0489737 | Ga0436361_0489737_2780_3142 | 120 |
| 49 | 3300039447 | Ga0436361_1115272 | Ga0436361_1115272_2431_2793 | 120 |
| 50 | 3300044673 | Ga0453683_0016715 | Ga0453683_0016715_1362_1727 | 120 |
| 51 | 3300044673 | Ga0453683_0071616 | Ga0453683_0071616_1712_2077 | 120 |
| 52 | 3300044673 | Ga0453683_0650408 | Ga0453683_0650408_47_412 | 120 |
| 53 | 3300044684 | Ga0466966_0033392 | Ga0466966_0033392_424_786 | 120 |
| 54 | 3300044684 | Ga0466966_0152405 | Ga0466966_0152405_844_1209 | 120 |
| 55 | 3300044712 | Ga0453684_0010072 | Ga0453684_0010072_2113_2496 | 120 |
| 56 | 3300044712 | Ga0453684_0400155 | Ga0453684_0400155_497_862 | 120 |
| 57 | 3300044719 | Ga0466971_0188836 | Ga0466971_0188836_414_779 | 120 |
| 58 | 3300044765 | Ga0466970_0085392 | Ga0466970_0085392_530_892 | 120 |
| 59 | 3300044842 | Ga0466957_0417676 | Ga0466957_0417676_272_637 | 120 |
| 60 | 3300045049 | Ga0466959_0002151 | Ga0466959_0002151_4365_4730 | 120 |
| 61 | 3300045051 | Ga0451576_0186023 | Ga0451576_0186023_1671_2036 | 120 |
| 62 | 3300045051 | Ga0451576_0824550 | Ga0451576_0824550_585_950 | 120 |
| 63 | 3300045051 | Ga0451576_1546787 | Ga0451576_1546787_281_646 | 120 |
| 64 | 3300045051 | Ga0451576_2733516 | Ga0451576_2733516_27_392 | 120 |
| 65 | 3300045836 | Ga0466958_0369547 | Ga0466958_0369547_197_562 | 120 |
| 66 | 3300046665 | Ga0495661_0275948 | Ga0495661_0275948_439_801 | 120 |
| 67 | 3300048920 | Ga0496117_0033443 | Ga0496117_0033443_2555_2917 | 120 |
| 68 | 3300048922 | Ga0496119_0113437 | Ga0496119_0113437_200_562 | 120 |
| 69 | 3300048923 | Ga0496120_0393946 | Ga0496120_0393946_171_533 | 120 |
| 70 | 3300048925 | Ga0496122_0021585 | Ga0496122_0021585_4712_5074 | 120 |
| 71 | 3300049568 | Ga0501031_0065591 | Ga0501031_0065591_1253_1618 | 120 |
| 72 | 3300049569 | Ga0501032_0003556 | Ga0501032_0003556_3593_3958 | 120 |
| 73 | 3300049570 | Ga0501033_0000392 | Ga0501033_0000392_1890_2255 | 120 |
| 74 | 3300049571 | Ga0501034_0050101 | Ga0501034_0050101_2409_2774 | 120 |
| 75 | 3300049572 | Ga0501036_0000088 | Ga0501036_0000088_56727_57092 | 120 |
| 76 | 3300049573 | Ga0501037_0008655 | Ga0501037_0008655_621_986 | 120 |
| 77 | 3300049574 | Ga0501038_0001549 | Ga0501038_0001549_545_910 | 120 |
| 78 | 3300049575 | Ga0501039_0015337 | Ga0501039_0015337_2110_2475 | 120 |
| 79 | 3300049578 | Ga0501042_0000506 | Ga0501042_0000506_796_1161 | 120 |
| 80 | 3300049579 | Ga0501043_0022975 | Ga0501043_0022975_4185_4550 | 120 |
| 81 | 3300049580 | Ga0501046_0000402 | Ga0501046_0000402_2248_2613 | 120 |
| 82 | 3300049581 | Ga0501047_0038560 | Ga0501047_0038560_51_416 | 120 |
| 83 | 3300049582 | Ga0501048_0001365 | Ga0501048_0001365_13890_14252 | 120 |
| 84 | 3300049582 | Ga0501048_0068744 | Ga0501048_0068744_1679_2044 | 120 |
| 85 | 3300049589 | Ga0501073_0150523 | Ga0501073_0150523_15_380 | 120 |
| 86 | 3300049742 | Ga0501080_0079232 | Ga0501080_0079232_2620_2985 | 120 |
| 87 | 3300049744 | Ga0501083_0147261 | Ga0501083_0147261_991_1356 | 120 |
| 88 | 3300049822 | Ga0501035_0000269 | Ga0501035_0000269_60266_60631 | 120 |
| 89 | 3300049823 | Ga0501044_0046026 | Ga0501044_0046026_1890_2255 | 120 |
| 90 | 3300060353 | Ga0501082_0158442 | Ga0501082_0158442_1039_1404 | 120 |
| 91 | 3300061719 | Ga0466962_0092498 | Ga0466962_0092498_840_1205 | 120 |
| 92 | 3300001904 | JGI24736J21556_1063606 | JGI24736J21556_10636062 | 121 |
| 93 | 3300001989 | JGI24739J22299_10100083 | JGI24739J22299_101000831 | 121 |
| 94 | 3300001990 | JGI24737J22298_10135173 | JGI24737J22298_101351732 | 121 |
| 95 | 3300002067 | JGI24735J21928_10147995 | JGI24735J21928_101479952 | 121 |
| 96 | 3300003215 | JGI25153J46596_10000633 | JGI25153J46596_1000063317 | 121 |
| 97 | 3300003215 | JGI25153J46596_10000651 | JGI25153J46596_100006516 | 121 |
| 98 | 3300003215 | JGI25153J46596_10006525 | JGI25153J46596_100065256 | 121 |
| 99 | 3300003215 | JGI25153J46596_10011915 | JGI25153J46596_100119151 | 121 |
| 100 | 3300003215 | JGI25153J46596_10037547 | JGI25153J46596_100375473 | 121 |
| 101 | 3300003215 | JGI25153J46596_10089491 | JGI25153J46596_100894912 | 121 |
| 102 | 3300003323 | rootH1_10201646 | rootH1_102016463 | 121 |
| 103 | 3300003354 | JGI25160J50197_1056197 | JGI25160J50197_10561971 | 121 |
| 104 | 3300003771 | Ga0055526_1036046 | Ga0055526_10360462 | 121 |
| 105 | 3300003775 | Ga0055524_1007998 | Ga0055524_10079983 | 121 |
| 106 | 3300003775 | Ga0055524_1059930 | Ga0055524_10599302 | 121 |
| 107 | 3300003794 | Ga0055531_10005412 | Ga0055531_100054122 | 121 |
| 108 | 3300005262 | Ga0065165_1000054 | Ga0065165_1000054112 | 121 |
| 109 | 3300005262 | Ga0065165_1001857 | Ga0065165_100185716 | 121 |
| 110 | 3300005262 | Ga0065165_1002497 | Ga0065165_10024976 | 121 |
| 111 | 3300005262 | Ga0065165_1061509 | Ga0065165_10615092 | 121 |
| 112 | 3300005329 | Ga0070683_100038089 | Ga0070683_1000380892 | 121 |
| 113 | 3300005329 | Ga0070683_100057527 | Ga0070683_1000575272 | 121 |
| 114 | 3300005329 | Ga0070683_100765555 | Ga0070683_1007655552 | 121 |
| 115 | 3300005331 | Ga0070670_101423776 | Ga0070670_1014237762 | 121 |
| 116 | 3300005336 | Ga0070680_100094782 | Ga0070680_1000947822 | 121 |
| 117 | 3300005337 | Ga0070682_101804299 | Ga0070682_1018042991 | 121 |
| 118 | 3300005338 | Ga0068868_100357737 | Ga0068868_1003577373 | 121 |
| 119 | 3300005339 | Ga0070660_100294597 | Ga0070660_1002945974 | 121 |
| 120 | 3300005339 | Ga0070660_101761265 | Ga0070660_1017612651 | 121 |
| 121 | 3300005341 | Ga0070691_10030518 | Ga0070691_100305183 | 121 |
| 122 | 3300005355 | Ga0070671_100289106 | Ga0070671_1002891062 | 121 |
| 123 | 3300005367 | Ga0070667_100930754 | Ga0070667_1009307541 | 121 |
| 124 | 3300005434 | Ga0070709_10001267 | Ga0070709_100012674 | 121 |
| 125 | 3300005434 | Ga0070709_11017313 | Ga0070709_110173132 | 121 |
| 126 | 3300005435 | Ga0070714_100135360 | Ga0070714_1001353602 | 121 |
| 127 | 3300005435 | Ga0070714_100213431 | Ga0070714_1002134313 | 121 |
| 128 | 3300005436 | Ga0070713_100006642 | Ga0070713_1000066422 | 121 |
| 129 | 3300005437 | Ga0070710_10001610 | Ga0070710_100016108 | 121 |
| 130 | 3300005439 | Ga0070711_100002880 | Ga0070711_1000028806 | 121 |
| 131 | 3300005455 | Ga0070663_100063537 | Ga0070663_1000635372 | 121 |
| 132 | 3300005455 | Ga0070663_100666177 | Ga0070663_1006661772 | 121 |
| 133 | 3300005458 | Ga0070681_10229924 | Ga0070681_102299243 | 121 |
| 134 | 3300005458 | Ga0070681_11349987 | Ga0070681_113499872 | 121 |
| 135 | 3300005530 | Ga0070679_100195528 | Ga0070679_1001955282 | 121 |
| 136 | 3300005530 | Ga0070679_100214870 | Ga0070679_1002148702 | 121 |
| 137 | 3300005530 | Ga0070679_101845899 | Ga0070679_1018458992 | 121 |
| 138 | 3300005535 | Ga0070684_100032985 | Ga0070684_1000329852 | 121 |
| 139 | 3300005535 | Ga0070684_100610185 | Ga0070684_1006101852 | 121 |
| 140 | 3300005539 | Ga0068853_100295866 | Ga0068853_1002958663 | 121 |
| 141 | 3300005539 | Ga0068853_100469902 | Ga0068853_1004699022 | 121 |
| 142 | 3300005539 | Ga0068853_100516200 | Ga0068853_1005162002 | 121 |
| 143 | 3300005539 | Ga0068853_100794613 | Ga0068853_1007946132 | 121 |
| 144 | 3300005539 | Ga0068853_101628346 | Ga0068853_1016283461 | 121 |
| 145 | 3300005563 | Ga0068855_100080309 | Ga0068855_1000803094 | 121 |
| 146 | 3300005563 | Ga0068855_101935132 | Ga0068855_1019351322 | 121 |
| 147 | 3300005564 | Ga0070664_100705062 | Ga0070664_1007050622 | 121 |
| 148 | 3300005577 | Ga0068857_100265926 | Ga0068857_1002659264 | 121 |
| 149 | 3300005577 | Ga0068857_100444308 | Ga0068857_1004443082 | 121 |
| 150 | 3300005577 | Ga0068857_100732826 | Ga0068857_1007328262 | 121 |
| 151 | 3300005578 | Ga0068854_100328560 | Ga0068854_1003285601 | 121 |
| 152 | 3300005614 | Ga0068856_100375959 | Ga0068856_1003759592 | 121 |
| 153 | 3300005614 | Ga0068856_101597303 | Ga0068856_1015973032 | 121 |
| 154 | 3300005616 | Ga0068852_100001747 | Ga0068852_1000017472 | 121 |
| 155 | 3300005618 | Ga0068864_100000060 | Ga0068864_1000000605 | 121 |
| 156 | 3300005618 | Ga0068864_100208399 | Ga0068864_1002083992 | 121 |
| 157 | 3300005834 | Ga0068851_10183858 | Ga0068851_101838584 | 121 |
| 158 | 3300005840 | Ga0068870_10512580 | Ga0068870_105125802 | 121 |
| 159 | 3300005841 | Ga0068863_100000023 | Ga0068863_100000023125 | 121 |
| 160 | 3300005841 | Ga0068863_100216415 | Ga0068863_1002164154 | 121 |
| 161 | 3300005842 | Ga0068858_100011301 | Ga0068858_1000113015 | 121 |
| 162 | 3300005843 | Ga0068860_100608105 | Ga0068860_1006081052 | 121 |
| 163 | 3300005843 | Ga0068860_100626215 | Ga0068860_1006262152 | 121 |
| 164 | 3300005844 | Ga0068862_100966501 | Ga0068862_1009665011 | 121 |
| 165 | 3300005937 | Ga0081455_10106377 | Ga0081455_101063772 | 121 |
| 166 | 3300005983 | Ga0081540_1048867 | Ga0081540_10488673 | 121 |
| 167 | 3300006028 | Ga0070717_10128448 | Ga0070717_101284483 | 121 |
| 168 | 3300006028 | Ga0070717_10238080 | Ga0070717_102380802 | 121 |
| 169 | 3300006038 | Ga0075365_10012541 | Ga0075365_100125414 | 121 |
| 170 | 3300006038 | Ga0075365_10039785 | Ga0075365_100397852 | 121 |
| 171 | 3300006038 | Ga0075365_10100286 | Ga0075365_101002862 | 121 |
| 172 | 3300006042 | Ga0075368_10283293 | Ga0075368_102832932 | 121 |
| 173 | 3300006048 | Ga0075363_100019810 | Ga0075363_1000198104 | 121 |
| 174 | 3300006048 | Ga0075363_100373654 | Ga0075363_1003736542 | 121 |
| 175 | 3300006048 | Ga0075363_101003995 | Ga0075363_1010039951 | 121 |
| 176 | 3300006051 | Ga0075364_10523514 | Ga0075364_105235142 | 121 |
| 177 | 3300006163 | Ga0070715_10569651 | Ga0070715_105696512 | 121 |
| 178 | 3300006173 | Ga0070716_100001907 | Ga0070716_1000019075 | 121 |
| 179 | 3300006175 | Ga0070712_100022694 | Ga0070712_1000226943 | 121 |
| 180 | 3300006177 | Ga0075362_10060294 | Ga0075362_100602942 | 121 |
| 181 | 3300006177 | Ga0075362_10183579 | Ga0075362_101835792 | 121 |
| 182 | 3300006177 | Ga0075362_10598125 | Ga0075362_105981252 | 121 |
| 183 | 3300006178 | Ga0075367_10096852 | Ga0075367_100968522 | 121 |
| 184 | 3300006178 | Ga0075367_10099824 | Ga0075367_100998243 | 121 |
| 185 | 3300006178 | Ga0075367_10127753 | Ga0075367_101277533 | 121 |
| 186 | 3300006178 | Ga0075367_10972276 | Ga0075367_109722762 | 121 |
| 187 | 3300006186 | Ga0075369_10100669 | Ga0075369_101006693 | 121 |
| 188 | 3300006186 | Ga0075369_10120731 | Ga0075369_101207312 | 121 |
| 189 | 3300006195 | Ga0075366_10008786 | Ga0075366_100087864 | 121 |
| 190 | 3300006237 | Ga0097621_101899187 | Ga0097621_1018991872 | 121 |
| 191 | 3300006353 | Ga0075370_10047941 | Ga0075370_100479412 | 121 |
| 192 | 3300006353 | Ga0075370_10133086 | Ga0075370_101330862 | 121 |
| 193 | 3300006358 | Ga0068871_100635702 | Ga0068871_1006357022 | 121 |
| 194 | 3300006914 | Ga0075436_100889635 | Ga0075436_1008896351 | 121 |
| 195 | 3300006942 | Ga0099824_1024667 | Ga0099824_10246671 | 121 |
| 196 | 3300006944 | Ga0099823_1070945 | Ga0099823_10709452 | 121 |
| 197 | 3300009011 | Ga0105251_10063426 | Ga0105251_100634263 | 121 |
| 198 | 3300009011 | Ga0105251_10210083 | Ga0105251_102100832 | 121 |
| 199 | 3300009036 | Ga0105244_10397525 | Ga0105244_103975252 | 121 |
| 200 | 3300009092 | Ga0105250_10012457 | Ga0105250_100124572 | 121 |
| 201 | 3300009093 | Ga0105240_10008853 | Ga0105240_100088537 | 121 |
| 202 | 3300009093 | Ga0105240_10020641 | Ga0105240_100206416 | 121 |
| 203 | 3300009093 | Ga0105240_10164739 | Ga0105240_101647392 | 121 |
| 204 | 3300009093 | Ga0105240_10465050 | Ga0105240_104650502 | 121 |
| 205 | 3300009093 | Ga0105240_11113435 | Ga0105240_111134352 | 121 |
| 206 | 3300009098 | Ga0105245_10336467 | Ga0105245_103364672 | 121 |
| 207 | 3300009098 | Ga0105245_10877220 | Ga0105245_108772202 | 121 |
| 208 | 3300009101 | Ga0105247_10122059 | Ga0105247_101220593 | 121 |
| 209 | 3300009101 | Ga0105247_10396142 | Ga0105247_103961422 | 121 |
| 210 | 3300009101 | Ga0105247_10803452 | Ga0105247_108034521 | 121 |
| 211 | 3300009148 | Ga0105243_10139868 | Ga0105243_101398682 | 121 |
| 212 | 3300009174 | Ga0105241_11457722 | Ga0105241_114577222 | 121 |
| 213 | 3300009176 | Ga0105242_10949479 | Ga0105242_109494791 | 121 |
| 214 | 3300009177 | Ga0105248_10001464 | Ga0105248_100014642 | 121 |
| 215 | 3300009177 | Ga0105248_10800750 | Ga0105248_108007502 | 121 |
| 216 | 3300009177 | Ga0105248_10860246 | Ga0105248_108602462 | 121 |
| 217 | 3300009177 | Ga0105248_12313384 | Ga0105248_123133842 | 121 |
| 218 | 3300009545 | Ga0105237_10014235 | Ga0105237_100142352 | 121 |
| 219 | 3300009545 | Ga0105237_10042891 | Ga0105237_100428914 | 121 |
| 220 | 3300009545 | Ga0105237_10139035 | Ga0105237_101390353 | 121 |
| 221 | 3300009545 | Ga0105237_10265701 | Ga0105237_102657012 | 121 |
| 222 | 3300009545 | Ga0105237_10644094 | Ga0105237_106440942 | 121 |
| 223 | 3300009545 | Ga0105237_11725061 | Ga0105237_117250612 | 121 |
| 224 | 3300009551 | Ga0105238_10063440 | Ga0105238_100634403 | 121 |
| 225 | 3300009551 | Ga0105238_10374439 | Ga0105238_103744392 | 121 |
| 226 | 3300009551 | Ga0105238_10791518 | Ga0105238_107915182 | 121 |
| 227 | 3300009551 | Ga0105238_11255130 | Ga0105238_112551301 | 121 |
| 228 | 3300009553 | Ga0105249_10339575 | Ga0105249_103395753 | 121 |
| 229 | 3300010375 | Ga0105239_10039622 | Ga0105239_100396224 | 121 |
| 230 | 3300010375 | Ga0105239_10079622 | Ga0105239_100796225 | 121 |
| 231 | 3300010375 | Ga0105239_10079805 | Ga0105239_100798053 | 121 |
| 232 | 3300010375 | Ga0105239_13536518 | Ga0105239_135365181 | 121 |
| 233 | 3300011119 | Ga0105246_10015578 | Ga0105246_100155782 | 121 |
| 234 | 3300013100 | Ga0157373_10307542 | Ga0157373_103075422 | 121 |
| 235 | 3300013102 | Ga0157371_10541086 | Ga0157371_105410861 | 121 |
| 236 | 3300013102 | Ga0157371_11115882 | Ga0157371_111158822 | 121 |
| 237 | 3300013104 | Ga0157370_10050197 | Ga0157370_100501973 | 121 |
| 238 | 3300013104 | Ga0157370_11160226 | Ga0157370_111602262 | 121 |
| 239 | 3300013105 | Ga0157369_10007758 | Ga0157369_100077584 | 121 |
| 240 | 3300013105 | Ga0157369_10009352 | Ga0157369_100093526 | 121 |
| 241 | 3300013105 | Ga0157369_10484841 | Ga0157369_104848412 | 121 |
| 242 | 3300013105 | Ga0157369_10729188 | Ga0157369_107291882 | 121 |
| 243 | 3300013296 | Ga0157374_10457643 | Ga0157374_104576432 | 121 |
| 244 | 3300013297 | Ga0157378_10433232 | Ga0157378_104332322 | 121 |
| 245 | 3300013306 | Ga0163162_10165287 | Ga0163162_101652873 | 121 |
| 246 | 3300013307 | Ga0157372_10213404 | Ga0157372_102134042 | 121 |
| 247 | 3300013307 | Ga0157372_10476886 | Ga0157372_104768862 | 121 |
| 248 | 3300013308 | Ga0157375_10136536 | Ga0157375_101365364 | 121 |
| 249 | 3300014325 | Ga0163163_10071930 | Ga0163163_100719304 | 121 |
| 250 | 3300014325 | Ga0163163_10536565 | Ga0163163_105365652 | 121 |
| 251 | 3300014497 | Ga0182008_10855741 | Ga0182008_108557411 | 121 |
| 252 | 3300014968 | Ga0157379_10058879 | Ga0157379_100588792 | 121 |
| 253 | 3300014968 | Ga0157379_10603277 | Ga0157379_106032772 | 121 |
| 254 | 3300014968 | Ga0157379_12117066 | Ga0157379_121170661 | 121 |
| 255 | 3300014969 | Ga0157376_10096295 | Ga0157376_100962953 | 121 |
| 256 | 3300021358 | Ga0213873_10010521 | Ga0213873_100105212 | 121 |
| 257 | 3300021361 | Ga0213872_10370683 | Ga0213872_103706832 | 121 |
| 258 | 3300021384 | Ga0213876_10065160 | Ga0213876_100651603 | 121 |
| 259 | 3300021384 | Ga0213876_10103445 | Ga0213876_101034452 | 121 |
| 260 | 3300021388 | Ga0213875_10119834 | Ga0213875_101198342 | 121 |
| 261 | 3300021388 | Ga0213875_10122984 | Ga0213875_101229841 | 121 |
| 262 | 3300021441 | Ga0213871_10007632 | Ga0213871_100076323 | 121 |
| 263 | 3300025245 | Ga0207425_1010576 | Ga0207425_10105762 | 121 |
| 264 | 3300025254 | Ga0209148_1000421 | Ga0209148_100042125 | 121 |
| 265 | 3300025254 | Ga0209148_1016562 | Ga0209148_10165622 | 121 |
| 266 | 3300025254 | Ga0209148_1043097 | Ga0209148_10430971 | 121 |
| 267 | 3300025261 | Ga0209233_1002484 | Ga0209233_10024844 | 121 |
| 268 | 3300025261 | Ga0209233_1002615 | Ga0209233_10026154 | 121 |
| 269 | 3300025261 | Ga0209233_1017000 | Ga0209233_10170003 | 121 |
| 270 | 3300025272 | Ga0209455_1007536 | Ga0209455_10075362 | 121 |
| 271 | 3300025284 | Ga0209130_1081120 | Ga0209130_10811202 | 121 |
| 272 | 3300025295 | Ga0209564_1000044 | Ga0209564_1000044159 | 121 |
| 273 | 3300025295 | Ga0209564_1004705 | Ga0209564_10047056 | 121 |
| 274 | 3300025295 | Ga0209564_1014807 | Ga0209564_10148074 | 121 |
| 275 | 3300025297 | Ga0209758_1000117 | Ga0209758_100011749 | 121 |
| 276 | 3300025297 | Ga0209758_1000506 | Ga0209758_100050645 | 121 |
| 277 | 3300025297 | Ga0209758_1001068 | Ga0209758_100106811 | 121 |
| 278 | 3300025297 | Ga0209758_1001793 | Ga0209758_100179311 | 121 |
| 279 | 3300025297 | Ga0209758_1003491 | Ga0209758_10034916 | 121 |
| 280 | 3300025297 | Ga0209758_1007058 | Ga0209758_10070583 | 121 |
| 281 | 3300025298 | Ga0209050_1070340 | Ga0209050_10703402 | 121 |
| 282 | 3300025299 | Ga0209256_1000740 | Ga0209256_100074034 | 121 |
| 283 | 3300025299 | Ga0209256_1007255 | Ga0209256_10072552 | 121 |
| 284 | 3300025299 | Ga0209256_1008199 | Ga0209256_10081995 | 121 |
| 285 | 3300025302 | Ga0207426_1000467 | Ga0207426_100046755 | 121 |
| 286 | 3300025302 | Ga0207426_1000508 | Ga0207426_100050836 | 121 |
| 287 | 3300025302 | Ga0207426_1006582 | Ga0207426_10065822 | 121 |
| 288 | 3300025302 | Ga0207426_1023419 | Ga0207426_10234193 | 121 |
| 289 | 3300025302 | Ga0207426_1075361 | Ga0207426_10753612 | 121 |
| 290 | 3300025302 | Ga0207426_1103153 | Ga0207426_11031532 | 121 |
| 291 | 3300025303 | Ga0209051_1030114 | Ga0209051_10301142 | 121 |
| 292 | 3300025304 | Ga0209257_1000158 | Ga0209257_1000158142 | 121 |
| 293 | 3300025304 | Ga0209257_1023507 | Ga0209257_10235073 | 121 |
| 294 | 3300025898 | Ga0207692_10001796 | Ga0207692_100017964 | 121 |
| 295 | 3300025900 | Ga0207710_10023967 | Ga0207710_100239672 | 121 |
| 296 | 3300025900 | Ga0207710_10318232 | Ga0207710_103182322 | 121 |
| 297 | 3300025901 | Ga0207688_10138968 | Ga0207688_101389682 | 121 |
| 298 | 3300025903 | Ga0207680_10052867 | Ga0207680_100528673 | 121 |
| 299 | 3300025904 | Ga0207647_10006024 | Ga0207647_100060242 | 121 |
| 300 | 3300025904 | Ga0207647_10146688 | Ga0207647_101466882 | 121 |
| 301 | 3300025905 | Ga0207685_10315612 | Ga0207685_103156122 | 121 |
| 302 | 3300025906 | Ga0207699_10000749 | Ga0207699_1000074911 | 121 |
| 303 | 3300025912 | Ga0207707_10660765 | Ga0207707_106607651 | 121 |
| 304 | 3300025913 | Ga0207695_10000136 | Ga0207695_1000013658 | 121 |
| 305 | 3300025913 | Ga0207695_10019551 | Ga0207695_100195514 | 121 |
| 306 | 3300025913 | Ga0207695_10113023 | Ga0207695_101130233 | 121 |
| 307 | 3300025913 | Ga0207695_10201059 | Ga0207695_102010593 | 121 |
| 308 | 3300025913 | Ga0207695_11137786 | Ga0207695_111377861 | 121 |
| 309 | 3300025914 | Ga0207671_10000202 | Ga0207671_1000020227 | 121 |
| 310 | 3300025914 | Ga0207671_10136125 | Ga0207671_101361252 | 121 |
| 311 | 3300025914 | Ga0207671_10171842 | Ga0207671_101718422 | 121 |
| 312 | 3300025914 | Ga0207671_10285439 | Ga0207671_102854392 | 121 |
| 313 | 3300025914 | Ga0207671_10556070 | Ga0207671_105560702 | 121 |
| 314 | 3300025915 | Ga0207693_10176854 | Ga0207693_101768542 | 121 |
| 315 | 3300025915 | Ga0207693_10227360 | Ga0207693_102273601 | 121 |
| 316 | 3300025916 | Ga0207663_10001805 | Ga0207663_100018052 | 121 |
| 317 | 3300025919 | Ga0207657_10304669 | Ga0207657_103046692 | 121 |
| 318 | 3300025919 | Ga0207657_10332726 | Ga0207657_103327262 | 121 |
| 319 | 3300025919 | Ga0207657_10392953 | Ga0207657_103929533 | 121 |
| 320 | 3300025920 | Ga0207649_10874190 | Ga0207649_108741902 | 121 |
| 321 | 3300025921 | Ga0207652_10150356 | Ga0207652_101503562 | 121 |
| 322 | 3300025921 | Ga0207652_10313972 | Ga0207652_103139722 | 121 |
| 323 | 3300025923 | Ga0207681_10762870 | Ga0207681_107628701 | 121 |
| 324 | 3300025924 | Ga0207694_10079372 | Ga0207694_100793722 | 121 |
| 325 | 3300025924 | Ga0207694_10092566 | Ga0207694_100925664 | 121 |
| 326 | 3300025924 | Ga0207694_10934411 | Ga0207694_109344112 | 121 |
| 327 | 3300025924 | Ga0207694_11431450 | Ga0207694_114314501 | 121 |
| 328 | 3300025925 | Ga0207650_10212832 | Ga0207650_102128322 | 121 |
| 329 | 3300025925 | Ga0207650_11610041 | Ga0207650_116100411 | 121 |
| 330 | 3300025927 | Ga0207687_10652712 | Ga0207687_106527122 | 121 |
| 331 | 3300025928 | Ga0207700_10004852 | Ga0207700_100048524 | 121 |
| 332 | 3300025928 | Ga0207700_10169014 | Ga0207700_101690142 | 121 |
| 333 | 3300025928 | Ga0207700_11201268 | Ga0207700_112012682 | 121 |
| 334 | 3300025929 | Ga0207664_10053425 | Ga0207664_100534254 | 121 |
| 335 | 3300025929 | Ga0207664_10151837 | Ga0207664_101518372 | 121 |
| 336 | 3300025932 | Ga0207690_10106076 | Ga0207690_101060762 | 121 |
| 337 | 3300025933 | Ga0207706_10100034 | Ga0207706_101000343 | 121 |
| 338 | 3300025934 | Ga0207686_10905971 | Ga0207686_109059712 | 121 |
| 339 | 3300025935 | Ga0207709_10130291 | Ga0207709_101302912 | 121 |
| 340 | 3300025939 | Ga0207665_10002001 | Ga0207665_100020019 | 121 |
| 341 | 3300025941 | Ga0207711_10001333 | Ga0207711_100013332 | 121 |
| 342 | 3300025941 | Ga0207711_10567296 | Ga0207711_105672961 | 121 |
| 343 | 3300025942 | Ga0207689_10634348 | Ga0207689_106343482 | 121 |
| 344 | 3300025944 | Ga0207661_10013432 | Ga0207661_100134324 | 121 |
| 345 | 3300025944 | Ga0207661_10062354 | Ga0207661_100623543 | 121 |
| 346 | 3300025944 | Ga0207661_11599670 | Ga0207661_115996702 | 121 |
| 347 | 3300025949 | Ga0207667_10441570 | Ga0207667_104415702 | 121 |
| 348 | 3300025949 | Ga0207667_10707351 | Ga0207667_107073512 | 121 |
| 349 | 3300025960 | Ga0207651_10220893 | Ga0207651_102208932 | 121 |
| 350 | 3300025961 | Ga0207712_10907609 | Ga0207712_109076092 | 121 |
| 351 | 3300025972 | Ga0207668_11197751 | Ga0207668_111977512 | 121 |
| 352 | 3300025981 | Ga0207640_10514171 | Ga0207640_105141711 | 121 |
| 353 | 3300026035 | Ga0207703_10000571 | Ga0207703_1000057114 | 121 |
| 354 | 3300026041 | Ga0207639_10186688 | Ga0207639_101866882 | 121 |
| 355 | 3300026041 | Ga0207639_10277379 | Ga0207639_102773792 | 121 |
| 356 | 3300026041 | Ga0207639_10729666 | Ga0207639_107296662 | 121 |
| 357 | 3300026041 | Ga0207639_11020290 | Ga0207639_110202902 | 121 |
| 358 | 3300026067 | Ga0207678_10055007 | Ga0207678_100550072 | 121 |
| 359 | 3300026067 | Ga0207678_10066190 | Ga0207678_100661903 | 121 |
| 360 | 3300026067 | Ga0207678_10202709 | Ga0207678_102027092 | 121 |
| 361 | 3300026067 | Ga0207678_10883620 | Ga0207678_108836202 | 121 |
| 362 | 3300026067 | Ga0207678_11713587 | Ga0207678_117135872 | 121 |
| 363 | 3300026075 | Ga0207708_11822248 | Ga0207708_118222481 | 121 |
| 364 | 3300026078 | Ga0207702_10283974 | Ga0207702_102839742 | 121 |
| 365 | 3300026088 | Ga0207641_10000067 | Ga0207641_10000067152 | 121 |
| 366 | 3300026088 | Ga0207641_10180966 | Ga0207641_101809662 | 121 |
| 367 | 3300026089 | Ga0207648_10105282 | Ga0207648_101052823 | 121 |
| 368 | 3300026095 | Ga0207676_10001977 | Ga0207676_1000197712 | 121 |
| 369 | 3300026095 | Ga0207676_11361098 | Ga0207676_113610982 | 121 |
| 370 | 3300026095 | Ga0207676_11816878 | Ga0207676_118168782 | 121 |
| 371 | 3300026095 | Ga0207676_12502286 | Ga0207676_125022861 | 121 |
| 372 | 3300026116 | Ga0207674_10295232 | Ga0207674_102952323 | 121 |
| 373 | 3300026116 | Ga0207674_10851309 | Ga0207674_108513092 | 121 |
| 374 | 3300026118 | Ga0207675_100260059 | Ga0207675_1002600593 | 121 |
| 375 | 3300026121 | Ga0207683_10091813 | Ga0207683_100918132 | 121 |
| 376 | 3300027111 | Ga0209281_1027067 | Ga0209281_10270672 | 121 |
| 377 | 3300027296 | Ga0209389_1000056 | Ga0209389_100005635 | 121 |
| 378 | 3300027296 | Ga0209389_1000206 | Ga0209389_100020633 | 121 |
| 379 | 3300027357 | Ga0209589_1000034 | Ga0209589_1000034109 | 121 |
| 380 | 3300027361 | Ga0209489_100009 | Ga0209489_10000975 | 121 |
| 381 | 3300027361 | Ga0209489_103071 | Ga0209489_10307122 | 121 |
| 382 | 3300027363 | Ga0209700_100471 | Ga0209700_10047113 | 121 |
| 383 | 3300027866 | Ga0209813_10107735 | Ga0209813_101077352 | 121 |
| 384 | 3300027866 | Ga0209813_10144029 | Ga0209813_101440292 | 121 |
| 385 | 3300028379 | Ga0268266_10133830 | Ga0268266_101338302 | 121 |
| 386 | 3300028379 | Ga0268266_10933498 | Ga0268266_109334982 | 121 |
| 387 | 3300028380 | Ga0268265_10149380 | Ga0268265_101493802 | 121 |
| 388 | 3300028381 | Ga0268264_10473708 | Ga0268264_104737082 | 121 |
| 389 | 3300028800 | Ga0265338_10009258 | Ga0265338_100092583 | 121 |
| 390 | 3300031901 | Ga0307406_10109482 | Ga0307406_101094822 | 121 |
| 391 | 3300031901 | Ga0307406_10339551 | Ga0307406_103395512 | 121 |
| 392 | 3300031995 | Ga0307409_100840991 | Ga0307409_1008409911 | 121 |
| 393 | 3300033180 | Ga0307510_10063444 | Ga0307510_100634445 | 121 |
| 394 | 3300035170 | Ga0373943_0848637 | Ga0373943_0848637_149_514 | 121 |
| 395 | 3300035691 | Ga0373931_0375875 | Ga0373931_0375875_234_599 | 121 |
| 396 | 3300037068 | Ga0373925_0065376 | Ga0373925_0065376_1477_1842 | 121 |
| 397 | 3300037312 | Ga0395899_0112185 | Ga0395899_0112185_934_1299 | 121 |
| 398 | 3300037312 | Ga0395899_0206251 | Ga0395899_0206251_141_506 | 121 |
| 399 | 3300037418 | Ga0395900_0003815 | Ga0395900_0003815_256_621 | 121 |
| 400 | 3300037418 | Ga0395900_0033307 | Ga0395900_0033307_3451_3816 | 121 |
| 401 | 3300037418 | Ga0395900_0057751 | Ga0395900_0057751_2131_2496 | 121 |
| 402 | 3300037418 | Ga0395900_0723873 | Ga0395900_0723873_189_554 | 121 |
| 403 | 3300037418 | Ga0395900_0904579 | Ga0395900_0904579_426_791 | 121 |
| 404 | 3300037466 | Ga0395898_0007171 | Ga0395898_0007171_3265_3630 | 121 |
| 405 | 3300037466 | Ga0395898_0022885 | Ga0395898_0022885_4852_5217 | 121 |
| 406 | 3300037466 | Ga0395898_0097903 | Ga0395898_0097903_1313_1678 | 121 |
| 407 | 3300037471 | Ga0395905_0637162 | Ga0395905_0637162_275_640 | 121 |
| 408 | 3300037471 | Ga0395905_0894013 | Ga0395905_0894013_249_614 | 121 |
| 409 | 3300037853 | Ga0436364_0487949 | Ga0436364_0487949_1623_1988 | 121 |
| 410 | 3300037853 | Ga0436364_0646122 | Ga0436364_0646122_1198_1563 | 121 |
| 411 | 3300037853 | Ga0436364_0899392 | Ga0436364_0899392_2530_2895 | 121 |
| 412 | 3300037853 | Ga0436364_1201854 | Ga0436364_1201854_466_831 | 121 |
| 413 | 3300038443 | Ga0395901_0017745 | Ga0395901_0017745_3666_4031 | 121 |
| 414 | 3300038443 | Ga0395901_0072187 | Ga0395901_0072187_1609_1974 | 121 |
| 415 | 3300039437 | Ga0436365_0167269 | Ga0436365_0167269_168_533 | 121 |
| 416 | 3300039437 | Ga0436365_0642071 | Ga0436365_0642071_1185_1550 | 121 |
| 417 | 3300039437 | Ga0436365_0817878 | Ga0436365_0817878_154_519 | 121 |
| 418 | 3300039437 | Ga0436365_1667821 | Ga0436365_1667821_296_664 | 121 |
| 419 | 3300039438 | Ga0436360_0463479 | Ga0436360_0463479_1211_1576 | 121 |
| 420 | 3300039438 | Ga0436360_0628778 | Ga0436360_0628778_427_792 | 121 |
| 421 | 3300039447 | Ga0436361_0238145 | Ga0436361_0238145_6077_6442 | 121 |
| 422 | 3300039447 | Ga0436361_0488424 | Ga0436361_0488424_1406_1771 | 121 |
| 423 | 3300039450 | Ga0436363_0656246 | Ga0436363_0656246_177_542 | 121 |
| 424 | 3300039450 | Ga0436363_1420126 | Ga0436363_1420126_410_775 | 121 |
| 425 | 3300039453 | Ga0436362_0085232 | Ga0436362_0085232_1749_2114 | 121 |
| 426 | 3300039453 | Ga0436362_0120734 | Ga0436362_0120734_193_558 | 121 |
| 427 | 3300041509 | Ga0451843_0121359 | Ga0451843_0121359_13_378 | 121 |
| 428 | 3300041512 | Ga0451853_2243521 | Ga0451853_2243521_256_621 | 121 |
| 429 | 3300042005 | Ga0439448_0145914 | Ga0439448_0145914_334_699 | 121 |
| 430 | 3300042012 | Ga0439455_0091643 | Ga0439455_0091643_455_820 | 121 |
| 431 | 3300044658 | Ga0466972_0013574 | Ga0466972_0013574_3340_3705 | 121 |
| 432 | 3300044658 | Ga0466972_0060680 | Ga0466972_0060680_120_485 | 121 |
| 433 | 3300044658 | Ga0466972_0148323 | Ga0466972_0148323_167_532 | 121 |
| 434 | 3300044683 | Ga0466965_0014378 | Ga0466965_0014378_2699_3064 | 121 |
| 435 | 3300044683 | Ga0466965_0126215 | Ga0466965_0126215_380_745 | 121 |
| 436 | 3300044684 | Ga0466966_0000101 | Ga0466966_0000101_5571_5936 | 121 |
| 437 | 3300044684 | Ga0466966_0529581 | Ga0466966_0529581_273_638 | 121 |
| 438 | 3300044693 | Ga0466961_0000031 | Ga0466961_0000031_37994_38359 | 121 |
| 439 | 3300044693 | Ga0466961_0389363 | Ga0466961_0389363_211_576 | 121 |
| 440 | 3300044693 | Ga0466961_0614709 | Ga0466961_0614709_188_553 | 121 |
| 441 | 3300044694 | Ga0466963_0071739 | Ga0466963_0071739_867_1232 | 121 |
| 442 | 3300044706 | Ga0466964_0062459 | Ga0466964_0062459_1023_1388 | 121 |
| 443 | 3300044706 | Ga0466964_0559434 | Ga0466964_0559434_238_603 | 121 |
| 444 | 3300044706 | Ga0466964_0583370 | Ga0466964_0583370_24_389 | 121 |
| 445 | 3300044712 | Ga0453684_0178352 | Ga0453684_0178352_396_773 | 121 |
| 446 | 3300044735 | Ga0466968_0007772 | Ga0466968_0007772_947_1312 | 121 |
| 447 | 3300044735 | Ga0466968_0059574 | Ga0466968_0059574_291_656 | 121 |
| 448 | 3300044735 | Ga0466968_0379882 | Ga0466968_0379882_25_390 | 121 |
| 449 | 3300044735 | Ga0466968_0589379 | Ga0466968_0589379_159_524 | 121 |
| 450 | 3300044765 | Ga0466970_0250820 | Ga0466970_0250820_418_783 | 121 |
| 451 | 3300044765 | Ga0466970_0752107 | Ga0466970_0752107_153_518 | 121 |
| 452 | 3300044842 | Ga0466957_0063501 | Ga0466957_0063501_972_1337 | 121 |
| 453 | 3300044842 | Ga0466957_0363544 | Ga0466957_0363544_374_739 | 121 |
| 454 | 3300044901 | Ga0466960_0097023 | Ga0466960_0097023_469_834 | 121 |
| 455 | 3300044901 | Ga0466960_0262608 | Ga0466960_0262608_202_567 | 121 |
| 456 | 3300044901 | Ga0466960_0300008 | Ga0466960_0300008_516_881 | 121 |
| 457 | 3300044901 | Ga0466960_0480463 | Ga0466960_0480463_319_684 | 121 |
| 458 | 3300044901 | Ga0466960_0588463 | Ga0466960_0588463_216_581 | 121 |
| 459 | 3300045049 | Ga0466959_0002988 | Ga0466959_0002988_4820_5185 | 121 |
| 460 | 3300045049 | Ga0466959_0083616 | Ga0466959_0083616_332_697 | 121 |
| 461 | 3300045049 | Ga0466959_0698176 | Ga0466959_0698176_96_461 | 121 |
| 462 | 3300045049 | Ga0466959_0785759 | Ga0466959_0785759_198_566 | 121 |
| 463 | 3300045051 | Ga0451576_0014014 | Ga0451576_0014014_8489_8866 | 121 |
| 464 | 3300045836 | Ga0466958_0241916 | Ga0466958_0241916_622_987 | 121 |
| 465 | 3300045976 | Ga0466967_0332903 | Ga0466967_0332903_684_1049 | 121 |
| 466 | 3300045976 | Ga0466967_1234914 | Ga0466967_1234914_143_508 | 121 |
| 467 | 3300046454 | Ga0495592_0636056 | Ga0495592_0636056_121_486 | 121 |
| 468 | 3300046455 | Ga0495603_0153940 | Ga0495603_0153940_330_695 | 121 |
| 469 | 3300046459 | Ga0495629_0002586 | Ga0495629_0002586_4343_4708 | 121 |
| 470 | 3300046460 | Ga0495638_0094972 | Ga0495638_0094972_11_376 | 121 |
| 471 | 3300046460 | Ga0495638_0293832 | Ga0495638_0293832_98_463 | 121 |
| 472 | 3300046460 | Ga0495638_0339974 | Ga0495638_0339974_151_516 | 121 |
| 473 | 3300046461 | Ga0495641_0222418 | Ga0495641_0222418_334_699 | 121 |
| 474 | 3300046463 | Ga0495653_0458474 | Ga0495653_0458474_386_751 | 121 |
| 475 | 3300046473 | Ga0495582_0345380 | Ga0495582_0345380_333_698 | 121 |
| 476 | 3300046474 | Ga0495605_0036646 | Ga0495605_0036646_1688_2053 | 121 |
| 477 | 3300046491 | Ga0495584_0321586 | Ga0495584_0321586_331_696 | 121 |
| 478 | 3300046492 | Ga0495585_0132759 | Ga0495585_0132759_640_1005 | 121 |
| 479 | 3300046492 | Ga0495585_0593259 | Ga0495585_0593259_57_422 | 121 |
| 480 | 3300046499 | Ga0495594_0329073 | Ga0495594_0329073_365_730 | 121 |
| 481 | 3300046501 | Ga0495607_0265039 | Ga0495607_0265039_391_756 | 121 |
| 482 | 3300046507 | Ga0495606_0359973 | Ga0495606_0359973_224_589 | 121 |
| 483 | 3300046511 | Ga0495608_0132808 | Ga0495608_0132808_1057_1422 | 121 |
| 484 | 3300046512 | Ga0495610_0041005 | Ga0495610_0041005_1741_2106 | 121 |
| 485 | 3300046514 | Ga0495618_0183521 | Ga0495618_0183521_530_895 | 121 |
| 486 | 3300046515 | Ga0495620_0101613 | Ga0495620_0101613_437_802 | 121 |
| 487 | 3300046515 | Ga0495620_0147040 | Ga0495620_0147040_371_736 | 121 |
| 488 | 3300046516 | Ga0495628_0127789 | Ga0495628_0127789_154_519 | 121 |
| 489 | 3300046516 | Ga0495628_0516394 | Ga0495628_0516394_261_626 | 121 |
| 490 | 3300046518 | Ga0495631_0178471 | Ga0495631_0178471_304_669 | 121 |
| 491 | 3300046519 | Ga0495632_0267632 | Ga0495632_0267632_177_542 | 121 |
| 492 | 3300046522 | Ga0495643_0014632 | Ga0495643_0014632_3010_3375 | 121 |
| 493 | 3300046522 | Ga0495643_0112256 | Ga0495643_0112256_965_1330 | 121 |
| 494 | 3300046524 | Ga0495648_0191101 | Ga0495648_0191101_87_452 | 121 |
| 495 | 3300046526 | Ga0495666_0446195 | Ga0495666_0446195_42_407 | 121 |
| 496 | 3300046529 | Ga0495652_0642276 | Ga0495652_0642276_76_441 | 121 |
| 497 | 3300046530 | Ga0495654_0071188 | Ga0495654_0071188_627_992 | 121 |
| 498 | 3300046533 | Ga0495640_0038244 | Ga0495640_0038244_1738_2103 | 121 |
| 499 | 3300046538 | Ga0495609_0064268 | Ga0495609_0064268_702_1067 | 121 |
| 500 | 3300046542 | Ga0495597_0068827 | Ga0495597_0068827_595_960 | 121 |
| 501 | 3300046557 | Ga0495622_0145679 | Ga0495622_0145679_122_487 | 121 |
| 502 | 3300046616 | Ga0495668_0256370 | Ga0495668_0256370_408_773 | 121 |
| 503 | 3300046648 | Ga0495611_0052320 | Ga0495611_0052320_952_1317 | 121 |
| 504 | 3300046660 | Ga0495625_0396047 | Ga0495625_0396047_371_736 | 121 |
| 505 | 3300046660 | Ga0495625_0830418 | Ga0495625_0830418_130_495 | 121 |
| 506 | 3300046674 | Ga0495588_0013855 | Ga0495588_0013855_1666_2031 | 121 |
| 507 | 3300046674 | Ga0495588_0258802 | Ga0495588_0258802_301_666 | 121 |
| 508 | 3300046675 | Ga0495657_0013301 | Ga0495657_0013301_445_810 | 121 |
| 509 | 3300046680 | Ga0495646_0115628 | Ga0495646_0115628_513_878 | 121 |
| 510 | 3300046683 | Ga0495658_0213925 | Ga0495658_0213925_276_641 | 121 |
| 511 | 3300046689 | Ga0495613_0050253 | Ga0495613_0050253_1865_2230 | 121 |
| 512 | 3300046690 | Ga0495624_0043108 | Ga0495624_0043108_16_381 | 121 |
| 513 | 3300046692 | Ga0495671_0428953 | Ga0495671_0428953_100_465 | 121 |
| 514 | 3300046694 | Ga0495649_0155091 | Ga0495649_0155091_349_714 | 121 |
| 515 | 3300046694 | Ga0495649_0382430 | Ga0495649_0382430_311_676 | 121 |
| 516 | 3300046794 | Ga0495589_0063125 | Ga0495589_0063125_832_1197 | 121 |
| 517 | 3300046809 | Ga0495600_0185527 | Ga0495600_0185527_23_388 | 121 |
| 518 | 3300046810 | Ga0495660_0283013 | Ga0495660_0283013_219_584 | 121 |
| 519 | 3300047315 | Ga0495581_0106771 | Ga0495581_0106771_845_1210 | 121 |
| 520 | 3300047317 | Ga0495604_0061880 | Ga0495604_0061880_132_497 | 121 |
| 521 | 3300047319 | Ga0495674_0404264 | Ga0495674_0404264_319_684 | 121 |
| 522 | 3300047320 | Ga0495672_0044926 | Ga0495672_0044926_218_583 | 121 |
| 523 | 3300047320 | Ga0495672_0090267 | Ga0495672_0090267_830_1195 | 121 |
| 524 | 3300047320 | Ga0495672_0228800 | Ga0495672_0228800_126_491 | 121 |
| 525 | 3300047320 | Ga0495672_0268228 | Ga0495672_0268228_402_770 | 121 |
| 526 | 3300047321 | Ga0495676_0063382 | Ga0495676_0063382_1475_1840 | 121 |
| 527 | 3300047323 | Ga0495683_0144990 | Ga0495683_0144990_24_389 | 121 |
| 528 | 3300047443 | Ga0495687_083087 | Ga0495687_083087_717_1082 | 121 |
| 529 | 3300047443 | Ga0495687_097577 | Ga0495687_097577_485_850 | 121 |
| 530 | 3300047469 | Ga0495673_0062574 | Ga0495673_0062574_557_922 | 121 |
| 531 | 3300048088 | Ga0495602_0109321 | Ga0495602_0109321_401_766 | 121 |
| 532 | 3300048091 | Ga0495626_0170316 | Ga0495626_0170316_433_798 | 121 |
| 533 | 3300048903 | Ga0496100_0615052 | Ga0496100_0615052_57_422 | 121 |
| 534 | 3300048904 | Ga0496101_0163326 | Ga0496101_0163326_122_487 | 121 |
| 535 | 3300048905 | Ga0496102_0074188 | Ga0496102_0074188_1618_1983 | 121 |
| 536 | 3300048905 | Ga0496102_0712961 | Ga0496102_0712961_461_826 | 121 |
| 537 | 3300048905 | Ga0496102_1042382 | Ga0496102_1042382_234_599 | 121 |
| 538 | 3300048906 | Ga0496103_0241856 | Ga0496103_0241856_253_618 | 121 |
| 539 | 3300048906 | Ga0496103_0261166 | Ga0496103_0261166_187_552 | 121 |
| 540 | 3300048907 | Ga0496104_0001655 | Ga0496104_0001655_4526_4891 | 121 |
| 541 | 3300048907 | Ga0496104_0057112 | Ga0496104_0057112_1902_2267 | 121 |
| 542 | 3300048907 | Ga0496104_0903684 | Ga0496104_0903684_312_677 | 121 |
| 543 | 3300048908 | Ga0496105_0015424 | Ga0496105_0015424_5681_6046 | 121 |
| 544 | 3300048909 | Ga0496106_0094426 | Ga0496106_0094426_1515_1880 | 121 |
| 545 | 3300048911 | Ga0496108_0505547 | Ga0496108_0505547_388_753 | 121 |
| 546 | 3300048912 | Ga0496109_0754511 | Ga0496109_0754511_316_681 | 121 |
| 547 | 3300048912 | Ga0496109_1859875 | Ga0496109_1859875_11_376 | 121 |
| 548 | 3300048913 | Ga0496110_0157888 | Ga0496110_0157888_1205_1570 | 121 |
| 549 | 3300048913 | Ga0496110_0880568 | Ga0496110_0880568_273_638 | 121 |
| 550 | 3300048913 | Ga0496110_1558871 | Ga0496110_1558871_171_536 | 121 |
| 551 | 3300048914 | Ga0496111_0711005 | Ga0496111_0711005_176_541 | 121 |
| 552 | 3300048914 | Ga0496111_1031510 | Ga0496111_1031510_119_484 | 121 |
| 553 | 3300048915 | Ga0496112_0064774 | Ga0496112_0064774_1163_1528 | 121 |
| 554 | 3300048915 | Ga0496112_0390349 | Ga0496112_0390349_101_466 | 121 |
| 555 | 3300048916 | Ga0496113_0119847 | Ga0496113_0119847_64_429 | 121 |
| 556 | 3300048916 | Ga0496113_0179175 | Ga0496113_0179175_1174_1539 | 121 |
| 557 | 3300048916 | Ga0496113_0347813 | Ga0496113_0347813_598_963 | 121 |
| 558 | 3300048917 | Ga0496114_0392099 | Ga0496114_0392099_564_929 | 121 |
| 559 | 3300048917 | Ga0496114_0769788 | Ga0496114_0769788_94_459 | 121 |
| 560 | 3300048918 | Ga0496115_0059021 | Ga0496115_0059021_342_707 | 121 |
| 561 | 3300048918 | Ga0496115_0154337 | Ga0496115_0154337_820_1185 | 121 |
| 562 | 3300048919 | Ga0496116_0009012 | Ga0496116_0009012_5936_6301 | 121 |
| 563 | 3300048919 | Ga0496116_0053528 | Ga0496116_0053528_10_375 | 121 |
| 564 | 3300048920 | Ga0496117_0014560 | Ga0496117_0014560_2846_3211 | 121 |
| 565 | 3300048920 | Ga0496117_0243084 | Ga0496117_0243084_113_478 | 121 |
| 566 | 3300048920 | Ga0496117_0418051 | Ga0496117_0418051_282_647 | 121 |
| 567 | 3300048921 | Ga0496118_0024327 | Ga0496118_0024327_599_964 | 121 |
| 568 | 3300048921 | Ga0496118_0025294 | Ga0496118_0025294_1139_1504 | 121 |
| 569 | 3300048921 | Ga0496118_0087742 | Ga0496118_0087742_1108_1473 | 121 |
| 570 | 3300048921 | Ga0496118_0222622 | Ga0496118_0222622_214_579 | 121 |
| 571 | 3300048922 | Ga0496119_0011533 | Ga0496119_0011533_6114_6479 | 121 |
| 572 | 3300048922 | Ga0496119_0016058 | Ga0496119_0016058_921_1286 | 121 |
| 573 | 3300048922 | Ga0496119_0342863 | Ga0496119_0342863_38_403 | 121 |
| 574 | 3300048922 | Ga0496119_0360104 | Ga0496119_0360104_134_499 | 121 |
| 575 | 3300048922 | Ga0496119_0388918 | Ga0496119_0388918_54_419 | 121 |
| 576 | 3300048923 | Ga0496120_0003849 | Ga0496120_0003849_5723_6088 | 121 |
| 577 | 3300048923 | Ga0496120_0173894 | Ga0496120_0173894_98_463 | 121 |
| 578 | 3300048924 | Ga0496121_0000152 | Ga0496121_0000152_80419_80784 | 121 |
| 579 | 3300048924 | Ga0496121_0013561 | Ga0496121_0013561_5010_5375 | 121 |
| 580 | 3300048924 | Ga0496121_0014668 | Ga0496121_0014668_1905_2270 | 121 |
| 581 | 3300048924 | Ga0496121_0026715 | Ga0496121_0026715_4769_5134 | 121 |
| 582 | 3300048924 | Ga0496121_0043563 | Ga0496121_0043563_1047_1412 | 121 |
| 583 | 3300048924 | Ga0496121_0049950 | Ga0496121_0049950_24_389 | 121 |
| 584 | 3300048924 | Ga0496121_0121794 | Ga0496121_0121794_1310_1675 | 121 |
| 585 | 3300048925 | Ga0496122_0047803 | Ga0496122_0047803_1656_2021 | 121 |
| 586 | 3300048925 | Ga0496122_0297606 | Ga0496122_0297606_303_668 | 121 |
| 587 | 3300048925 | Ga0496122_0314650 | Ga0496122_0314650_174_539 | 121 |
| 588 | 3300048926 | Ga0496123_0084176 | Ga0496123_0084176_47_412 | 121 |
| 589 | 3300048927 | Ga0496124_0371906 | Ga0496124_0371906_165_530 | 121 |
| 590 | 3300048927 | Ga0496124_0576293 | Ga0496124_0576293_97_462 | 121 |
| 591 | 3300048927 | Ga0496124_0934270 | Ga0496124_0934270_108_473 | 121 |
| 592 | 3300048928 | Ga0496125_0016187 | Ga0496125_0016187_4836_5201 | 121 |
| 593 | 3300048929 | Ga0496126_0002980 | Ga0496126_0002980_14205_14570 | 121 |
| 594 | 3300048929 | Ga0496126_0016467 | Ga0496126_0016467_5172_5537 | 121 |
| 595 | 3300048929 | Ga0496126_0026746 | Ga0496126_0026746_2398_2763 | 121 |
| 596 | 3300048929 | Ga0496126_0030510 | Ga0496126_0030510_3078_3443 | 121 |
| 597 | 3300048929 | Ga0496126_0076527 | Ga0496126_0076527_1392_1757 | 121 |
| 598 | 3300048929 | Ga0496126_0142002 | Ga0496126_0142002_487_852 | 121 |
| 599 | 3300048929 | Ga0496126_0173888 | Ga0496126_0173888_1195_1560 | 121 |
| 600 | 3300048929 | Ga0496126_0182774 | Ga0496126_0182774_1303_1668 | 121 |
| 601 | 3300048929 | Ga0496126_0194501 | Ga0496126_0194501_747_1112 | 121 |
| 602 | 3300048929 | Ga0496126_0422071 | Ga0496126_0422071_187_552 | 121 |
| 603 | 3300048929 | Ga0496126_0470127 | Ga0496126_0470127_174_539 | 121 |
| 604 | 3300049459 | Ga0495678_089501 | Ga0495678_089501_473_838 | 121 |
| 605 | 3300049460 | Ga0495682_0127700 | Ga0495682_0127700_33_398 | 121 |
| 606 | 3300049568 | Ga0501031_0001041 | Ga0501031_0001041_1721_2086 | 121 |
| 607 | 3300049569 | Ga0501032_0000040 | Ga0501032_0000040_70175_70540 | 121 |
| 608 | 3300049570 | Ga0501033_0000128 | Ga0501033_0000128_67469_67834 | 121 |
| 609 | 3300049570 | Ga0501033_0187684 | Ga0501033_0187684_388_753 | 121 |
| 610 | 3300049571 | Ga0501034_0000254 | Ga0501034_0000254_33035_33400 | 121 |
| 611 | 3300049572 | Ga0501036_0000375 | Ga0501036_0000375_5586_5951 | 121 |
| 612 | 3300049572 | Ga0501036_0239652 | Ga0501036_0239652_1014_1379 | 121 |
| 613 | 3300049573 | Ga0501037_0000041 | Ga0501037_0000041_70075_70440 | 121 |
| 614 | 3300049574 | Ga0501038_0000057 | Ga0501038_0000057_41483_41848 | 121 |
| 615 | 3300049575 | Ga0501039_0000084 | Ga0501039_0000084_44208_44573 | 121 |
| 616 | 3300049579 | Ga0501043_0000184 | Ga0501043_0000184_38927_39292 | 121 |
| 617 | 3300049579 | Ga0501043_0186112 | Ga0501043_0186112_532_897 | 121 |
| 618 | 3300049579 | Ga0501043_0439183 | Ga0501043_0439183_51_416 | 121 |
| 619 | 3300049580 | Ga0501046_0000072 | Ga0501046_0000072_35844_36209 | 121 |
| 620 | 3300049581 | Ga0501047_0000044 | Ga0501047_0000044_70157_70522 | 121 |
| 621 | 3300049581 | Ga0501047_0009182 | Ga0501047_0009182_5324_5689 | 121 |
| 622 | 3300049581 | Ga0501047_0017239 | Ga0501047_0017239_1068_1433 | 121 |
| 623 | 3300049581 | Ga0501047_0047785 | Ga0501047_0047785_3550_3915 | 121 |
| 624 | 3300049582 | Ga0501048_0000295 | Ga0501048_0000295_9016_9381 | 121 |
| 625 | 3300049583 | Ga0501067_0039211 | Ga0501067_0039211_441_806 | 121 |
| 626 | 3300049583 | Ga0501067_0154729 | Ga0501067_0154729_828_1193 | 121 |
| 627 | 3300049584 | Ga0501068_0000113 | Ga0501068_0000113_4714_5079 | 121 |
| 628 | 3300049585 | Ga0501069_0021434 | Ga0501069_0021434_930_1295 | 121 |
| 629 | 3300049585 | Ga0501069_0211197 | Ga0501069_0211197_371_736 | 121 |
| 630 | 3300049586 | Ga0501070_0000310 | Ga0501070_0000310_18302_18667 | 121 |
| 631 | 3300049586 | Ga0501070_0021229 | Ga0501070_0021229_552_917 | 121 |
| 632 | 3300049586 | Ga0501070_0885236 | Ga0501070_0885236_256_621 | 121 |
| 633 | 3300049586 | Ga0501070_1392272 | Ga0501070_1392272_147_512 | 121 |
| 634 | 3300049587 | Ga0501071_0278852 | Ga0501071_0278852_279_644 | 121 |
| 635 | 3300049588 | Ga0501072_0000156 | Ga0501072_0000156_47860_48225 | 121 |
| 636 | 3300049589 | Ga0501073_0000043 | Ga0501073_0000043_22965_23330 | 121 |
| 637 | 3300049589 | Ga0501073_0185555 | Ga0501073_0185555_418_783 | 121 |
| 638 | 3300049590 | Ga0501074_0000035 | Ga0501074_0000035_6063_6428 | 121 |
| 639 | 3300049590 | Ga0501074_0156084 | Ga0501074_0156084_641_1006 | 121 |
| 640 | 3300049741 | Ga0501079_0000839 | Ga0501079_0000839_9002_9367 | 121 |
| 641 | 3300049742 | Ga0501080_0000600 | Ga0501080_0000600_3594_3959 | 121 |
| 642 | 3300049742 | Ga0501080_0099770 | Ga0501080_0099770_959_1324 | 121 |
| 643 | 3300049744 | Ga0501083_0223232 | Ga0501083_0223232_114_479 | 121 |
| 644 | 3300049822 | Ga0501035_0000128 | Ga0501035_0000128_34159_34524 | 121 |
| 645 | 3300049822 | Ga0501035_0225361 | Ga0501035_0225361_534_899 | 121 |
| 646 | 3300049822 | Ga0501035_1208039 | Ga0501035_1208039_116_481 | 121 |
| 647 | 3300049823 | Ga0501044_0000108 | Ga0501044_0000108_3378_3743 | 121 |
| 648 | 3300049823 | Ga0501044_0323740 | Ga0501044_0323740_417_782 | 121 |
| 649 | 3300050489 | nmdc:mga03683_146362_c1 | nmdc:mga03683_146362_c1_242_607 | 121 |
| 650 | 3300050489 | nmdc:mga03683_223452_c1 | nmdc:mga03683_223452_c1_447_812 | 121 |
| 651 | 3300050490 | nmdc:mga03n38_190319_c1 | nmdc:mga03n38_190319_c1_24_389 | 121 |
| 652 | 3300050491 | nmdc:mga00v17_438966_c1 | nmdc:mga00v17_438966_c1_170_535 | 121 |
| 653 | 3300050491 | nmdc:mga00v17_77157_c1 | nmdc:mga00v17_77157_c1_578_943 | 121 |
| 654 | 3300050492 | nmdc:mga0yw44_3454_c1 | nmdc:mga0yw44_3454_c1_4460_4825 | 121 |
| 655 | 3300050492 | nmdc:mga0yw44_528656_c1 | nmdc:mga0yw44_528656_c1_248_613 | 121 |
| 656 | 3300050493 | nmdc:mga0k408_11705_c1 | nmdc:mga0k408_11705_c1_439_804 | 121 |
| 657 | 3300050494 | nmdc:mga06z11_149191_c1 | nmdc:mga06z11_149191_c1_518_883 | 121 |
| 658 | 3300050494 | nmdc:mga06z11_244146_c1 | nmdc:mga06z11_244146_c1_317_682 | 121 |
| 659 | 3300050494 | nmdc:mga06z11_520846_c1 | nmdc:mga06z11_520846_c1_266_631 | 121 |
| 660 | 3300050495 | nmdc:mga04h51_50221_c1 | nmdc:mga04h51_50221_c1_234_599 | 121 |
| 661 | 3300050496 | nmdc:mga07m45_174323_c1 | nmdc:mga07m45_174323_c1_662_1030 | 121 |
| 662 | 3300050496 | nmdc:mga07m45_506363_c1 | nmdc:mga07m45_506363_c1_83_448 | 121 |
| 663 | 3300050496 | nmdc:mga07m45_63911_c1 | nmdc:mga07m45_63911_c1_615_980 | 121 |
| 664 | 3300050514 | nmdc:mga08x19_425231_c1 | nmdc:mga08x19_425231_c1_44_409 | 121 |
| 665 | 3300050516 | nmdc:mga0sz30_107435_c1 | nmdc:mga0sz30_107435_c1_515_880 | 121 |
| 666 | 3300050516 | nmdc:mga0sz30_237724_c1 | nmdc:mga0sz30_237724_c1_98_463 | 121 |
| 667 | 3300050516 | nmdc:mga0sz30_48827_c1 | nmdc:mga0sz30_48827_c1_24_389 | 121 |
| 668 | 3300053085 | Ga0495619_0412108 | Ga0495619_0412108_473_838 | 121 |
| 669 | 3300053086 | Ga0500578_0186870 | Ga0500578_0186870_764_1129 | 121 |
| 670 | 3300053087 | Ga0500643_000095 | Ga0500643_000095_55612_55977 | 121 |
| 671 | 3300053088 | Ga0500644_0283517 | Ga0500644_0283517_210_575 | 121 |
| 672 | 3300053093 | Ga0500651_0001437 | Ga0500651_0001437_6384_6749 | 121 |
| 673 | 3300053093 | Ga0500651_0211368 | Ga0500651_0211368_644_1009 | 121 |
| 674 | 3300053094 | Ga0500566_0000123 | Ga0500566_0000123_13900_14265 | 121 |
| 675 | 3300053095 | Ga0500640_202490 | Ga0500640_202490_196_561 | 121 |
| 676 | 3300053096 | Ga0500641_0108970 | Ga0500641_0108970_701_1066 | 121 |
| 677 | 3300053096 | Ga0500641_0372331 | Ga0500641_0372331_123_491 | 121 |
| 678 | 3300053098 | Ga0500650_0087519 | Ga0500650_0087519_429_794 | 121 |
| 679 | 3300053102 | Ga0500554_138171 | Ga0500554_138171_35_400 | 121 |
| 680 | 3300053103 | Ga0500555_004703 | Ga0500555_004703_3145_3510 | 121 |
| 681 | 3300053104 | Ga0500556_0048984 | Ga0500556_0048984_777_1142 | 121 |
| 682 | 3300053105 | Ga0500557_000036 | Ga0500557_000036_51442_51807 | 121 |
| 683 | 3300053108 | Ga0500562_034684 | Ga0500562_034684_387_752 | 121 |
| 684 | 3300053109 | Ga0500569_003011 | Ga0500569_003011_759_1124 | 121 |
| 685 | 3300053109 | Ga0500569_267237 | Ga0500569_267237_52_417 | 121 |
| 686 | 3300053111 | Ga0500572_019168 | Ga0500572_019168_1343_1708 | 121 |
| 687 | 3300053116 | Ga0500592_025841 | Ga0500592_025841_370_735 | 121 |
| 688 | 3300053116 | Ga0500592_030759 | Ga0500592_030759_321_686 | 121 |
| 689 | 3300053117 | Ga0500593_000585 | Ga0500593_000585_10070_10438 | 121 |
| 690 | 3300053118 | Ga0500594_0223209 | Ga0500594_0223209_101_466 | 121 |
| 691 | 3300053119 | Ga0500595_000839 | Ga0500595_000839_3715_4080 | 121 |
| 692 | 3300053119 | Ga0500595_001859 | Ga0500595_001859_1170_1535 | 121 |
| 693 | 3300053119 | Ga0500595_014588 | Ga0500595_014588_1343_1708 | 121 |
| 694 | 3300053119 | Ga0500595_029117 | Ga0500595_029117_433_798 | 121 |
| 695 | 3300053119 | Ga0500595_044588 | Ga0500595_044588_984_1349 | 121 |
| 696 | 3300053119 | Ga0500595_088852 | Ga0500595_088852_335_700 | 121 |
| 697 | 3300053121 | Ga0500607_055382 | Ga0500607_055382_663_1028 | 121 |
| 698 | 3300053122 | Ga0500608_019066 | Ga0500608_019066_196_561 | 121 |
| 699 | 3300053130 | Ga0500642_0000103 | Ga0500642_0000103_16427_16792 | 121 |
| 700 | 3300053130 | Ga0500642_0037896 | Ga0500642_0037896_1590_1955 | 121 |
| 701 | 3300053130 | Ga0500642_0088219 | Ga0500642_0088219_524_889 | 121 |
| 702 | 3300053131 | Ga0500652_140334 | Ga0500652_140334_630_995 | 121 |
| 703 | 3300053131 | Ga0500652_310827 | Ga0500652_310827_224_589 | 121 |
| 704 | 3300053134 | Ga0500658_0040012 | Ga0500658_0040012_1401_1766 | 121 |
| 705 | 3300053136 | Ga0500559_0002826 | Ga0500559_0002826_1468_1833 | 121 |
| 706 | 3300053136 | Ga0500559_0030423 | Ga0500559_0030423_1887_2252 | 121 |
| 707 | 3300053139 | Ga0500568_0008926 | Ga0500568_0008926_3594_3959 | 121 |
| 708 | 3300053139 | Ga0500568_0041288 | Ga0500568_0041288_964_1329 | 121 |
| 709 | 3300053139 | Ga0500568_0059411 | Ga0500568_0059411_846_1211 | 121 |
| 710 | 3300053139 | Ga0500568_0074207 | Ga0500568_0074207_474_839 | 121 |
| 711 | 3300053139 | Ga0500568_0260100 | Ga0500568_0260100_127_492 | 121 |
| 712 | 3300053142 | Ga0500577_0317831 | Ga0500577_0317831_200_565 | 121 |
| 713 | 3300053146 | Ga0500588_0179590 | Ga0500588_0179590_269_634 | 121 |
| 714 | 3300053148 | Ga0500590_126829 | Ga0500590_126829_85_450 | 121 |
| 715 | 3300053153 | Ga0500616_0017085 | Ga0500616_0017085_3209_3574 | 121 |
| 716 | 3300053153 | Ga0500616_0297568 | Ga0500616_0297568_285_650 | 121 |
| 717 | 3300053154 | Ga0500619_019397 | Ga0500619_019397_660_1025 | 121 |
| 718 | 3300053155 | Ga0500620_036935 | Ga0500620_036935_933_1298 | 121 |
| 719 | 3300053156 | Ga0500622_0012724 | Ga0500622_0012724_2978_3343 | 121 |
| 720 | 3300053156 | Ga0500622_0020063 | Ga0500622_0020063_1538_1903 | 121 |
| 721 | 3300053158 | Ga0500627_0361680 | Ga0500627_0361680_25_390 | 121 |
| 722 | 3300053162 | Ga0500638_118669 | Ga0500638_118669_658_1023 | 121 |
| 723 | 3300053162 | Ga0500638_139954 | Ga0500638_139954_477_842 | 121 |
| 724 | 3300053177 | Ga0500636_0002571 | Ga0500636_0002571_8655_9020 | 121 |
| 725 | 3300053177 | Ga0500636_0005712 | Ga0500636_0005712_6096_6461 | 121 |
| 726 | 3300053178 | Ga0500637_0073623 | Ga0500637_0073623_1456_1821 | 121 |
| 727 | 3300053724 | Ga0500570_066843 | Ga0500570_066843_92_457 | 121 |
| 728 | 3300053729 | Ga0500625_000325 | Ga0500625_000325_8829_9194 | 121 |
| 729 | 3300053731 | Ga0500609_001599 | Ga0500609_001599_1248_1613 | 121 |
| 730 | 3300053736 | Ga0500599_007228 | Ga0500599_007228_1001_1366 | 121 |
| 731 | 3300053737 | Ga0500601_000445 | Ga0500601_000445_4844_5209 | 121 |
| 732 | 3300053737 | Ga0500601_035212 | Ga0500601_035212_208_573 | 121 |
| 733 | 3300054114 | Ga0501084_0025559 | Ga0501084_0025559_2885_3250 | 121 |
| 734 | 3300055283 | Ga0500661_011309 | Ga0500661_011309_664_1029 | 121 |
| 735 | 3300061719 | Ga0466962_0132351 | Ga0466962_0132351_15_380 | 121 |
| 736 | 3300061719 | Ga0466962_0157047 | Ga0466962_0157047_363_728 | 121 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4h60-assembly1.cif.gz_A | high resolution structure of vibrio cholerae chemotaxis protein chey4 crystallized in low ph (4.0) condition | 0.973 | 1 | 118 |
| 4hnr-assembly1.cif.gz_A | high resolution structure of chemotaxis response regulator chey4 of vibrio cholerae | 0.9701 | 1 | 118 |
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9699 | 1 | 120 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9674 | 3 | 120 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9672 | 3 | 120 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WGN1_2_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9714 | 3 | 82 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9701 | 1 | 82 | 3.40.50.2300 |
| 4hnrA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9701 | 1 | 118 | 3.40.50.2300 |
| af_Q5A4X5_425_557_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.969 | 4 | 118 | 3.40.50.2300 |
| af_Q06065_2_134_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9655 | 1 | 120 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8ITQ6-F1-model_v4 | deleted | 0.9912 | 2 | 119 |
|
| AF-A7BZ01-F1-model_v4 | deleted | 0.9893 | 1 | 120 |
|
| AF-B7RJ06-F1-model_v4 | Chemotaxis response regulator, CheY4 | 0.9883 | 1 | 121 |
GO:0000160
|
| AF-A0A545TIN6-F1-model_v4 | Response regulator | 0.9878 | 1 | 120 |
GO:0000160
|
| AF-A0A2E0FLD5-F1-model_v4 | Response regulatory domain-containing protein | 0.9873 | 2 | 120 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar