F478264

General Info

Members Datasets Scaffolds Average Seq Length
736 408 1472 180

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10018169|Ga0157370_100181698
Length 212
Sequence MTSATFTLPARVLHWLMAVLIVAMLFIGVGMVASVSARHEWLLAIHKPLGIAILILAIVRLAVRLRHPPPPLPADLPALQKLAALASHWLLYFLMLAMPLIGWAMLSAGGYPVMLGTSLRLPPIFPTNATAFAVLRHLHGWFAALLFLTFLAHMAAALYHGLIRRDGVLPSMLRGRRTAAPILIGYADEPAATDPIEPGVARDGLDAAERTD

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
17 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
18 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
19 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
22 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
23 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
24 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
31 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
32 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
33 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
36 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
37 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
62 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012473 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
88 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
96 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
97 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
103 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
114 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
170 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
171 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
172 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
173 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
174 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
175 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
176 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
177 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
178 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
179 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
180 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
181 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
182 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
183 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
196 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
221 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
229 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
232 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
235 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
236 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
243 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
244 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
245 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
246 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
247 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
258 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
261 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
264 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
269 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
287 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
290 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
291 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
292 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
293 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
294 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
295 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
296 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
297 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
299 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
300 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
301 2519103095 Burkholderia sp. KJ006 Isolate Nodule
302 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
303 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
304 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
305 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
306 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
307 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
308 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
309 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
310 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
311 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
312 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
313 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
314 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
315 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
316 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
317 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
318 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
319 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
320 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
321 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
322 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
323 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
324 2643221593 Lysobacter sp. Root690 Isolate Unclassified
325 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
326 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
327 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
328 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
329 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
330 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
331 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
332 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
333 2734482264 Dyella sp. AD052 Isolate Unclassified
334 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
335 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
336 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
337 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
338 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
339 2738543009 Luteibacter sp. OK325 Isolate Unclassified
340 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
341 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
342 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
343 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
344 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
345 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
346 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
347 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
348 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
349 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
350 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
351 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
352 2818991452 Burkholderia cepacia 561 Isolate Unclassified
353 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
354 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
355 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
356 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
357 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
358 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
359 2855730933 Achromobacter sp. HZ28 Isolate Nodule
360 2855767633 Achromobacter sp. HZ34 Isolate Nodule
361 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
362 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
363 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
364 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
365 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
366 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
367 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
368 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
369 2904564687 Burkholderia sp. 571 Isolate Unclassified
370 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
371 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
372 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
373 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
374 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
375 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
376 2928163908 Burkholderia sp. 567 Isolate Unclassified
377 2928170801 Burkholderia sp. 572 Isolate Unclassified
378 2928536128 Burkholderia sola 565 Isolate Unclassified
379 2928963466 Dyella japonica 1073 Isolate Unclassified
380 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
381 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
382 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
383 2941471342 Luteibacter sp. 621 Isolate Unclassified
384 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
385 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
386 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
387 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
388 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
389 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
390 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
391 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
392 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
393 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
394 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
395 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
396 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
397 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
398 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
399 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
400 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
401 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
402 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
403 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
404 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
405 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
406 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
407 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
408 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.78
Metatranscriptomes 0.27
Isolates 14.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.9
Nodule 1.09
Rhizoplane 2.99
Rhizosphere 59.78
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10018169 3300013104 Bacteria 7077
2 JGI25156J39149_1004808 3300002705 Bacteria 4035
3 JGI25162J39368_1000709 3300002737 Bacteria 23155
4 JGI25162J39368_1000822 3300002737 Bacteria 20460
5 JGI25162J39368_1002764 3300002737 Bacteria 6248
6 JGI25158J39367_1000059 3300002739 Bacteria 24502
7 JGI25157J39369_1001626 3300002741 Bacteria 7756
8 JGI25157J39369_1002929 3300002741 Bacteria 3786
9 JGI25157J39369_1003012 3300002741 Bacteria 3690
10 JGI25164J39214_1000149 3300002772 Bacteria 67364
11 JGI25164J39214_1000553 3300002772 Bacteria 17152
12 JGI25152J39213_1001248 3300002773 Bacteria 11603
13 JGI25152J39213_1004153 3300002773 Bacteria 4672
14 JGI25159J45721_1000504 3300002987 Bacteria 17816
15 JGI25165J46597_1000643 3300003214 Bacteria 28939
16 JGI25165J46597_1002587 3300003214 Bacteria 5528
17 JGI25153J46596_10014206 3300003215 Bacteria 3323
18 rootH2_10036142 3300003320 Bacteria 15654
19 rootL2_10209767 3300003322 Bacteria 1299
20 rootH1_10104958 3300003323 Bacteria 8292
21 rootH1_10168750 3300003323 Bacteria 4267
22 JGI25160J50197_1013524 3300003354 Bacteria 2776
23 JGI25161J50226_1000123 3300003374 Bacteria 56542
24 Ga0055538_1000072 3300003751 Bacteria 91545
25 Ga0055539_1000107 3300003752 Bacteria 91545
26 Ga0055533_1000116 3300003756 Bacteria 91545
27 Ga0055532_1000103 3300003758 Bacteria 91541
28 Ga0055532_1003352 3300003758 Bacteria 2789
29 Ga0055525_1000160 3300003759 Bacteria 87810
30 Ga0055525_1000242 3300003759 Bacteria 55608
31 Ga0055527_1000248 3300003760 Bacteria 33362
32 Ga0055527_1000743 3300003760 Bacteria 9162
33 Ga0055527_1001164 3300003760 Bacteria 5960
34 Ga0055527_1021903 3300003760 Bacteria 662
35 Ga0055535_1000398 3300003761 Bacteria 40844
36 Ga0055535_1000680 3300003761 Bacteria 26481
37 Ga0055535_1001824 3300003761 Bacteria 9162
38 Ga0055535_1002504 3300003761 Bacteria 6298
39 Ga0055535_1003305 3300003761 Bacteria 4656
40 Ga0055542_1000264 3300003762 Bacteria 58581
41 Ga0055542_1000552 3300003762 Bacteria 33226
42 Ga0055542_1001663 3300003762 Bacteria 9910
43 Ga0055542_1002426 3300003762 Bacteria 6197
44 Ga0055542_1011628 3300003762 Bacteria 1554
45 Ga0055529_1000448 3300003763 Bacteria 40848
46 Ga0055529_1000912 3300003763 Bacteria 16130
47 Ga0055529_1002010 3300003763 Bacteria 4457
48 Ga0055529_1003524 3300003763 Bacteria 2577
49 Ga0055529_1004565 3300003763 Bacteria 2091
50 Ga0055526_1007035 3300003771 Bacteria 5951
51 Ga0055526_1015265 3300003771 Bacteria 3093
52 Ga0055524_1023420 3300003775 Bacteria 1988
53 Ga0055528_1001408 3300003790 Bacteria 14733
54 Ga0055528_1006055 3300003790 Bacteria 5531
55 Ga0055540_1009899 3300003792 Bacteria 3228
56 Ga0055541_1000073 3300003841 Bacteria 91545
57 Ga0058692_1042727 3300003856 Bacteria 786
58 Ga0055543_1000116 3300004625 Bacteria 67872
59 Ga0065714_10064735 3300005288 Bacteria 20692
60 Ga0065712_10090700 3300005290 Bacteria 2402
61 Ga0070670_100003042 3300005331 Bacteria 13876
62 Ga0070680_101232918 3300005336 Bacteria 647
63 Ga0070661_100000036 3300005344 Bacteria 108531
64 Ga0070661_100484145 3300005344 Bacteria 988
65 Ga0070692_10190799 3300005345 Bacteria 1194
66 Ga0070669_100000957 3300005353 Bacteria 21077
67 Ga0070675_100289915 3300005354 Bacteria 1440
68 Ga0070671_100495032 3300005355 Bacteria 1051
69 Ga0070673_100693858 3300005364 Bacteria 934
70 Ga0070659_100032863 3300005366 Bacteria 4028
71 Ga0070667_100032538 3300005367 Bacteria 4350
72 Ga0070714_100000034 3300005435 Bacteria 130742
73 Ga0070714_100001388 3300005435 Bacteria 17551
74 Ga0070714_100444550 3300005435 Bacteria 1231
75 Ga0070713_100072468 3300005436 Bacteria 2913
76 Ga0070678_100055749 3300005456 Bacteria 2887
77 Ga0070662_100002793 3300005457 Bacteria 10813
78 Ga0070662_100063289 3300005457 Bacteria 2706
79 Ga0070681_10010947 3300005458 Bacteria 8971
80 Ga0068853_100047582 3300005539 Bacteria 3681
81 Ga0070696_100096309 3300005546 Bacteria 2115
82 Ga0070693_100329374 3300005547 Bacteria 1039
83 Ga0070665_100324744 3300005548 Bacteria 1543
84 Ga0068855_100001262 3300005563 Bacteria 31405
85 Ga0068855_100971569 3300005563 Bacteria 894
86 Ga0068855_101289442 3300005563 Bacteria 756
87 Ga0070664_100000486 3300005564 Bacteria 30104
88 Ga0068854_100000826 3300005578 Bacteria 18477
89 Ga0068854_100108357 3300005578 Bacteria 2092
90 Ga0068854_100245888 3300005578 Bacteria 1426
91 Ga0068856_100001540 3300005614 Bacteria 24168
92 Ga0068856_101800351 3300005614 Bacteria 624
93 Ga0068851_10000103 3300005834 Bacteria 45687
94 Ga0075362_10024489 3300006177 Bacteria 2561
95 Ga0099826_10000027 3300006948 Bacteria 140533
96 Ga0105251_10001158 3300009011 Bacteria 22899
97 Ga0105251_10003812 3300009011 Bacteria 10744
98 Ga0105251_10034598 3300009011 Bacteria 2498
99 Ga0105251_10079460 3300009011 Bacteria 1517
100 Ga0105244_10012702 3300009036 Bacteria 4965
101 Ga0105244_10018596 3300009036 Bacteria 3895
102 Ga0105244_10036357 3300009036 Bacteria 2580
103 Ga0105244_10093304 3300009036 Bacteria 1479
104 Ga0105250_10000128 3300009092 Bacteria 65474
105 Ga0105250_10113269 3300009092 Bacteria 1112
106 Ga0105240_10012639 3300009093 Bacteria 11640
107 Ga0105240_10118123 3300009093 Bacteria 3196
108 Ga0105243_10123874 3300009148 Bacteria 2184
109 Ga0105243_10738890 3300009148 Bacteria 963
110 Ga0105241_10938122 3300009174 Bacteria 806
111 Ga0105242_10000520 3300009176 Bacteria 30218
112 Ga0105248_10034883 3300009177 Bacteria 5630
113 Ga0105248_10107818 3300009177 Bacteria 3141
114 Ga0105237_10000163 3300009545 Bacteria 94679
115 Ga0105237_10001127 3300009545 Bacteria 35830
116 Ga0105237_10191665 3300009545 Bacteria 2044
117 Ga0105238_10975370 3300009551 Bacteria 868
118 Ga0105249_10835182 3300009553 Bacteria 986
119 Ga0105147_105401 3300009982 Bacteria 1073
120 Ga0105246_10022660 3300011119 Bacteria 4055
121 Ga0157340_1000944 3300012473 Bacteria 1239
122 Ga0157373_10005057 3300013100 Bacteria 9906
123 Ga0157373_10006322 3300013100 Bacteria 8849
124 Ga0157370_10045890 3300013104 Bacteria 4191
125 Ga0157370_10072831 3300013104 Bacteria 3241
126 Ga0157370_10149538 3300013104 Bacteria 2174
127 Ga0157369_10009908 3300013105 Bacteria 10889
128 Ga0157369_10019997 3300013105 Bacteria 7487
129 Ga0157369_10030321 3300013105 Bacteria 5965
130 Ga0157369_10100543 3300013105 Bacteria 3082
131 Ga0163162_10001674 3300013306 Bacteria 20781
132 Ga0163162_10005933 3300013306 Bacteria 11821
133 Ga0163162_10268377 3300013306 Unclassified 1838
134 Ga0157372_11717898 3300013307 Bacteria 722
135 Ga0157375_10001075 3300013308 Bacteria 23675
136 Ga0157375_10011307 3300013308 Bacteria 7882
137 Ga0157375_10021437 3300013308 Bacteria 5925
138 Ga0157375_10050147 3300013308 Bacteria 4094
139 Ga0163163_10996973 3300014325 Bacteria 901
140 Ga0182008_10002178 3300014497 Bacteria 12461
141 Ga0182008_10003123 3300014497 Bacteria 10136
142 Ga0182008_10036927 3300014497 Bacteria 2444
143 Ga0182008_10078526 3300014497 Bacteria 1624
144 Ga0182008_10082212 3300014497 Bacteria 1585
145 Ga0182006_1000162 3300015261 Bacteria 71391
146 Ga0182006_1002213 3300015261 Bacteria 10777
147 Ga0182006_1125785 3300015261 Bacteria 886
148 Ga0182007_10012520 3300015262 Bacteria 3259
149 Ga0182007_10020320 3300015262 Bacteria 2375
150 Ga0182007_10102127 3300015262 Bacteria 950
151 Ga0183369_1003 3300015685 Bacteria 726443
152 Ga0163161_10004002 3300017792 Bacteria 10315
153 Ga0163161_10073634 3300017792 Bacteria 2503
154 Ga0163161_10083107 3300017792 Bacteria 2360
155 Ga0163161_10125285 3300017792 Bacteria 1934
156 Ga0163161_10152942 3300017792 Bacteria 1754
157 Ga0163161_10196117 3300017792 Bacteria 1554
158 Ga0206356_11398797 3300020070 Bacteria 3980
159 Ga0213876_10032386 3300021384 Bacteria 2757
160 Ga0209435_101295 3300025206 Bacteria 3267
161 Ga0209436_100066 3300025208 Bacteria 54510
162 Ga0209784_100110 3300025224 Bacteria 91931
163 Ga0209566_100131 3300025225 Bacteria 91931
164 Ga0209674_100154 3300025226 Bacteria 91931
165 Ga0209672_100007 3300025228 Bacteria 959482
166 Ga0209672_100115 3300025228 Bacteria 89213
167 Ga0209672_100552 3300025228 Bacteria 20231
168 Ga0209672_100652 3300025228 Bacteria 17705
169 Ga0209147_100158 3300025229 Bacteria 91931
170 Ga0209147_100164 3300025229 Bacteria 90422
171 Ga0209147_100412 3300025229 Bacteria 28498
172 Ga0209563_100071 3300025230 Bacteria 232653
173 Ga0209563_100133 3300025230 Bacteria 91931
174 Ga0207427_100021 3300025231 Bacteria 494115
175 Ga0207427_100123 3300025231 Bacteria 98859
176 Ga0209437_100087 3300025233 Bacteria 253432
177 Ga0209437_100106 3300025233 Bacteria 219071
178 Ga0209437_100227 3300025233 Bacteria 98939
179 Ga0209437_113517 3300025233 Bacteria 1165
180 Ga0209258_100017 3300025242 Bacteria 590785
181 Ga0209258_100260 3300025242 Bacteria 91919
182 Ga0209258_100261 3300025242 Bacteria 90726
183 Ga0209258_100271 3300025242 Bacteria 89095
184 Ga0209258_100379 3300025242 Bacteria 57256
185 Ga0209258_103817 3300025242 Bacteria 3081
186 Ga0209646_1000454 3300025246 Bacteria 21498
187 Ga0209646_1024566 3300025246 Bacteria 848
188 Ga0209026_1000158 3300025250 Bacteria 106333
189 Ga0209026_1002678 3300025250 Bacteria 6442
190 Ga0209026_1009325 3300025250 Bacteria 1939
191 Ga0209677_100100 3300025253 Bacteria 91931
192 Ga0209148_1000002 3300025254 Bacteria 2399500
193 Ga0209148_1000044 3300025254 Bacteria 458417
194 Ga0209148_1000045 3300025254 Bacteria 448076
195 Ga0209148_1000104 3300025254 Bacteria 214254
196 Ga0209148_1008815 3300025254 Bacteria 2006
197 Ga0209759_1000150 3300025256 Bacteria 120839
198 Ga0209759_1001197 3300025256 Bacteria 16140
199 Ga0209759_1003231 3300025256 Bacteria 6595
200 Ga0209759_1013122 3300025256 Bacteria 2257
201 Ga0209759_1037181 3300025256 Bacteria 878
202 Ga0209759_1046899 3300025256 Bacteria 695
203 Ga0209129_1000653 3300025258 Bacteria 23204
204 Ga0209129_1003691 3300025258 Bacteria 6498
205 Ga0209233_1000023 3300025261 Bacteria 738870
206 Ga0209233_1000419 3300025261 Bacteria 32032
207 Ga0209565_1003844 3300025263 Bacteria 4730
208 Ga0209455_1000010 3300025272 Bacteria 959482
209 Ga0209455_1000035 3300025272 Bacteria 479071
210 Ga0209455_1000097 3300025272 Bacteria 214136
211 Ga0209455_1000218 3300025272 Bacteria 79966
212 Ga0209455_1000774 3300025272 Bacteria 17922
213 Ga0209673_1000124 3300025273 Bacteria 169015
214 Ga0209673_1005112 3300025273 Bacteria 6725
215 Ga0209673_1007502 3300025273 Bacteria 5009
216 Ga0209673_1032748 3300025273 Bacteria 1597
217 Ga0209130_1000022 3300025284 Bacteria 361244
218 Ga0209025_1000003 3300025294 Bacteria 1366495
219 Ga0209025_1028046 3300025294 Bacteria 2771
220 Ga0209564_1000475 3300025295 Bacteria 67102
221 Ga0209564_1025883 3300025295 Bacteria 1958
222 Ga0209758_1028297 3300025297 Bacteria 2374
223 Ga0209758_1068198 3300025297 Bacteria 1134
224 Ga0209256_1004167 3300025299 Bacteria 9331
225 Ga0209256_1020693 3300025299 Bacteria 2044
226 Ga0207426_1000005 3300025302 Bacteria 1037188
227 Ga0209051_1018719 3300025303 Bacteria 3053
228 Ga0209257_1012027 3300025304 Bacteria 4067
229 Ga0207656_10002930 3300025321 Bacteria 5822
230 Ga0207696_1000143 3300025711 Bacteria 123194
231 Ga0207655_1000173 3300025728 Bacteria 118589
232 Ga0207655_1032811 3300025728 Bacteria 2366
233 Ga0207655_1037840 3300025728 Bacteria 2118
234 Ga0207655_1107367 3300025728 Bacteria 949
235 Ga0207713_1000315 3300025735 Bacteria 54844
236 Ga0207713_1001848 3300025735 Bacteria 16132
237 Ga0207713_1006439 3300025735 Bacteria 7150
238 Ga0207680_10000002 3300025903 Bacteria 1018646
239 Ga0207680_10032126 3300025903 Bacteria 2980
240 Ga0207647_10003916 3300025904 Bacteria 11120
241 Ga0207695_10010058 3300025913 Bacteria 11616
242 Ga0207695_10088148 3300025913 Bacteria 3124
243 Ga0207695_10142571 3300025913 Bacteria 2343
244 Ga0207695_10223078 3300025913 Bacteria 1792
245 Ga0207671_10000196 3300025914 Bacteria 94054
246 Ga0207671_10001413 3300025914 Bacteria 27891
247 Ga0207693_10072328 3300025915 Bacteria 2700
248 Ga0207663_10330980 3300025916 Bacteria 1147
249 Ga0207660_10677987 3300025917 Bacteria 841
250 Ga0207657_10056277 3300025919 Bacteria 3394
251 Ga0207657_10433498 3300025919 Bacteria 1032
252 Ga0207649_10000042 3300025920 Bacteria 117456
253 Ga0207649_10119572 3300025920 Bacteria 1774
254 Ga0207652_10153258 3300025921 Bacteria 2064
255 Ga0207681_10745968 3300025923 Bacteria 816
256 Ga0207694_10257706 3300025924 Bacteria 1428
257 Ga0207650_10000874 3300025925 Bacteria 22810
258 Ga0207700_10010034 3300025928 Bacteria 5951
259 Ga0207664_10000021 3300025929 Bacteria 216875
260 Ga0207664_10006826 3300025929 Bacteria 7888
261 Ga0207664_10119125 3300025929 Bacteria 2207
262 Ga0207644_10140926 3300025931 Bacteria 1857
263 Ga0207644_10595055 3300025931 Bacteria 918
264 Ga0207690_10000384 3300025932 Bacteria 29204
265 Ga0207706_10000566 3300025933 Bacteria 39267
266 Ga0207706_10052954 3300025933 Bacteria 3583
267 Ga0207686_10039967 3300025934 Bacteria 2849
268 Ga0207709_10022553 3300025935 Bacteria 3572
269 Ga0207709_11047775 3300025935 Bacteria 668
270 Ga0207711_10011256 3300025941 Bacteria 7434
271 Ga0207711_10019271 3300025941 Bacteria 5682
272 Ga0207711_10080447 3300025941 Bacteria 2846
273 Ga0207679_10000044 3300025945 Bacteria 122251
274 Ga0207667_10000486 3300025949 Bacteria 52631
275 Ga0207667_10274103 3300025949 Bacteria 1725
276 Ga0207640_10000042 3300025981 Bacteria 102885
277 Ga0207640_10014134 3300025981 Bacteria 4589
278 Ga0207658_10021663 3300025986 Bacteria 4465
279 Ga0207678_10270774 3300026067 Bacteria 1456
280 Ga0207702_10000290 3300026078 Bacteria 58330
281 Ga0207702_10456164 3300026078 Bacteria 1241
282 Ga0207674_10063437 3300026116 Bacteria 3730
283 Ga0209371_1000185 3300027312 Bacteria 90613
284 Ga0209995_1011811 3300027471 Bacteria 1421
285 Ga0209982_1000979 3300027552 Bacteria 3785
286 Ga0209282_1000141 3300027666 Bacteria 42759
287 Ga0209971_1010745 3300027682 Bacteria 2167
288 Ga0209974_10001007 3300027876 Bacteria 9942
289 Ga0268266_10237046 3300028379 Bacteria 1682
290 Ga0307517_10119698 3300028786 Bacteria 1953
291 Ga0265338_10001414 3300028800 Bacteria 39085
292 Ga0268256_1000211 3300030500 Bacteria 65693
293 Ga0307509_10133981 3300031507 Bacteria 2427
294 Ga0307405_10002959 3300031731 Bacteria 7671
295 Ga0307414_10190370 3300032004 Bacteria 1659
296 Ga0395899_0024399 3300037312 Bacteria 4571
297 Ga0395900_0456111 3300037418 Bacteria 1234
298 Ga0395898_0000078 3300037466 Bacteria 244514
299 Ga0395898_0034384 3300037466 Bacteria 5052
300 Ga0395905_0486937 3300037471 Bacteria 1133
301 Ga0395901_0036847 3300038443 Bacteria 5056
302 Ga0237819_00428 3300038705 Bacteria 14475
303 Ga0436365_0354829 3300039437 Bacteria 1031
304 Ga0436361_0398230 3300039447 Bacteria 684
305 Ga0439447_013622 3300041407 Bacteria 2302
306 Ga0451795_1066095 3300041456 Bacteria 1525
307 Ga0451833_0445334 3300041491 Bacteria 3292
308 Ga0451835_0648597 3300041492 Bacteria 3321
309 Ga0451837_0320107 3300041494 Bacteria 1789
310 Ga0451845_0592791 3300041501 Bacteria 1627
311 Ga0451849_0216198 3300041505 Bacteria 3619
312 Ga0451851_0154268 3300041507 Bacteria 3339
313 Ga0451855_0271646 3300041511 Bacteria 4034
314 Ga0439432_001612 3300042006 Bacteria 8445
315 Ga0439432_087301 3300042006 Bacteria 941
316 Ga0439452_101138 3300042010 Bacteria 619
317 Ga0439463_072582 3300042016 Bacteria 882
318 Ga0466969_0026432 3300044656 Bacteria 2977
319 Ga0466969_0376695 3300044656 Bacteria 643
320 Ga0466972_0001620 3300044658 Bacteria 10989
321 Ga0466982_0000013 3300044672 Bacteria 136227
322 Ga0466965_0015127 3300044683 Bacteria 3662
323 Ga0466965_0203664 3300044683 Bacteria 1050
324 Ga0466966_0000593 3300044684 Bacteria 22990
325 Ga0466966_0018299 3300044684 Bacteria 4621
326 Ga0466961_0004765 3300044693 Bacteria 8538
327 Ga0466961_0007797 3300044693 Bacteria 6812
328 Ga0466961_0026181 3300044693 Bacteria 3751
329 Ga0466961_0048224 3300044693 Bacteria 2722
330 Ga0466971_0005784 3300044719 Bacteria 5379
331 Ga0466971_0012041 3300044719 Bacteria 3789
332 Ga0466968_0016998 3300044735 Bacteria 2901
333 Ga0466970_0003402 3300044765 Bacteria 7745
334 Ga0466970_0004073 3300044765 Bacteria 7180
335 Ga0466970_0011372 3300044765 Bacteria 4536
336 Ga0466970_0033761 3300044765 Bacteria 2705
337 Ga0466957_0079195 3300044842 Bacteria 2044
338 Ga0466957_0192323 3300044842 Bacteria 1337
339 Ga0466960_0009427 3300044901 Bacteria 4024
340 Ga0466959_0000172 3300045049 Bacteria 42574
341 Ga0466959_0019023 3300045049 Bacteria 5048
342 Ga0466959_0082073 3300045049 Bacteria 2323
343 Ga0466959_0521420 3300045049 Bacteria 802
344 Ga0466958_0003894 3300045836 Bacteria 7811
345 Ga0466958_0006576 3300045836 Bacteria 6336
346 Ga0466967_0163594 3300045976 Bacteria 2090
347 Ga0495617_000111 3300046452 Bacteria 59710
348 Ga0495617_001833 3300046452 Bacteria 9020
349 Ga0495627_000668 3300046453 Bacteria 26397
350 Ga0495603_0149909 3300046455 Bacteria 1355
351 Ga0495590_0079138 3300046457 Bacteria 1157
352 Ga0495591_000762 3300046458 Bacteria 23270
353 Ga0495591_040804 3300046458 Bacteria 1321
354 Ga0495629_0113571 3300046459 Bacteria 1888
355 Ga0495638_0000233 3300046460 Bacteria 75994
356 Ga0495638_0004139 3300046460 Bacteria 11081
357 Ga0495638_0010997 3300046460 Bacteria 6258
358 Ga0495638_0121587 3300046460 Bacteria 1542
359 Ga0495650_0017391 3300046471 Bacteria 3606
360 Ga0495650_0025254 3300046471 Bacteria 2789
361 Ga0495650_0029335 3300046471 Bacteria 2509
362 Ga0495650_0084469 3300046471 Bacteria 1218
363 Ga0495580_0114346 3300046472 Bacteria 1874
364 Ga0495605_0001310 3300046474 Bacteria 16487
365 Ga0495605_0001363 3300046474 Bacteria 16113
366 Ga0495605_0006109 3300046474 Bacteria 6949
367 Ga0495605_0316500 3300046474 Bacteria 658
368 Ga0495662_0113843 3300046476 Bacteria 1326
369 Ga0495584_0000839 3300046491 Bacteria 19926
370 Ga0495584_0024203 3300046491 Bacteria 3079
371 Ga0495585_0000001 3300046492 Bacteria 609804
372 Ga0495585_0007027 3300046492 Bacteria 6930
373 Ga0495585_0044730 3300046492 Bacteria 2473
374 Ga0495596_0000296 3300046500 Bacteria 33048
375 Ga0495596_0015426 3300046500 Bacteria 3199
376 Ga0495607_0000207 3300046501 Bacteria 62802
377 Ga0495607_0000336 3300046501 Bacteria 48521
378 Ga0495607_0015940 3300046501 Bacteria 4858
379 Ga0495607_0033870 3300046501 Bacteria 3105
380 Ga0495607_0035963 3300046501 Bacteria 2990
381 Ga0495607_0057233 3300046501 Bacteria 2235
382 Ga0495607_0083586 3300046501 Bacteria 1748
383 Ga0495583_0001210 3300046506 Bacteria 27537
384 Ga0495583_0004094 3300046506 Bacteria 10696
385 Ga0495583_0006444 3300046506 Bacteria 7674
386 Ga0495583_0009253 3300046506 Bacteria 5903
387 Ga0495606_0001292 3300046507 Bacteria 34691
388 Ga0495606_0007113 3300046507 Bacteria 10116
389 Ga0495606_0010131 3300046507 Bacteria 7868
390 Ga0495606_0052259 3300046507 Bacteria 2658
391 Ga0495606_0073822 3300046507 Bacteria 2138
392 Ga0495606_0074451 3300046507 Bacteria 2127
393 Ga0495606_0177576 3300046507 Bacteria 1230
394 Ga0495610_0000803 3300046512 Bacteria 29467
395 Ga0495610_0001466 3300046512 Bacteria 20807
396 Ga0495610_0043104 3300046512 Bacteria 2251
397 Ga0495616_0000001 3300046513 Bacteria 780061
398 Ga0495616_0007643 3300046513 Bacteria 6465
399 Ga0495618_0179571 3300046514 Bacteria 1345
400 Ga0495620_0000543 3300046515 Bacteria 23917
401 Ga0495620_0004657 3300046515 Bacteria 7707
402 Ga0495620_0009435 3300046515 Bacteria 5191
403 Ga0495630_0287432 3300046517 Bacteria 1256
404 Ga0495631_0000162 3300046518 Bacteria 45464
405 Ga0495631_0000617 3300046518 Bacteria 23416
406 Ga0495631_0072449 3300046518 Bacteria 1488
407 Ga0495631_0161795 3300046518 Bacteria 960
408 Ga0495632_0002482 3300046519 Bacteria 14007
409 Ga0495632_0007207 3300046519 Bacteria 7021
410 Ga0495632_0010644 3300046519 Bacteria 5427
411 Ga0495643_0031085 3300046522 Bacteria 2975
412 Ga0495643_0148217 3300046522 Bacteria 1164
413 Ga0495644_0342330 3300046523 Bacteria 588
414 Ga0495648_0000083 3300046524 Bacteria 121164
415 Ga0495648_0004279 3300046524 Bacteria 12239
416 Ga0495648_0026745 3300046524 Bacteria 3878
417 Ga0495648_0098802 3300046524 Bacteria 1616
418 Ga0495648_0191969 3300046524 Bacteria 1029
419 Ga0495666_0018424 3300046526 Bacteria 3474
420 Ga0495642_0018770 3300046528 Bacteria 2708
421 Ga0495642_0027277 3300046528 Bacteria 2272
422 Ga0495654_0000762 3300046530 Bacteria 24922
423 Ga0495654_0115390 3300046530 Bacteria 1221
424 Ga0495665_0060673 3300046531 Bacteria 1996
425 Ga0495587_0305934 3300046536 Bacteria 889
426 Ga0495609_0000905 3300046538 Bacteria 21595
427 Ga0495609_0002763 3300046538 Bacteria 10560
428 Ga0495609_0170168 3300046538 Bacteria 920
429 Ga0495597_0031345 3300046542 Bacteria 2420
430 Ga0495597_0040811 3300046542 Bacteria 2074
431 Ga0495597_0194564 3300046542 Bacteria 814
432 Ga0495622_0109712 3300046557 Bacteria 1263
433 Ga0495656_0138212 3300046615 Bacteria 1166
434 Ga0495668_0013200 3300046616 Bacteria 4882
435 Ga0495611_0000001 3300046648 Bacteria 2628469
436 Ga0495611_0014748 3300046648 Bacteria 3341
437 Ga0495625_0000001 3300046660 Bacteria 1641829
438 Ga0495661_0000290 3300046665 Bacteria 56929
439 Ga0495661_0001053 3300046665 Bacteria 24433
440 Ga0495661_0002265 3300046665 Bacteria 14884
441 Ga0495661_0008271 3300046665 Bacteria 7207
442 Ga0495661_0040496 3300046665 Bacteria 2888
443 Ga0495661_0388021 3300046665 Bacteria 681
444 Ga0495669_0006796 3300046684 Bacteria 4788
445 Ga0495669_0042422 3300046684 Bacteria 2023
446 Ga0495670_0002621 3300046691 Bacteria 8881
447 Ga0495670_0019906 3300046691 Bacteria 3307
448 Ga0495670_0038206 3300046691 Bacteria 2393
449 Ga0495671_0000723 3300046692 Bacteria 23834
450 Ga0495671_0001777 3300046692 Bacteria 13946
451 Ga0495671_0006719 3300046692 Bacteria 6625
452 Ga0495671_0025501 3300046692 Bacteria 3072
453 Ga0495671_0049635 3300046692 Bacteria 2091
454 Ga0495671_0239734 3300046692 Bacteria 876
455 Ga0495671_0324048 3300046692 Bacteria 740
456 Ga0495649_0007424 3300046694 Bacteria 6682
457 Ga0495649_0054692 3300046694 Bacteria 2157
458 Ga0495649_0101989 3300046694 Bacteria 1524
459 Ga0495589_0000314 3300046794 Bacteria 38602
460 Ga0495589_0001164 3300046794 Bacteria 15661
461 Ga0495589_0001578 3300046794 Bacteria 13095
462 Ga0495589_0009411 3300046794 Bacteria 5082
463 Ga0495660_0000008 3300046810 Bacteria 435769
464 Ga0495660_0000180 3300046810 Bacteria 68501
465 Ga0495660_0032348 3300046810 Bacteria 2937
466 Ga0495660_0035700 3300046810 Bacteria 2776
467 Ga0495674_1116356 3300047319 Bacteria 599
468 Ga0495672_0017827 3300047320 Bacteria 4737
469 Ga0495672_0028694 3300047320 Bacteria 3515
470 Ga0495683_0002728 3300047323 Bacteria 10527
471 Ga0495683_0006757 3300047323 Bacteria 6241
472 Ga0495683_0081831 3300047323 Bacteria 1574
473 Ga0495683_0231759 3300047323 Bacteria 818
474 Ga0495679_000001 3300047446 Bacteria 1607568
475 Ga0495679_000115 3300047446 Bacteria 71277
476 Ga0495679_000353 3300047446 Bacteria 35879
477 Ga0495679_001477 3300047446 Bacteria 13301
478 Ga0495685_019269 3300047447 Bacteria 2344
479 Ga0495685_105681 3300047447 Bacteria 928
480 Ga0495673_0000001 3300047469 Bacteria 1630730
481 Ga0495673_0000030 3300047469 Bacteria 468915
482 Ga0495673_0000232 3300047469 Bacteria 81119
483 Ga0495673_0060860 3300047469 Bacteria 1618
484 Ga0495681_0005004 3300047470 Bacteria 8934
485 Ga0495681_0038721 3300047470 Bacteria 2334
486 Ga0495681_0147045 3300047470 Bacteria 991
487 Ga0495686_0000019 3300047472 Bacteria 434054
488 Ga0495686_0000077 3300047472 Bacteria 205924
489 Ga0495686_0022484 3300047472 Bacteria 4173
490 Ga0495686_0022650 3300047472 Bacteria 4154
491 Ga0495686_0041028 3300047472 Bacteria 2948
492 Ga0495686_0076792 3300047472 Bacteria 2046
493 Ga0495602_0192922 3300048088 Bacteria 1560
494 Ga0495626_0012020 3300048091 Bacteria 4556
495 Ga0495626_0019776 3300048091 Bacteria 3363
496 Ga0496102_0029176 3300048905 Bacteria 4934
497 Ga0496103_0031599 3300048906 Bacteria 3227
498 Ga0496105_0012131 3300048908 Bacteria 6823
499 Ga0496106_0000034 3300048909 Bacteria 130368
500 Ga0496106_0001636 3300048909 Bacteria 16807
501 Ga0496106_0015200 3300048909 Bacteria 5697
502 Ga0496112_0441348 3300048915 Bacteria 1240
503 Ga0496115_0056353 3300048918 Bacteria 3159
504 Ga0496116_0024416 3300048919 Bacteria 4472
505 Ga0496116_0033295 3300048919 Bacteria 3659
506 Ga0496116_0038617 3300048919 Bacteria 3312
507 Ga0496117_0000876 3300048920 Bacteria 46421
508 Ga0496117_0040887 3300048920 Bacteria 3404
509 Ga0496117_0070320 3300048920 Bacteria 2352
510 Ga0496117_0082586 3300048920 Bacteria 2104
511 Ga0496117_0093467 3300048920 Bacteria 1928
512 Ga0496117_0166931 3300048920 Bacteria 1282
513 Ga0496118_0007642 3300048921 Bacteria 11383
514 Ga0496118_0018109 3300048921 Bacteria 6372
515 Ga0496118_0024104 3300048921 Bacteria 5262
516 Ga0496118_0028642 3300048921 Bacteria 4686
517 Ga0496118_0040829 3300048921 Bacteria 3683
518 Ga0496118_0045206 3300048921 Bacteria 3440
519 Ga0496118_0244343 3300048921 Bacteria 1025
520 Ga0496119_0062587 3300048922 Bacteria 2216
521 Ga0496119_0122302 3300048922 Bacteria 1429
522 Ga0496120_0003942 3300048923 Bacteria 12927
523 Ga0496120_0029932 3300048923 Bacteria 3318
524 Ga0496120_0034799 3300048923 Bacteria 3014
525 Ga0496120_0059413 3300048923 Bacteria 2143
526 Ga0496121_0000278 3300048924 Bacteria 106838
527 Ga0496121_0000431 3300048924 Bacteria 82456
528 Ga0496121_0001587 3300048924 Bacteria 37821
529 Ga0496121_0008874 3300048924 Bacteria 11691
530 Ga0496121_0017270 3300048924 Bacteria 7383
531 Ga0496121_0034837 3300048924 Bacteria 4522
532 Ga0496121_0052326 3300048924 Bacteria 3431
533 Ga0496121_0082577 3300048924 Bacteria 2539
534 Ga0496121_0208549 3300048924 Bacteria 1386
535 Ga0496121_0265551 3300048924 Bacteria 1182
536 Ga0496121_0293537 3300048924 Bacteria 1106
537 Ga0496122_0016926 3300048925 Bacteria 6851
538 Ga0496122_0057665 3300048925 Bacteria 2882
539 Ga0496122_0061624 3300048925 Bacteria 2752
540 Ga0496122_0259322 3300048925 Bacteria 966
541 Ga0496122_0287164 3300048925 Bacteria 895
542 Ga0496122_0289509 3300048925 Bacteria 890
543 Ga0496123_0003223 3300048926 Bacteria 18571
544 Ga0496123_0011469 3300048926 Bacteria 7678
545 Ga0496123_0052857 3300048926 Bacteria 2690
546 Ga0496123_0074724 3300048926 Bacteria 2096
547 Ga0496123_0177402 3300048926 Bacteria 1117
548 Ga0496123_0273617 3300048926 Bacteria 820
549 Ga0496124_0000948 3300048927 Bacteria 46382
550 Ga0496124_0018685 3300048927 Bacteria 6485
551 Ga0496124_0042475 3300048927 Bacteria 3915
552 Ga0496124_0050938 3300048927 Bacteria 3525
553 Ga0496124_0061560 3300048927 Bacteria 3145
554 Ga0496124_0293175 3300048927 Bacteria 1179
555 Ga0496124_0296988 3300048927 Bacteria 1169
556 Ga0496124_0425366 3300048927 Bacteria 913
557 Ga0496125_0000915 3300048928 Bacteria 46451
558 Ga0496125_0004839 3300048928 Bacteria 15295
559 Ga0496125_0020402 3300048928 Bacteria 6219
560 Ga0496125_0059444 3300048928 Bacteria 3080
561 Ga0496125_0060612 3300048928 Bacteria 3040
562 Ga0496125_0099352 3300048928 Bacteria 2150
563 Ga0496125_0107708 3300048928 Bacteria 2029
564 Ga0496126_0000389 3300048929 Bacteria 90452
565 Ga0496126_0036072 3300048929 Bacteria 4628
566 Ga0496126_0042656 3300048929 Bacteria 4188
567 Ga0496126_0123351 3300048929 Bacteria 2244
568 Ga0496126_0137070 3300048929 Bacteria 2110
569 Ga0496126_0211273 3300048929 Bacteria 1634
570 Ga0496126_0251378 3300048929 Bacteria 1473
571 Ga0496126_0577063 3300048929 Bacteria 889
572 Ga0495678_000023 3300049459 Bacteria 233463
573 Ga0495678_005024 3300049459 Bacteria 7448
574 Ga0495682_0000048 3300049460 Bacteria 111881
575 Ga0495682_0009290 3300049460 Bacteria 3841
576 Ga0495682_0040669 3300049460 Bacteria 1704
577 Ga0501031_0111305 3300049568 Bacteria 1788
578 Ga0501031_0263145 3300049568 Bacteria 1120
579 Ga0501032_0035390 3300049569 Bacteria 3414
580 Ga0501033_0004794 3300049570 Bacteria 10800
581 Ga0501033_0142874 3300049570 Bacteria 1730
582 Ga0501033_0282525 3300049570 Bacteria 1171
583 Ga0501034_0049617 3300049571 Bacteria 4234
584 Ga0501036_0008151 3300049572 Bacteria 8585
585 Ga0501036_0837465 3300049572 Bacteria 756
586 Ga0501037_0032822 3300049573 Bacteria 3835
587 Ga0501037_0073082 3300049573 Bacteria 2493
588 Ga0501038_0073981 3300049574 Bacteria 2883
589 Ga0501038_0171767 3300049574 Bacteria 1754
590 Ga0501040_0324588 3300049576 Bacteria 1101
591 Ga0501042_0206234 3300049578 Bacteria 1417
592 Ga0501043_0012070 3300049579 Bacteria 6756
593 Ga0501043_0352869 3300049579 Bacteria 1117
594 Ga0501043_0383111 3300049579 Bacteria 1064
595 Ga0501046_0026164 3300049580 Bacteria 4766
596 Ga0501047_0034665 3300049581 Bacteria 4873
597 Ga0501047_0067086 3300049581 Bacteria 3458
598 Ga0501047_0147685 3300049581 Bacteria 2227
599 Ga0501048_0075671 3300049582 Bacteria 2375
600 Ga0501070_0040316 3300049586 Bacteria 3894
601 Ga0501070_0136002 3300049586 Bacteria 2029
602 Ga0501080_0100403 3300049742 Bacteria 2685
603 Ga0501035_0006541 3300049822 Bacteria 10933
604 Ga0501035_0040819 3300049822 Bacteria 4192
605 Ga0501035_0123479 3300049822 Bacteria 2261
606 Ga0501035_0245948 3300049822 Bacteria 1520
607 Ga0501044_0026488 3300049823 Bacteria 6136
608 Ga0501044_0089010 3300049823 Bacteria 3116
609 Ga0501044_0128377 3300049823 Bacteria 2531
610 Ga0501044_0261434 3300049823 Bacteria 1669
611 Ga0501044_0314965 3300049823 Bacteria 1490
612 Ga0501044_0388977 3300049823 Bacteria 1309
613 Ga0500643_000002 3300053087 Bacteria 1277657
614 Ga0500651_0139885 3300053093 Bacteria 1460
615 Ga0500555_000716 3300053103 Bacteria 12470
616 Ga0500595_008673 3300053119 Bacteria 4145
617 Ga0500658_0072422 3300053134 Bacteria 1457
618 Ga0500568_0010576 3300053139 Bacteria 4310
619 Ga0500568_0110468 3300053139 Bacteria 1028
620 Ga0500622_0001338 3300053156 Bacteria 19968
621 Ga0500633_0000151 3300053160 Bacteria 9308
622 Ga0500634_0002831 3300053161 Bacteria 7485
623 Ga0500645_000704 3300053730 Bacteria 20751
624 Ga0587088_038126 3300059508 Bacteria 893
625 Ga0466962_0008594 3300061719 Bacteria 4895
626 Ga0466962_0008862 3300061719 Bacteria 4821
627 2511196366 2510917030 Bacteria 7460662
628 2513597942 2513237088 Bacteria 6927906
629 2519457225 2519103095 Bacteria 6629912
630 2563062580 2562617112 Bacteria 10918404
631 2585226312 2582581298 Bacteria 7315509
632 2585292231 2582581311 Bacteria 6763856
633 2585548768 2585427529 Bacteria 7395659
634 2597864618 2597489888 Bacteria 6179543
635 2597870424 2597489889 Bacteria 6297495
636 2599397792 2599185167 Bacteria 6353609
637 2599452238 2599185179 Bacteria 6611171
638 2599506821 2599185189 Bacteria 5862825
639 2599513383 2599185190 Bacteria 6285678
640 2599518118 2599185191 Bacteria 6297582
641 2599738838 2599185239 Bacteria 8686614
642 2599747547 2599185240 Bacteria 7968121
643 2599880941 2599185288 Bacteria 6666191
644 2599892060 2599185290 Bacteria 6289611
645 2599949926 2599185303 Bacteria 6512725
646 2600209431 2599185355 Bacteria 7968906
647 2600811847 2600255067 Bacteria 6795583
648 2601690089 2600255296 Bacteria 5784754
649 2621298870 2619619299 Bacteria 6649820
650 2643871323 2643221571 Bacteria 6228673
651 2643894630 2643221577 Bacteria 3710843
652 2643974623 2643221593 Bacteria 6296053
653 2644476782 2643221685 Bacteria 3673288
654 2644622752 2643221713 Bacteria 6554480
655 2676745490 2675903129 Bacteria 7964495
656 2677900663 2675903420 Bacteria 6247433
657 2687582168 2687453130 Bacteria 4227172
658 2713476816 2711768613 Bacteria 11048459
659 2721027675 2718218334 Bacteria 4765486
660 2723249400 2721755607 Bacteria 5841722
661 2735836765 2734482264 Unclassified 5014763
662 2738672117 2738541265 Bacteria 6594665
663 2738750510 2738541282 Bacteria 6593925
664 2738806010 2738541294 Bacteria 6925949
665 2738859551 2738541303 Bacteria 6591772
666 2738893370 2738541309 Bacteria 6926455
667 2739228682 2738543009 Bacteria 4944499
668 2748018389 2747842501 Bacteria 5293829
669 2792839895 2791355137 Bacteria 9654227
670 2808971272 2808606384 Bacteria 8474373
671 2808979048 2808606385 Bacteria 6711065
672 2808994637 2808606388 Bacteria 6706662
673 2809006344 2808606390 Bacteria 8476311
674 2809013239 2808606391 Bacteria 8308166
675 2817259429 2816332253 Bacteria 6764532
676 2817277097 2816332256 Bacteria 6891714
677 2817454012 2816332286 Bacteria 6853759
678 2817491969 2816332298 Bacteria 6852809
679 2819562955 2818991440 Bacteria 4774720
680 2819634794 2818991452 Bacteria 8442785
681 2834032782 2834028612 Bacteria 6354979
682 2842805997 2842805378 Bacteria 5385175
683 2842828248 2842826826 Bacteria 5974129
684 2842841154 2842837860 Bacteria 6066181
685 2852613733 2852612431 Bacteria 6885235
686 2852668531 2852667396 Bacteria 6885555
687 2855734563 2855730933 Bacteria 7047938
688 2855770153 2855767633 Bacteria 7049357
689 2860871129 2860867994 Bacteria 5645326
690 2863425472 2863421361 Bacteria 7300805
691 2870069724 2870068957 Bacteria 8925310
692 2881414366 2881412998 Bacteria 6492157
693 2884340362 2884338543 Bacteria 4610696
694 2895396664 2895395659 Bacteria 3983269
695 2900641146 2900634093 Bacteria 10263517
696 2904463567 2904463128 Bacteria 4775606
697 2904570230 2904564687 Bacteria 7609577
698 2904577238 2904571731 Bacteria 7608790
699 2908450464 2908446538 Bacteria 6829095
700 2919104760 2919100787 Bacteria 7710546
701 2928108594 2928108538 Bacteria 7360024
702 2928135818 2928135762 Bacteria 7259641
703 2928163653 2928157003 Bacteria 7522202
704 2928170598 2928163908 Bacteria 7561269
705 2928175932 2928170801 Bacteria 8785406
706 2928541571 2928536128 Bacteria 7657547
707 2928964195 2928963466 Bacteria 5165703
708 2929193189 2929189879 Bacteria 5930554
709 2931393256 2931390751 Bacteria 6273349
710 2939614547 2939611941 Bacteria 3892017
711 2941473434 2941471342 Bacteria 5018624
712 2945932796 2945928738 Bacteria 6053221
713 2945964756 2945961074 Bacteria 7342064
714 2946009058 2946006987 Bacteria 6705746
715 2946031469 2946027586 Bacteria 6049274
716 2947238433 2947233263 Bacteria 6439278
717 2981995683 2981990288 Bacteria 7590678
718 3005452061 3005445848 Bacteria 6906074
719 642415063 641736154 Bacteria 7689995
720 642616070 642555113 Bacteria 8214658
721 643391069 643348555 Bacteria 3914947
722 8011352303 8011350971 Bacteria 6158957
723 8018851866 8018845410 Bacteria 8933938
724 8020813387 8020807995 Bacteria 6801506
725 8020939262 8020938398 Bacteria 7472757
726 8020958254 8020953355 Bacteria 7439080
727 8021128340 8021120328 Bacteria 8782274
728 8024487022 8024486573 Bacteria 6540512
729 8040169524 8040167225 Bacteria 6542727
730 8040174558 8040173305 Bacteria 6827067
731 8054287736 8054285046 Bacteria 6919322
732 8054348969 8054347763 Bacteria 5901107
733 8054506975 8054503363 Bacteria 6101651
734 8055821936 8055817908 Bacteria 6609162
735 8056154395 8056148874 Bacteria 6479865
736 8056165364 8056161164 Bacteria 6106669
737 Ga0157370_10018169
738 JGI25156J39149_1004808
739 JGI25162J39368_1000709
740 JGI25162J39368_1000822
741 JGI25162J39368_1002764
742 JGI25158J39367_1000059
743 JGI25157J39369_1001626
744 JGI25157J39369_1002929
745 JGI25157J39369_1003012
746 JGI25164J39214_1000149
747 JGI25164J39214_1000553
748 JGI25152J39213_1001248
749 JGI25152J39213_1004153
750 JGI25159J45721_1000504
751 JGI25165J46597_1000643
752 JGI25165J46597_1002587
753 JGI25153J46596_10014206
754 rootH2_10036142
755 rootL2_10209767
756 rootH1_10104958
757 rootH1_10168750
758 JGI25160J50197_1013524
759 JGI25161J50226_1000123
760 Ga0055538_1000072
761 Ga0055539_1000107
762 Ga0055533_1000116
763 Ga0055532_1000103
764 Ga0055532_1003352
765 Ga0055525_1000160
766 Ga0055525_1000242
767 Ga0055527_1000248
768 Ga0055527_1000743
769 Ga0055527_1001164
770 Ga0055527_1021903
771 Ga0055535_1000398
772 Ga0055535_1000680
773 Ga0055535_1001824
774 Ga0055535_1002504
775 Ga0055535_1003305
776 Ga0055542_1000264
777 Ga0055542_1000552
778 Ga0055542_1001663
779 Ga0055542_1002426
780 Ga0055542_1011628
781 Ga0055529_1000448
782 Ga0055529_1000912
783 Ga0055529_1002010
784 Ga0055529_1003524
785 Ga0055529_1004565
786 Ga0055526_1007035
787 Ga0055526_1015265
788 Ga0055524_1023420
789 Ga0055528_1001408
790 Ga0055528_1006055
791 Ga0055540_1009899
792 Ga0055541_1000073
793 Ga0058692_1042727
794 Ga0055543_1000116
795 Ga0065714_10064735
796 Ga0065712_10090700
797 Ga0070670_100003042
798 Ga0070680_101232918
799 Ga0070661_100000036
800 Ga0070661_100484145
801 Ga0070692_10190799
802 Ga0070669_100000957
803 Ga0070675_100289915
804 Ga0070671_100495032
805 Ga0070673_100693858
806 Ga0070659_100032863
807 Ga0070667_100032538
808 Ga0070714_100000034
809 Ga0070714_100001388
810 Ga0070714_100444550
811 Ga0070713_100072468
812 Ga0070678_100055749
813 Ga0070662_100002793
814 Ga0070662_100063289
815 Ga0070681_10010947
816 Ga0068853_100047582
817 Ga0070696_100096309
818 Ga0070693_100329374
819 Ga0070665_100324744
820 Ga0068855_100001262
821 Ga0068855_100971569
822 Ga0068855_101289442
823 Ga0070664_100000486
824 Ga0068854_100000826
825 Ga0068854_100108357
826 Ga0068854_100245888
827 Ga0068856_100001540
828 Ga0068856_101800351
829 Ga0068851_10000103
830 Ga0075362_10024489
831 Ga0099826_10000027
832 Ga0105251_10001158
833 Ga0105251_10003812
834 Ga0105251_10034598
835 Ga0105251_10079460
836 Ga0105244_10012702
837 Ga0105244_10018596
838 Ga0105244_10036357
839 Ga0105244_10093304
840 Ga0105250_10000128
841 Ga0105250_10113269
842 Ga0105240_10012639
843 Ga0105240_10118123
844 Ga0105243_10123874
845 Ga0105243_10738890
846 Ga0105241_10938122
847 Ga0105242_10000520
848 Ga0105248_10034883
849 Ga0105248_10107818
850 Ga0105237_10000163
851 Ga0105237_10001127
852 Ga0105237_10191665
853 Ga0105238_10975370
854 Ga0105249_10835182
855 Ga0105147_105401
856 Ga0105246_10022660
857 Ga0157340_1000944
858 Ga0157373_10005057
859 Ga0157373_10006322
860 Ga0157370_10045890
861 Ga0157370_10072831
862 Ga0157370_10149538
863 Ga0157369_10009908
864 Ga0157369_10019997
865 Ga0157369_10030321
866 Ga0157369_10100543
867 Ga0163162_10001674
868 Ga0163162_10005933
869 Ga0163162_10268377
870 Ga0157372_11717898
871 Ga0157375_10001075
872 Ga0157375_10011307
873 Ga0157375_10021437
874 Ga0157375_10050147
875 Ga0163163_10996973
876 Ga0182008_10002178
877 Ga0182008_10003123
878 Ga0182008_10036927
879 Ga0182008_10078526
880 Ga0182008_10082212
881 Ga0182006_1000162
882 Ga0182006_1002213
883 Ga0182006_1125785
884 Ga0182007_10012520
885 Ga0182007_10020320
886 Ga0182007_10102127
887 Ga0183369_1003
888 Ga0163161_10004002
889 Ga0163161_10073634
890 Ga0163161_10083107
891 Ga0163161_10125285
892 Ga0163161_10152942
893 Ga0163161_10196117
894 Ga0206356_11398797
895 Ga0213876_10032386
896 Ga0209435_101295
897 Ga0209436_100066
898 Ga0209784_100110
899 Ga0209566_100131
900 Ga0209674_100154
901 Ga0209672_100007
902 Ga0209672_100115
903 Ga0209672_100552
904 Ga0209672_100652
905 Ga0209147_100158
906 Ga0209147_100164
907 Ga0209147_100412
908 Ga0209563_100071
909 Ga0209563_100133
910 Ga0207427_100021
911 Ga0207427_100123
912 Ga0209437_100087
913 Ga0209437_100106
914 Ga0209437_100227
915 Ga0209437_113517
916 Ga0209258_100017
917 Ga0209258_100260
918 Ga0209258_100261
919 Ga0209258_100271
920 Ga0209258_100379
921 Ga0209258_103817
922 Ga0209646_1000454
923 Ga0209646_1024566
924 Ga0209026_1000158
925 Ga0209026_1002678
926 Ga0209026_1009325
927 Ga0209677_100100
928 Ga0209148_1000002
929 Ga0209148_1000044
930 Ga0209148_1000045
931 Ga0209148_1000104
932 Ga0209148_1008815
933 Ga0209759_1000150
934 Ga0209759_1001197
935 Ga0209759_1003231
936 Ga0209759_1013122
937 Ga0209759_1037181
938 Ga0209759_1046899
939 Ga0209129_1000653
940 Ga0209129_1003691
941 Ga0209233_1000023
942 Ga0209233_1000419
943 Ga0209565_1003844
944 Ga0209455_1000010
945 Ga0209455_1000035
946 Ga0209455_1000097
947 Ga0209455_1000218
948 Ga0209455_1000774
949 Ga0209673_1000124
950 Ga0209673_1005112
951 Ga0209673_1007502
952 Ga0209673_1032748
953 Ga0209130_1000022
954 Ga0209025_1000003
955 Ga0209025_1028046
956 Ga0209564_1000475
957 Ga0209564_1025883
958 Ga0209758_1028297
959 Ga0209758_1068198
960 Ga0209256_1004167
961 Ga0209256_1020693
962 Ga0207426_1000005
963 Ga0209051_1018719
964 Ga0209257_1012027
965 Ga0207656_10002930
966 Ga0207696_1000143
967 Ga0207655_1000173
968 Ga0207655_1032811
969 Ga0207655_1037840
970 Ga0207655_1107367
971 Ga0207713_1000315
972 Ga0207713_1001848
973 Ga0207713_1006439
974 Ga0207680_10000002
975 Ga0207680_10032126
976 Ga0207647_10003916
977 Ga0207695_10010058
978 Ga0207695_10088148
979 Ga0207695_10142571
980 Ga0207695_10223078
981 Ga0207671_10000196
982 Ga0207671_10001413
983 Ga0207693_10072328
984 Ga0207663_10330980
985 Ga0207660_10677987
986 Ga0207657_10056277
987 Ga0207657_10433498
988 Ga0207649_10000042
989 Ga0207649_10119572
990 Ga0207652_10153258
991 Ga0207681_10745968
992 Ga0207694_10257706
993 Ga0207650_10000874
994 Ga0207700_10010034
995 Ga0207664_10000021
996 Ga0207664_10006826
997 Ga0207664_10119125
998 Ga0207644_10140926
999 Ga0207644_10595055
1000 Ga0207690_10000384
1001 Ga0207706_10000566
1002 Ga0207706_10052954
1003 Ga0207686_10039967
1004 Ga0207709_10022553
1005 Ga0207709_11047775
1006 Ga0207711_10011256
1007 Ga0207711_10019271
1008 Ga0207711_10080447
1009 Ga0207679_10000044
1010 Ga0207667_10000486
1011 Ga0207667_10274103
1012 Ga0207640_10000042
1013 Ga0207640_10014134
1014 Ga0207658_10021663
1015 Ga0207678_10270774
1016 Ga0207702_10000290
1017 Ga0207702_10456164
1018 Ga0207674_10063437
1019 Ga0209371_1000185
1020 Ga0209995_1011811
1021 Ga0209982_1000979
1022 Ga0209282_1000141
1023 Ga0209971_1010745
1024 Ga0209974_10001007
1025 Ga0268266_10237046
1026 Ga0307517_10119698
1027 Ga0265338_10001414
1028 Ga0268256_1000211
1029 Ga0307509_10133981
1030 Ga0307405_10002959
1031 Ga0307414_10190370
1032 Ga0395899_0024399
1033 Ga0395900_0456111
1034 Ga0395898_0000078
1035 Ga0395898_0034384
1036 Ga0395905_0486937
1037 Ga0395901_0036847
1038 Ga0237819_00428
1039 Ga0436365_0354829
1040 Ga0436361_0398230
1041 Ga0439447_013622
1042 Ga0451795_1066095
1043 Ga0451833_0445334
1044 Ga0451835_0648597
1045 Ga0451837_0320107
1046 Ga0451845_0592791
1047 Ga0451849_0216198
1048 Ga0451851_0154268
1049 Ga0451855_0271646
1050 Ga0439432_001612
1051 Ga0439432_087301
1052 Ga0439452_101138
1053 Ga0439463_072582
1054 Ga0466969_0026432
1055 Ga0466969_0376695
1056 Ga0466972_0001620
1057 Ga0466982_0000013
1058 Ga0466965_0015127
1059 Ga0466965_0203664
1060 Ga0466966_0000593
1061 Ga0466966_0018299
1062 Ga0466961_0004765
1063 Ga0466961_0007797
1064 Ga0466961_0026181
1065 Ga0466961_0048224
1066 Ga0466971_0005784
1067 Ga0466971_0012041
1068 Ga0466968_0016998
1069 Ga0466970_0003402
1070 Ga0466970_0004073
1071 Ga0466970_0011372
1072 Ga0466970_0033761
1073 Ga0466957_0079195
1074 Ga0466957_0192323
1075 Ga0466960_0009427
1076 Ga0466959_0000172
1077 Ga0466959_0019023
1078 Ga0466959_0082073
1079 Ga0466959_0521420
1080 Ga0466958_0003894
1081 Ga0466958_0006576
1082 Ga0466967_0163594
1083 Ga0495617_000111
1084 Ga0495617_001833
1085 Ga0495627_000668
1086 Ga0495603_0149909
1087 Ga0495590_0079138
1088 Ga0495591_000762
1089 Ga0495591_040804
1090 Ga0495629_0113571
1091 Ga0495638_0000233
1092 Ga0495638_0004139
1093 Ga0495638_0010997
1094 Ga0495638_0121587
1095 Ga0495650_0017391
1096 Ga0495650_0025254
1097 Ga0495650_0029335
1098 Ga0495650_0084469
1099 Ga0495580_0114346
1100 Ga0495605_0001310
1101 Ga0495605_0001363
1102 Ga0495605_0006109
1103 Ga0495605_0316500
1104 Ga0495662_0113843
1105 Ga0495584_0000839
1106 Ga0495584_0024203
1107 Ga0495585_0000001
1108 Ga0495585_0007027
1109 Ga0495585_0044730
1110 Ga0495596_0000296
1111 Ga0495596_0015426
1112 Ga0495607_0000207
1113 Ga0495607_0000336
1114 Ga0495607_0015940
1115 Ga0495607_0033870
1116 Ga0495607_0035963
1117 Ga0495607_0057233
1118 Ga0495607_0083586
1119 Ga0495583_0001210
1120 Ga0495583_0004094
1121 Ga0495583_0006444
1122 Ga0495583_0009253
1123 Ga0495606_0001292
1124 Ga0495606_0007113
1125 Ga0495606_0010131
1126 Ga0495606_0052259
1127 Ga0495606_0073822
1128 Ga0495606_0074451
1129 Ga0495606_0177576
1130 Ga0495610_0000803
1131 Ga0495610_0001466
1132 Ga0495610_0043104
1133 Ga0495616_0000001
1134 Ga0495616_0007643
1135 Ga0495618_0179571
1136 Ga0495620_0000543
1137 Ga0495620_0004657
1138 Ga0495620_0009435
1139 Ga0495630_0287432
1140 Ga0495631_0000162
1141 Ga0495631_0000617
1142 Ga0495631_0072449
1143 Ga0495631_0161795
1144 Ga0495632_0002482
1145 Ga0495632_0007207
1146 Ga0495632_0010644
1147 Ga0495643_0031085
1148 Ga0495643_0148217
1149 Ga0495644_0342330
1150 Ga0495648_0000083
1151 Ga0495648_0004279
1152 Ga0495648_0026745
1153 Ga0495648_0098802
1154 Ga0495648_0191969
1155 Ga0495666_0018424
1156 Ga0495642_0018770
1157 Ga0495642_0027277
1158 Ga0495654_0000762
1159 Ga0495654_0115390
1160 Ga0495665_0060673
1161 Ga0495587_0305934
1162 Ga0495609_0000905
1163 Ga0495609_0002763
1164 Ga0495609_0170168
1165 Ga0495597_0031345
1166 Ga0495597_0040811
1167 Ga0495597_0194564
1168 Ga0495622_0109712
1169 Ga0495656_0138212
1170 Ga0495668_0013200
1171 Ga0495611_0000001
1172 Ga0495611_0014748
1173 Ga0495625_0000001
1174 Ga0495661_0000290
1175 Ga0495661_0001053
1176 Ga0495661_0002265
1177 Ga0495661_0008271
1178 Ga0495661_0040496
1179 Ga0495661_0388021
1180 Ga0495669_0006796
1181 Ga0495669_0042422
1182 Ga0495670_0002621
1183 Ga0495670_0019906
1184 Ga0495670_0038206
1185 Ga0495671_0000723
1186 Ga0495671_0001777
1187 Ga0495671_0006719
1188 Ga0495671_0025501
1189 Ga0495671_0049635
1190 Ga0495671_0239734
1191 Ga0495671_0324048
1192 Ga0495649_0007424
1193 Ga0495649_0054692
1194 Ga0495649_0101989
1195 Ga0495589_0000314
1196 Ga0495589_0001164
1197 Ga0495589_0001578
1198 Ga0495589_0009411
1199 Ga0495660_0000008
1200 Ga0495660_0000180
1201 Ga0495660_0032348
1202 Ga0495660_0035700
1203 Ga0495674_1116356
1204 Ga0495672_0017827
1205 Ga0495672_0028694
1206 Ga0495683_0002728
1207 Ga0495683_0006757
1208 Ga0495683_0081831
1209 Ga0495683_0231759
1210 Ga0495679_000001
1211 Ga0495679_000115
1212 Ga0495679_000353
1213 Ga0495679_001477
1214 Ga0495685_019269
1215 Ga0495685_105681
1216 Ga0495673_0000001
1217 Ga0495673_0000030
1218 Ga0495673_0000232
1219 Ga0495673_0060860
1220 Ga0495681_0005004
1221 Ga0495681_0038721
1222 Ga0495681_0147045
1223 Ga0495686_0000019
1224 Ga0495686_0000077
1225 Ga0495686_0022484
1226 Ga0495686_0022650
1227 Ga0495686_0041028
1228 Ga0495686_0076792
1229 Ga0495602_0192922
1230 Ga0495626_0012020
1231 Ga0495626_0019776
1232 Ga0496102_0029176
1233 Ga0496103_0031599
1234 Ga0496105_0012131
1235 Ga0496106_0000034
1236 Ga0496106_0001636
1237 Ga0496106_0015200
1238 Ga0496112_0441348
1239 Ga0496115_0056353
1240 Ga0496116_0024416
1241 Ga0496116_0033295
1242 Ga0496116_0038617
1243 Ga0496117_0000876
1244 Ga0496117_0040887
1245 Ga0496117_0070320
1246 Ga0496117_0082586
1247 Ga0496117_0093467
1248 Ga0496117_0166931
1249 Ga0496118_0007642
1250 Ga0496118_0018109
1251 Ga0496118_0024104
1252 Ga0496118_0028642
1253 Ga0496118_0040829
1254 Ga0496118_0045206
1255 Ga0496118_0244343
1256 Ga0496119_0062587
1257 Ga0496119_0122302
1258 Ga0496120_0003942
1259 Ga0496120_0029932
1260 Ga0496120_0034799
1261 Ga0496120_0059413
1262 Ga0496121_0000278
1263 Ga0496121_0000431
1264 Ga0496121_0001587
1265 Ga0496121_0008874
1266 Ga0496121_0017270
1267 Ga0496121_0034837
1268 Ga0496121_0052326
1269 Ga0496121_0082577
1270 Ga0496121_0208549
1271 Ga0496121_0265551
1272 Ga0496121_0293537
1273 Ga0496122_0016926
1274 Ga0496122_0057665
1275 Ga0496122_0061624
1276 Ga0496122_0259322
1277 Ga0496122_0287164
1278 Ga0496122_0289509
1279 Ga0496123_0003223
1280 Ga0496123_0011469
1281 Ga0496123_0052857
1282 Ga0496123_0074724
1283 Ga0496123_0177402
1284 Ga0496123_0273617
1285 Ga0496124_0000948
1286 Ga0496124_0018685
1287 Ga0496124_0042475
1288 Ga0496124_0050938
1289 Ga0496124_0061560
1290 Ga0496124_0293175
1291 Ga0496124_0296988
1292 Ga0496124_0425366
1293 Ga0496125_0000915
1294 Ga0496125_0004839
1295 Ga0496125_0020402
1296 Ga0496125_0059444
1297 Ga0496125_0060612
1298 Ga0496125_0099352
1299 Ga0496125_0107708
1300 Ga0496126_0000389
1301 Ga0496126_0036072
1302 Ga0496126_0042656
1303 Ga0496126_0123351
1304 Ga0496126_0137070
1305 Ga0496126_0211273
1306 Ga0496126_0251378
1307 Ga0496126_0577063
1308 Ga0495678_000023
1309 Ga0495678_005024
1310 Ga0495682_0000048
1311 Ga0495682_0009290
1312 Ga0495682_0040669
1313 Ga0501031_0111305
1314 Ga0501031_0263145
1315 Ga0501032_0035390
1316 Ga0501033_0004794
1317 Ga0501033_0142874
1318 Ga0501033_0282525
1319 Ga0501034_0049617
1320 Ga0501036_0008151
1321 Ga0501036_0837465
1322 Ga0501037_0032822
1323 Ga0501037_0073082
1324 Ga0501038_0073981
1325 Ga0501038_0171767
1326 Ga0501040_0324588
1327 Ga0501042_0206234
1328 Ga0501043_0012070
1329 Ga0501043_0352869
1330 Ga0501043_0383111
1331 Ga0501046_0026164
1332 Ga0501047_0034665
1333 Ga0501047_0067086
1334 Ga0501047_0147685
1335 Ga0501048_0075671
1336 Ga0501070_0040316
1337 Ga0501070_0136002
1338 Ga0501080_0100403
1339 Ga0501035_0006541
1340 Ga0501035_0040819
1341 Ga0501035_0123479
1342 Ga0501035_0245948
1343 Ga0501044_0026488
1344 Ga0501044_0089010
1345 Ga0501044_0128377
1346 Ga0501044_0261434
1347 Ga0501044_0314965
1348 Ga0501044_0388977
1349 Ga0500643_000002
1350 Ga0500651_0139885
1351 Ga0500555_000716
1352 Ga0500595_008673
1353 Ga0500658_0072422
1354 Ga0500568_0010576
1355 Ga0500568_0110468
1356 Ga0500622_0001338
1357 Ga0500633_0000151
1358 Ga0500634_0002831
1359 Ga0500645_000704
1360 Ga0587088_038126
1361 Ga0466962_0008594
1362 Ga0466962_0008862
1363 2511196366
1364 2513597942
1365 2519457225
1366 2563062580
1367 2585226312
1368 2585292231
1369 2585548768
1370 2597864618
1371 2597870424
1372 2599397792
1373 2599452238
1374 2599506821
1375 2599513383
1376 2599518118
1377 2599738838
1378 2599747547
1379 2599880941
1380 2599892060
1381 2599949926
1382 2600209431
1383 2600811847
1384 2601690089
1385 2621298870
1386 2643871323
1387 2643894630
1388 2643974623
1389 2644476782
1390 2644622752
1391 2676745490
1392 2677900663
1393 2687582168
1394 2713476816
1395 2721027675
1396 2723249400
1397 2735836765
1398 2738672117
1399 2738750510
1400 2738806010
1401 2738859551
1402 2738893370
1403 2739228682
1404 2748018389
1405 2792839895
1406 2808971272
1407 2808979048
1408 2808994637
1409 2809006344
1410 2809013239
1411 2817259429
1412 2817277097
1413 2817454012
1414 2817491969
1415 2819562955
1416 2819634794
1417 2834032782
1418 2842805997
1419 2842828248
1420 2842841154
1421 2852613733
1422 2852668531
1423 2855734563
1424 2855770153
1425 2860871129
1426 2863425472
1427 2870069724
1428 2881414366
1429 2884340362
1430 2895396664
1431 2900641146
1432 2904463567
1433 2904570230
1434 2904577238
1435 2908450464
1436 2919104760
1437 2928108594
1438 2928135818
1439 2928163653
1440 2928170598
1441 2928175932
1442 2928541571
1443 2928964195
1444 2929193189
1445 2931393256
1446 2939614547
1447 2941473434
1448 2945932796
1449 2945964756
1450 2946009058
1451 2946031469
1452 2947238433
1453 2981995683
1454 3005452061
1455 642415063
1456 642616070
1457 643391069
1458 8011352303
1459 8018851866
1460 8020813387
1461 8020939262
1462 8020958254
1463 8021128340
1464 8024487022
1465 8040169524
1466 8040174558
1467 8054287736
1468 8054348969
1469 8054506975
1470 8055821936
1471 8056154395
1472 8056165364

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01292

Ni_hydr_CYTB

Prokaryotic cytochrome b561

5

175

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oc0-assembly1.cif.gz_A structure of e. coli superoxide oxidase 0.8759 6 174
5oc0-assembly1.cif.gz_A structure of e. coli superoxide oxidase 0.8434 6 174
1kqf-assembly1.cif.gz_C formate dehydrogenase n from e. coli 0.6641 8 173
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.6552 8 165
6g94-assembly1.cif.gz_A structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b 0.612 8 164
ID Description Score Start End Superfamily
af_P76345_3_174_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8959 8 174 1.20.950.20
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8763 8 174 1.20.950.20
af_P76345_3_174_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8667 8 174 1.20.950.20
af_P0ABE5_4_173_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.8526 8 174 1.20.950.20
af_P0AEL0_1_211_1.20.950.20 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.6715 8 177 1.20.950.20
ID Description Score Start End GO Terms
AF-A0A4Q1HPY8-F1-model_v4 Cytochrome b 0.9868 6 176 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A1B4HPD7-F1-model_v4 deleted 0.9847 6 176
AF-A0A0S1Y1H0-F1-model_v4 Cytochrome B 0.9847 6 176 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A6P2SN87-F1-model_v4 Cytochrome B561 0.9842 6 176 GO:0005886
GO:0009055
GO:0020037
GO:0022904
GO:0046872
AF-A0A1I0KR83-F1-model_v4 deleted 0.9835 6 176

Map