F478264
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 736 | 408 | 1472 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10018169|Ga0157370_100181698 |
| Length | 212 |
| Sequence | MTSATFTLPARVLHWLMAVLIVAMLFIGVGMVASVSARHEWLLAIHKPLGIAILILAIVRLAVRLRHPPPPLPADLPALQKLAALASHWLLYFLMLAMPLIGWAMLSAGGYPVMLGTSLRLPPIFPTNATAFAVLRHLHGWFAALLFLTFLAHMAAALYHGLIRRDGVLPSMLRGRRTAAPILIGYADEPAATDPIEPGVARDGLDAAERTD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 6 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 7 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 8 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 17 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 20 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 22 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 23 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 31 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 60 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Metagenome | Rhizosphere |
| 74 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 81 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 87 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 99 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 103 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 113 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 156 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 161 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 162 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 163 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 164 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 167 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 168 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 169 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 170 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 172 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 173 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 174 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 175 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 176 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 177 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 178 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 179 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 180 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 181 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 182 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 183 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 184 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 185 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 186 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 187 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 188 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 252 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 253 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 254 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 258 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 259 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 260 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 261 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 262 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 263 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 264 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 265 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 268 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 288 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 289 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 290 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 291 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 292 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 293 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 294 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 295 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 296 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 297 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 299 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 300 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 301 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 302 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 303 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 304 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 305 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 306 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 307 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 308 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 309 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 310 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 311 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 312 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 313 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 314 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 315 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 316 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 317 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 318 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 319 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 320 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 321 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 322 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 323 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 324 | 2643221593 | Lysobacter sp. Root690 | Isolate | Unclassified |
| 325 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 326 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 327 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 328 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 329 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 330 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 331 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 332 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 333 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 334 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 335 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 336 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 337 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 338 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 339 | 2738543009 | Luteibacter sp. OK325 | Isolate | Unclassified |
| 340 | 2747842501 | Xanthomonas sp. WCS2014-23 | Isolate | Unclassified |
| 341 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 342 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 343 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 344 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 345 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 346 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 347 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 348 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 349 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 350 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 351 | 2818991440 | Luteibacter yeojuensis 583 | Isolate | Unclassified |
| 352 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 353 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 354 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 355 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 356 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 357 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 358 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 359 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 360 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 361 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 362 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 363 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 364 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 365 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 366 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 367 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 368 | 2904463128 | Luteibacter yeojuensis 3191 | Isolate | Unclassified |
| 369 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 370 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 371 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 372 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 373 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 374 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 375 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 376 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 377 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 378 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 379 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 380 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 381 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 382 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 383 | 2941471342 | Luteibacter sp. 621 | Isolate | Unclassified |
| 384 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 385 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 386 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 387 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 388 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 389 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 390 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 391 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 392 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 393 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 394 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 395 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 396 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 397 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 398 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 399 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 400 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 401 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 402 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 403 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 404 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 405 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 406 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 407 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 408 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.78 |
| Metatranscriptomes | 0.27 |
| Isolates | 14.95 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.9 |
| Nodule | 1.09 |
| Rhizoplane | 2.99 |
| Rhizosphere | 59.78 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157370_10018169 | 3300013104 | Bacteria | 7077 |
| 2 | JGI25156J39149_1004808 | 3300002705 | Bacteria | 4035 |
| 3 | JGI25162J39368_1000709 | 3300002737 | Bacteria | 23155 |
| 4 | JGI25162J39368_1000822 | 3300002737 | Bacteria | 20460 |
| 5 | JGI25162J39368_1002764 | 3300002737 | Bacteria | 6248 |
| 6 | JGI25158J39367_1000059 | 3300002739 | Bacteria | 24502 |
| 7 | JGI25157J39369_1001626 | 3300002741 | Bacteria | 7756 |
| 8 | JGI25157J39369_1002929 | 3300002741 | Bacteria | 3786 |
| 9 | JGI25157J39369_1003012 | 3300002741 | Bacteria | 3690 |
| 10 | JGI25164J39214_1000149 | 3300002772 | Bacteria | 67364 |
| 11 | JGI25164J39214_1000553 | 3300002772 | Bacteria | 17152 |
| 12 | JGI25152J39213_1001248 | 3300002773 | Bacteria | 11603 |
| 13 | JGI25152J39213_1004153 | 3300002773 | Bacteria | 4672 |
| 14 | JGI25159J45721_1000504 | 3300002987 | Bacteria | 17816 |
| 15 | JGI25165J46597_1000643 | 3300003214 | Bacteria | 28939 |
| 16 | JGI25165J46597_1002587 | 3300003214 | Bacteria | 5528 |
| 17 | JGI25153J46596_10014206 | 3300003215 | Bacteria | 3323 |
| 18 | rootH2_10036142 | 3300003320 | Bacteria | 15654 |
| 19 | rootL2_10209767 | 3300003322 | Bacteria | 1299 |
| 20 | rootH1_10104958 | 3300003323 | Bacteria | 8292 |
| 21 | rootH1_10168750 | 3300003323 | Bacteria | 4267 |
| 22 | JGI25160J50197_1013524 | 3300003354 | Bacteria | 2776 |
| 23 | JGI25161J50226_1000123 | 3300003374 | Bacteria | 56542 |
| 24 | Ga0055538_1000072 | 3300003751 | Bacteria | 91545 |
| 25 | Ga0055539_1000107 | 3300003752 | Bacteria | 91545 |
| 26 | Ga0055533_1000116 | 3300003756 | Bacteria | 91545 |
| 27 | Ga0055532_1000103 | 3300003758 | Bacteria | 91541 |
| 28 | Ga0055532_1003352 | 3300003758 | Bacteria | 2789 |
| 29 | Ga0055525_1000160 | 3300003759 | Bacteria | 87810 |
| 30 | Ga0055525_1000242 | 3300003759 | Bacteria | 55608 |
| 31 | Ga0055527_1000248 | 3300003760 | Bacteria | 33362 |
| 32 | Ga0055527_1000743 | 3300003760 | Bacteria | 9162 |
| 33 | Ga0055527_1001164 | 3300003760 | Bacteria | 5960 |
| 34 | Ga0055527_1021903 | 3300003760 | Bacteria | 662 |
| 35 | Ga0055535_1000398 | 3300003761 | Bacteria | 40844 |
| 36 | Ga0055535_1000680 | 3300003761 | Bacteria | 26481 |
| 37 | Ga0055535_1001824 | 3300003761 | Bacteria | 9162 |
| 38 | Ga0055535_1002504 | 3300003761 | Bacteria | 6298 |
| 39 | Ga0055535_1003305 | 3300003761 | Bacteria | 4656 |
| 40 | Ga0055542_1000264 | 3300003762 | Bacteria | 58581 |
| 41 | Ga0055542_1000552 | 3300003762 | Bacteria | 33226 |
| 42 | Ga0055542_1001663 | 3300003762 | Bacteria | 9910 |
| 43 | Ga0055542_1002426 | 3300003762 | Bacteria | 6197 |
| 44 | Ga0055542_1011628 | 3300003762 | Bacteria | 1554 |
| 45 | Ga0055529_1000448 | 3300003763 | Bacteria | 40848 |
| 46 | Ga0055529_1000912 | 3300003763 | Bacteria | 16130 |
| 47 | Ga0055529_1002010 | 3300003763 | Bacteria | 4457 |
| 48 | Ga0055529_1003524 | 3300003763 | Bacteria | 2577 |
| 49 | Ga0055529_1004565 | 3300003763 | Bacteria | 2091 |
| 50 | Ga0055526_1007035 | 3300003771 | Bacteria | 5951 |
| 51 | Ga0055526_1015265 | 3300003771 | Bacteria | 3093 |
| 52 | Ga0055524_1023420 | 3300003775 | Bacteria | 1988 |
| 53 | Ga0055528_1001408 | 3300003790 | Bacteria | 14733 |
| 54 | Ga0055528_1006055 | 3300003790 | Bacteria | 5531 |
| 55 | Ga0055540_1009899 | 3300003792 | Bacteria | 3228 |
| 56 | Ga0055541_1000073 | 3300003841 | Bacteria | 91545 |
| 57 | Ga0058692_1042727 | 3300003856 | Bacteria | 786 |
| 58 | Ga0055543_1000116 | 3300004625 | Bacteria | 67872 |
| 59 | Ga0065714_10064735 | 3300005288 | Bacteria | 20692 |
| 60 | Ga0065712_10090700 | 3300005290 | Bacteria | 2402 |
| 61 | Ga0070670_100003042 | 3300005331 | Bacteria | 13876 |
| 62 | Ga0070680_101232918 | 3300005336 | Bacteria | 647 |
| 63 | Ga0070661_100000036 | 3300005344 | Bacteria | 108531 |
| 64 | Ga0070661_100484145 | 3300005344 | Bacteria | 988 |
| 65 | Ga0070692_10190799 | 3300005345 | Bacteria | 1194 |
| 66 | Ga0070669_100000957 | 3300005353 | Bacteria | 21077 |
| 67 | Ga0070675_100289915 | 3300005354 | Bacteria | 1440 |
| 68 | Ga0070671_100495032 | 3300005355 | Bacteria | 1051 |
| 69 | Ga0070673_100693858 | 3300005364 | Bacteria | 934 |
| 70 | Ga0070659_100032863 | 3300005366 | Bacteria | 4028 |
| 71 | Ga0070667_100032538 | 3300005367 | Bacteria | 4350 |
| 72 | Ga0070714_100000034 | 3300005435 | Bacteria | 130742 |
| 73 | Ga0070714_100001388 | 3300005435 | Bacteria | 17551 |
| 74 | Ga0070714_100444550 | 3300005435 | Bacteria | 1231 |
| 75 | Ga0070713_100072468 | 3300005436 | Bacteria | 2913 |
| 76 | Ga0070678_100055749 | 3300005456 | Bacteria | 2887 |
| 77 | Ga0070662_100002793 | 3300005457 | Bacteria | 10813 |
| 78 | Ga0070662_100063289 | 3300005457 | Bacteria | 2706 |
| 79 | Ga0070681_10010947 | 3300005458 | Bacteria | 8971 |
| 80 | Ga0068853_100047582 | 3300005539 | Bacteria | 3681 |
| 81 | Ga0070696_100096309 | 3300005546 | Bacteria | 2115 |
| 82 | Ga0070693_100329374 | 3300005547 | Bacteria | 1039 |
| 83 | Ga0070665_100324744 | 3300005548 | Bacteria | 1543 |
| 84 | Ga0068855_100001262 | 3300005563 | Bacteria | 31405 |
| 85 | Ga0068855_100971569 | 3300005563 | Bacteria | 894 |
| 86 | Ga0068855_101289442 | 3300005563 | Bacteria | 756 |
| 87 | Ga0070664_100000486 | 3300005564 | Bacteria | 30104 |
| 88 | Ga0068854_100000826 | 3300005578 | Bacteria | 18477 |
| 89 | Ga0068854_100108357 | 3300005578 | Bacteria | 2092 |
| 90 | Ga0068854_100245888 | 3300005578 | Bacteria | 1426 |
| 91 | Ga0068856_100001540 | 3300005614 | Bacteria | 24168 |
| 92 | Ga0068856_101800351 | 3300005614 | Bacteria | 624 |
| 93 | Ga0068851_10000103 | 3300005834 | Bacteria | 45687 |
| 94 | Ga0075362_10024489 | 3300006177 | Bacteria | 2561 |
| 95 | Ga0099826_10000027 | 3300006948 | Bacteria | 140533 |
| 96 | Ga0105251_10001158 | 3300009011 | Bacteria | 22899 |
| 97 | Ga0105251_10003812 | 3300009011 | Bacteria | 10744 |
| 98 | Ga0105251_10034598 | 3300009011 | Bacteria | 2498 |
| 99 | Ga0105251_10079460 | 3300009011 | Bacteria | 1517 |
| 100 | Ga0105244_10012702 | 3300009036 | Bacteria | 4965 |
| 101 | Ga0105244_10018596 | 3300009036 | Bacteria | 3895 |
| 102 | Ga0105244_10036357 | 3300009036 | Bacteria | 2580 |
| 103 | Ga0105244_10093304 | 3300009036 | Bacteria | 1479 |
| 104 | Ga0105250_10000128 | 3300009092 | Bacteria | 65474 |
| 105 | Ga0105250_10113269 | 3300009092 | Bacteria | 1112 |
| 106 | Ga0105240_10012639 | 3300009093 | Bacteria | 11640 |
| 107 | Ga0105240_10118123 | 3300009093 | Bacteria | 3196 |
| 108 | Ga0105243_10123874 | 3300009148 | Bacteria | 2184 |
| 109 | Ga0105243_10738890 | 3300009148 | Bacteria | 963 |
| 110 | Ga0105241_10938122 | 3300009174 | Bacteria | 806 |
| 111 | Ga0105242_10000520 | 3300009176 | Bacteria | 30218 |
| 112 | Ga0105248_10034883 | 3300009177 | Bacteria | 5630 |
| 113 | Ga0105248_10107818 | 3300009177 | Bacteria | 3141 |
| 114 | Ga0105237_10000163 | 3300009545 | Bacteria | 94679 |
| 115 | Ga0105237_10001127 | 3300009545 | Bacteria | 35830 |
| 116 | Ga0105237_10191665 | 3300009545 | Bacteria | 2044 |
| 117 | Ga0105238_10975370 | 3300009551 | Bacteria | 868 |
| 118 | Ga0105249_10835182 | 3300009553 | Bacteria | 986 |
| 119 | Ga0105147_105401 | 3300009982 | Bacteria | 1073 |
| 120 | Ga0105246_10022660 | 3300011119 | Bacteria | 4055 |
| 121 | Ga0157340_1000944 | 3300012473 | Bacteria | 1239 |
| 122 | Ga0157373_10005057 | 3300013100 | Bacteria | 9906 |
| 123 | Ga0157373_10006322 | 3300013100 | Bacteria | 8849 |
| 124 | Ga0157370_10045890 | 3300013104 | Bacteria | 4191 |
| 125 | Ga0157370_10072831 | 3300013104 | Bacteria | 3241 |
| 126 | Ga0157370_10149538 | 3300013104 | Bacteria | 2174 |
| 127 | Ga0157369_10009908 | 3300013105 | Bacteria | 10889 |
| 128 | Ga0157369_10019997 | 3300013105 | Bacteria | 7487 |
| 129 | Ga0157369_10030321 | 3300013105 | Bacteria | 5965 |
| 130 | Ga0157369_10100543 | 3300013105 | Bacteria | 3082 |
| 131 | Ga0163162_10001674 | 3300013306 | Bacteria | 20781 |
| 132 | Ga0163162_10005933 | 3300013306 | Bacteria | 11821 |
| 133 | Ga0163162_10268377 | 3300013306 | Unclassified | 1838 |
| 134 | Ga0157372_11717898 | 3300013307 | Bacteria | 722 |
| 135 | Ga0157375_10001075 | 3300013308 | Bacteria | 23675 |
| 136 | Ga0157375_10011307 | 3300013308 | Bacteria | 7882 |
| 137 | Ga0157375_10021437 | 3300013308 | Bacteria | 5925 |
| 138 | Ga0157375_10050147 | 3300013308 | Bacteria | 4094 |
| 139 | Ga0163163_10996973 | 3300014325 | Bacteria | 901 |
| 140 | Ga0182008_10002178 | 3300014497 | Bacteria | 12461 |
| 141 | Ga0182008_10003123 | 3300014497 | Bacteria | 10136 |
| 142 | Ga0182008_10036927 | 3300014497 | Bacteria | 2444 |
| 143 | Ga0182008_10078526 | 3300014497 | Bacteria | 1624 |
| 144 | Ga0182008_10082212 | 3300014497 | Bacteria | 1585 |
| 145 | Ga0182006_1000162 | 3300015261 | Bacteria | 71391 |
| 146 | Ga0182006_1002213 | 3300015261 | Bacteria | 10777 |
| 147 | Ga0182006_1125785 | 3300015261 | Bacteria | 886 |
| 148 | Ga0182007_10012520 | 3300015262 | Bacteria | 3259 |
| 149 | Ga0182007_10020320 | 3300015262 | Bacteria | 2375 |
| 150 | Ga0182007_10102127 | 3300015262 | Bacteria | 950 |
| 151 | Ga0183369_1003 | 3300015685 | Bacteria | 726443 |
| 152 | Ga0163161_10004002 | 3300017792 | Bacteria | 10315 |
| 153 | Ga0163161_10073634 | 3300017792 | Bacteria | 2503 |
| 154 | Ga0163161_10083107 | 3300017792 | Bacteria | 2360 |
| 155 | Ga0163161_10125285 | 3300017792 | Bacteria | 1934 |
| 156 | Ga0163161_10152942 | 3300017792 | Bacteria | 1754 |
| 157 | Ga0163161_10196117 | 3300017792 | Bacteria | 1554 |
| 158 | Ga0206356_11398797 | 3300020070 | Bacteria | 3980 |
| 159 | Ga0213876_10032386 | 3300021384 | Bacteria | 2757 |
| 160 | Ga0209435_101295 | 3300025206 | Bacteria | 3267 |
| 161 | Ga0209436_100066 | 3300025208 | Bacteria | 54510 |
| 162 | Ga0209784_100110 | 3300025224 | Bacteria | 91931 |
| 163 | Ga0209566_100131 | 3300025225 | Bacteria | 91931 |
| 164 | Ga0209674_100154 | 3300025226 | Bacteria | 91931 |
| 165 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 166 | Ga0209672_100115 | 3300025228 | Bacteria | 89213 |
| 167 | Ga0209672_100552 | 3300025228 | Bacteria | 20231 |
| 168 | Ga0209672_100652 | 3300025228 | Bacteria | 17705 |
| 169 | Ga0209147_100158 | 3300025229 | Bacteria | 91931 |
| 170 | Ga0209147_100164 | 3300025229 | Bacteria | 90422 |
| 171 | Ga0209147_100412 | 3300025229 | Bacteria | 28498 |
| 172 | Ga0209563_100071 | 3300025230 | Bacteria | 232653 |
| 173 | Ga0209563_100133 | 3300025230 | Bacteria | 91931 |
| 174 | Ga0207427_100021 | 3300025231 | Bacteria | 494115 |
| 175 | Ga0207427_100123 | 3300025231 | Bacteria | 98859 |
| 176 | Ga0209437_100087 | 3300025233 | Bacteria | 253432 |
| 177 | Ga0209437_100106 | 3300025233 | Bacteria | 219071 |
| 178 | Ga0209437_100227 | 3300025233 | Bacteria | 98939 |
| 179 | Ga0209437_113517 | 3300025233 | Bacteria | 1165 |
| 180 | Ga0209258_100017 | 3300025242 | Bacteria | 590785 |
| 181 | Ga0209258_100260 | 3300025242 | Bacteria | 91919 |
| 182 | Ga0209258_100261 | 3300025242 | Bacteria | 90726 |
| 183 | Ga0209258_100271 | 3300025242 | Bacteria | 89095 |
| 184 | Ga0209258_100379 | 3300025242 | Bacteria | 57256 |
| 185 | Ga0209258_103817 | 3300025242 | Bacteria | 3081 |
| 186 | Ga0209646_1000454 | 3300025246 | Bacteria | 21498 |
| 187 | Ga0209646_1024566 | 3300025246 | Bacteria | 848 |
| 188 | Ga0209026_1000158 | 3300025250 | Bacteria | 106333 |
| 189 | Ga0209026_1002678 | 3300025250 | Bacteria | 6442 |
| 190 | Ga0209026_1009325 | 3300025250 | Bacteria | 1939 |
| 191 | Ga0209677_100100 | 3300025253 | Bacteria | 91931 |
| 192 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 193 | Ga0209148_1000044 | 3300025254 | Bacteria | 458417 |
| 194 | Ga0209148_1000045 | 3300025254 | Bacteria | 448076 |
| 195 | Ga0209148_1000104 | 3300025254 | Bacteria | 214254 |
| 196 | Ga0209148_1008815 | 3300025254 | Bacteria | 2006 |
| 197 | Ga0209759_1000150 | 3300025256 | Bacteria | 120839 |
| 198 | Ga0209759_1001197 | 3300025256 | Bacteria | 16140 |
| 199 | Ga0209759_1003231 | 3300025256 | Bacteria | 6595 |
| 200 | Ga0209759_1013122 | 3300025256 | Bacteria | 2257 |
| 201 | Ga0209759_1037181 | 3300025256 | Bacteria | 878 |
| 202 | Ga0209759_1046899 | 3300025256 | Bacteria | 695 |
| 203 | Ga0209129_1000653 | 3300025258 | Bacteria | 23204 |
| 204 | Ga0209129_1003691 | 3300025258 | Bacteria | 6498 |
| 205 | Ga0209233_1000023 | 3300025261 | Bacteria | 738870 |
| 206 | Ga0209233_1000419 | 3300025261 | Bacteria | 32032 |
| 207 | Ga0209565_1003844 | 3300025263 | Bacteria | 4730 |
| 208 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 209 | Ga0209455_1000035 | 3300025272 | Bacteria | 479071 |
| 210 | Ga0209455_1000097 | 3300025272 | Bacteria | 214136 |
| 211 | Ga0209455_1000218 | 3300025272 | Bacteria | 79966 |
| 212 | Ga0209455_1000774 | 3300025272 | Bacteria | 17922 |
| 213 | Ga0209673_1000124 | 3300025273 | Bacteria | 169015 |
| 214 | Ga0209673_1005112 | 3300025273 | Bacteria | 6725 |
| 215 | Ga0209673_1007502 | 3300025273 | Bacteria | 5009 |
| 216 | Ga0209673_1032748 | 3300025273 | Bacteria | 1597 |
| 217 | Ga0209130_1000022 | 3300025284 | Bacteria | 361244 |
| 218 | Ga0209025_1000003 | 3300025294 | Bacteria | 1366495 |
| 219 | Ga0209025_1028046 | 3300025294 | Bacteria | 2771 |
| 220 | Ga0209564_1000475 | 3300025295 | Bacteria | 67102 |
| 221 | Ga0209564_1025883 | 3300025295 | Bacteria | 1958 |
| 222 | Ga0209758_1028297 | 3300025297 | Bacteria | 2374 |
| 223 | Ga0209758_1068198 | 3300025297 | Bacteria | 1134 |
| 224 | Ga0209256_1004167 | 3300025299 | Bacteria | 9331 |
| 225 | Ga0209256_1020693 | 3300025299 | Bacteria | 2044 |
| 226 | Ga0207426_1000005 | 3300025302 | Bacteria | 1037188 |
| 227 | Ga0209051_1018719 | 3300025303 | Bacteria | 3053 |
| 228 | Ga0209257_1012027 | 3300025304 | Bacteria | 4067 |
| 229 | Ga0207656_10002930 | 3300025321 | Bacteria | 5822 |
| 230 | Ga0207696_1000143 | 3300025711 | Bacteria | 123194 |
| 231 | Ga0207655_1000173 | 3300025728 | Bacteria | 118589 |
| 232 | Ga0207655_1032811 | 3300025728 | Bacteria | 2366 |
| 233 | Ga0207655_1037840 | 3300025728 | Bacteria | 2118 |
| 234 | Ga0207655_1107367 | 3300025728 | Bacteria | 949 |
| 235 | Ga0207713_1000315 | 3300025735 | Bacteria | 54844 |
| 236 | Ga0207713_1001848 | 3300025735 | Bacteria | 16132 |
| 237 | Ga0207713_1006439 | 3300025735 | Bacteria | 7150 |
| 238 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 239 | Ga0207680_10032126 | 3300025903 | Bacteria | 2980 |
| 240 | Ga0207647_10003916 | 3300025904 | Bacteria | 11120 |
| 241 | Ga0207695_10010058 | 3300025913 | Bacteria | 11616 |
| 242 | Ga0207695_10088148 | 3300025913 | Bacteria | 3124 |
| 243 | Ga0207695_10142571 | 3300025913 | Bacteria | 2343 |
| 244 | Ga0207695_10223078 | 3300025913 | Bacteria | 1792 |
| 245 | Ga0207671_10000196 | 3300025914 | Bacteria | 94054 |
| 246 | Ga0207671_10001413 | 3300025914 | Bacteria | 27891 |
| 247 | Ga0207693_10072328 | 3300025915 | Bacteria | 2700 |
| 248 | Ga0207663_10330980 | 3300025916 | Bacteria | 1147 |
| 249 | Ga0207660_10677987 | 3300025917 | Bacteria | 841 |
| 250 | Ga0207657_10056277 | 3300025919 | Bacteria | 3394 |
| 251 | Ga0207657_10433498 | 3300025919 | Bacteria | 1032 |
| 252 | Ga0207649_10000042 | 3300025920 | Bacteria | 117456 |
| 253 | Ga0207649_10119572 | 3300025920 | Bacteria | 1774 |
| 254 | Ga0207652_10153258 | 3300025921 | Bacteria | 2064 |
| 255 | Ga0207681_10745968 | 3300025923 | Bacteria | 816 |
| 256 | Ga0207694_10257706 | 3300025924 | Bacteria | 1428 |
| 257 | Ga0207650_10000874 | 3300025925 | Bacteria | 22810 |
| 258 | Ga0207700_10010034 | 3300025928 | Bacteria | 5951 |
| 259 | Ga0207664_10000021 | 3300025929 | Bacteria | 216875 |
| 260 | Ga0207664_10006826 | 3300025929 | Bacteria | 7888 |
| 261 | Ga0207664_10119125 | 3300025929 | Bacteria | 2207 |
| 262 | Ga0207644_10140926 | 3300025931 | Bacteria | 1857 |
| 263 | Ga0207644_10595055 | 3300025931 | Bacteria | 918 |
| 264 | Ga0207690_10000384 | 3300025932 | Bacteria | 29204 |
| 265 | Ga0207706_10000566 | 3300025933 | Bacteria | 39267 |
| 266 | Ga0207706_10052954 | 3300025933 | Bacteria | 3583 |
| 267 | Ga0207686_10039967 | 3300025934 | Bacteria | 2849 |
| 268 | Ga0207709_10022553 | 3300025935 | Bacteria | 3572 |
| 269 | Ga0207709_11047775 | 3300025935 | Bacteria | 668 |
| 270 | Ga0207711_10011256 | 3300025941 | Bacteria | 7434 |
| 271 | Ga0207711_10019271 | 3300025941 | Bacteria | 5682 |
| 272 | Ga0207711_10080447 | 3300025941 | Bacteria | 2846 |
| 273 | Ga0207679_10000044 | 3300025945 | Bacteria | 122251 |
| 274 | Ga0207667_10000486 | 3300025949 | Bacteria | 52631 |
| 275 | Ga0207667_10274103 | 3300025949 | Bacteria | 1725 |
| 276 | Ga0207640_10000042 | 3300025981 | Bacteria | 102885 |
| 277 | Ga0207640_10014134 | 3300025981 | Bacteria | 4589 |
| 278 | Ga0207658_10021663 | 3300025986 | Bacteria | 4465 |
| 279 | Ga0207678_10270774 | 3300026067 | Bacteria | 1456 |
| 280 | Ga0207702_10000290 | 3300026078 | Bacteria | 58330 |
| 281 | Ga0207702_10456164 | 3300026078 | Bacteria | 1241 |
| 282 | Ga0207674_10063437 | 3300026116 | Bacteria | 3730 |
| 283 | Ga0209371_1000185 | 3300027312 | Bacteria | 90613 |
| 284 | Ga0209995_1011811 | 3300027471 | Bacteria | 1421 |
| 285 | Ga0209982_1000979 | 3300027552 | Bacteria | 3785 |
| 286 | Ga0209282_1000141 | 3300027666 | Bacteria | 42759 |
| 287 | Ga0209971_1010745 | 3300027682 | Bacteria | 2167 |
| 288 | Ga0209974_10001007 | 3300027876 | Bacteria | 9942 |
| 289 | Ga0268266_10237046 | 3300028379 | Bacteria | 1682 |
| 290 | Ga0307517_10119698 | 3300028786 | Bacteria | 1953 |
| 291 | Ga0265338_10001414 | 3300028800 | Bacteria | 39085 |
| 292 | Ga0268256_1000211 | 3300030500 | Bacteria | 65693 |
| 293 | Ga0307509_10133981 | 3300031507 | Bacteria | 2427 |
| 294 | Ga0307405_10002959 | 3300031731 | Bacteria | 7671 |
| 295 | Ga0307414_10190370 | 3300032004 | Bacteria | 1659 |
| 296 | Ga0395899_0024399 | 3300037312 | Bacteria | 4571 |
| 297 | Ga0395900_0456111 | 3300037418 | Bacteria | 1234 |
| 298 | Ga0395898_0000078 | 3300037466 | Bacteria | 244514 |
| 299 | Ga0395898_0034384 | 3300037466 | Bacteria | 5052 |
| 300 | Ga0395905_0486937 | 3300037471 | Bacteria | 1133 |
| 301 | Ga0395901_0036847 | 3300038443 | Bacteria | 5056 |
| 302 | Ga0237819_00428 | 3300038705 | Bacteria | 14475 |
| 303 | Ga0436365_0354829 | 3300039437 | Bacteria | 1031 |
| 304 | Ga0436361_0398230 | 3300039447 | Bacteria | 684 |
| 305 | Ga0439447_013622 | 3300041407 | Bacteria | 2302 |
| 306 | Ga0451795_1066095 | 3300041456 | Bacteria | 1525 |
| 307 | Ga0451833_0445334 | 3300041491 | Bacteria | 3292 |
| 308 | Ga0451835_0648597 | 3300041492 | Bacteria | 3321 |
| 309 | Ga0451837_0320107 | 3300041494 | Bacteria | 1789 |
| 310 | Ga0451845_0592791 | 3300041501 | Bacteria | 1627 |
| 311 | Ga0451849_0216198 | 3300041505 | Bacteria | 3619 |
| 312 | Ga0451851_0154268 | 3300041507 | Bacteria | 3339 |
| 313 | Ga0451855_0271646 | 3300041511 | Bacteria | 4034 |
| 314 | Ga0439432_001612 | 3300042006 | Bacteria | 8445 |
| 315 | Ga0439432_087301 | 3300042006 | Bacteria | 941 |
| 316 | Ga0439452_101138 | 3300042010 | Bacteria | 619 |
| 317 | Ga0439463_072582 | 3300042016 | Bacteria | 882 |
| 318 | Ga0466969_0026432 | 3300044656 | Bacteria | 2977 |
| 319 | Ga0466969_0376695 | 3300044656 | Bacteria | 643 |
| 320 | Ga0466972_0001620 | 3300044658 | Bacteria | 10989 |
| 321 | Ga0466982_0000013 | 3300044672 | Bacteria | 136227 |
| 322 | Ga0466965_0015127 | 3300044683 | Bacteria | 3662 |
| 323 | Ga0466965_0203664 | 3300044683 | Bacteria | 1050 |
| 324 | Ga0466966_0000593 | 3300044684 | Bacteria | 22990 |
| 325 | Ga0466966_0018299 | 3300044684 | Bacteria | 4621 |
| 326 | Ga0466961_0004765 | 3300044693 | Bacteria | 8538 |
| 327 | Ga0466961_0007797 | 3300044693 | Bacteria | 6812 |
| 328 | Ga0466961_0026181 | 3300044693 | Bacteria | 3751 |
| 329 | Ga0466961_0048224 | 3300044693 | Bacteria | 2722 |
| 330 | Ga0466971_0005784 | 3300044719 | Bacteria | 5379 |
| 331 | Ga0466971_0012041 | 3300044719 | Bacteria | 3789 |
| 332 | Ga0466968_0016998 | 3300044735 | Bacteria | 2901 |
| 333 | Ga0466970_0003402 | 3300044765 | Bacteria | 7745 |
| 334 | Ga0466970_0004073 | 3300044765 | Bacteria | 7180 |
| 335 | Ga0466970_0011372 | 3300044765 | Bacteria | 4536 |
| 336 | Ga0466970_0033761 | 3300044765 | Bacteria | 2705 |
| 337 | Ga0466957_0079195 | 3300044842 | Bacteria | 2044 |
| 338 | Ga0466957_0192323 | 3300044842 | Bacteria | 1337 |
| 339 | Ga0466960_0009427 | 3300044901 | Bacteria | 4024 |
| 340 | Ga0466959_0000172 | 3300045049 | Bacteria | 42574 |
| 341 | Ga0466959_0019023 | 3300045049 | Bacteria | 5048 |
| 342 | Ga0466959_0082073 | 3300045049 | Bacteria | 2323 |
| 343 | Ga0466959_0521420 | 3300045049 | Bacteria | 802 |
| 344 | Ga0466958_0003894 | 3300045836 | Bacteria | 7811 |
| 345 | Ga0466958_0006576 | 3300045836 | Bacteria | 6336 |
| 346 | Ga0466967_0163594 | 3300045976 | Bacteria | 2090 |
| 347 | Ga0495617_000111 | 3300046452 | Bacteria | 59710 |
| 348 | Ga0495617_001833 | 3300046452 | Bacteria | 9020 |
| 349 | Ga0495627_000668 | 3300046453 | Bacteria | 26397 |
| 350 | Ga0495603_0149909 | 3300046455 | Bacteria | 1355 |
| 351 | Ga0495590_0079138 | 3300046457 | Bacteria | 1157 |
| 352 | Ga0495591_000762 | 3300046458 | Bacteria | 23270 |
| 353 | Ga0495591_040804 | 3300046458 | Bacteria | 1321 |
| 354 | Ga0495629_0113571 | 3300046459 | Bacteria | 1888 |
| 355 | Ga0495638_0000233 | 3300046460 | Bacteria | 75994 |
| 356 | Ga0495638_0004139 | 3300046460 | Bacteria | 11081 |
| 357 | Ga0495638_0010997 | 3300046460 | Bacteria | 6258 |
| 358 | Ga0495638_0121587 | 3300046460 | Bacteria | 1542 |
| 359 | Ga0495650_0017391 | 3300046471 | Bacteria | 3606 |
| 360 | Ga0495650_0025254 | 3300046471 | Bacteria | 2789 |
| 361 | Ga0495650_0029335 | 3300046471 | Bacteria | 2509 |
| 362 | Ga0495650_0084469 | 3300046471 | Bacteria | 1218 |
| 363 | Ga0495580_0114346 | 3300046472 | Bacteria | 1874 |
| 364 | Ga0495605_0001310 | 3300046474 | Bacteria | 16487 |
| 365 | Ga0495605_0001363 | 3300046474 | Bacteria | 16113 |
| 366 | Ga0495605_0006109 | 3300046474 | Bacteria | 6949 |
| 367 | Ga0495605_0316500 | 3300046474 | Bacteria | 658 |
| 368 | Ga0495662_0113843 | 3300046476 | Bacteria | 1326 |
| 369 | Ga0495584_0000839 | 3300046491 | Bacteria | 19926 |
| 370 | Ga0495584_0024203 | 3300046491 | Bacteria | 3079 |
| 371 | Ga0495585_0000001 | 3300046492 | Bacteria | 609804 |
| 372 | Ga0495585_0007027 | 3300046492 | Bacteria | 6930 |
| 373 | Ga0495585_0044730 | 3300046492 | Bacteria | 2473 |
| 374 | Ga0495596_0000296 | 3300046500 | Bacteria | 33048 |
| 375 | Ga0495596_0015426 | 3300046500 | Bacteria | 3199 |
| 376 | Ga0495607_0000207 | 3300046501 | Bacteria | 62802 |
| 377 | Ga0495607_0000336 | 3300046501 | Bacteria | 48521 |
| 378 | Ga0495607_0015940 | 3300046501 | Bacteria | 4858 |
| 379 | Ga0495607_0033870 | 3300046501 | Bacteria | 3105 |
| 380 | Ga0495607_0035963 | 3300046501 | Bacteria | 2990 |
| 381 | Ga0495607_0057233 | 3300046501 | Bacteria | 2235 |
| 382 | Ga0495607_0083586 | 3300046501 | Bacteria | 1748 |
| 383 | Ga0495583_0001210 | 3300046506 | Bacteria | 27537 |
| 384 | Ga0495583_0004094 | 3300046506 | Bacteria | 10696 |
| 385 | Ga0495583_0006444 | 3300046506 | Bacteria | 7674 |
| 386 | Ga0495583_0009253 | 3300046506 | Bacteria | 5903 |
| 387 | Ga0495606_0001292 | 3300046507 | Bacteria | 34691 |
| 388 | Ga0495606_0007113 | 3300046507 | Bacteria | 10116 |
| 389 | Ga0495606_0010131 | 3300046507 | Bacteria | 7868 |
| 390 | Ga0495606_0052259 | 3300046507 | Bacteria | 2658 |
| 391 | Ga0495606_0073822 | 3300046507 | Bacteria | 2138 |
| 392 | Ga0495606_0074451 | 3300046507 | Bacteria | 2127 |
| 393 | Ga0495606_0177576 | 3300046507 | Bacteria | 1230 |
| 394 | Ga0495610_0000803 | 3300046512 | Bacteria | 29467 |
| 395 | Ga0495610_0001466 | 3300046512 | Bacteria | 20807 |
| 396 | Ga0495610_0043104 | 3300046512 | Bacteria | 2251 |
| 397 | Ga0495616_0000001 | 3300046513 | Bacteria | 780061 |
| 398 | Ga0495616_0007643 | 3300046513 | Bacteria | 6465 |
| 399 | Ga0495618_0179571 | 3300046514 | Bacteria | 1345 |
| 400 | Ga0495620_0000543 | 3300046515 | Bacteria | 23917 |
| 401 | Ga0495620_0004657 | 3300046515 | Bacteria | 7707 |
| 402 | Ga0495620_0009435 | 3300046515 | Bacteria | 5191 |
| 403 | Ga0495630_0287432 | 3300046517 | Bacteria | 1256 |
| 404 | Ga0495631_0000162 | 3300046518 | Bacteria | 45464 |
| 405 | Ga0495631_0000617 | 3300046518 | Bacteria | 23416 |
| 406 | Ga0495631_0072449 | 3300046518 | Bacteria | 1488 |
| 407 | Ga0495631_0161795 | 3300046518 | Bacteria | 960 |
| 408 | Ga0495632_0002482 | 3300046519 | Bacteria | 14007 |
| 409 | Ga0495632_0007207 | 3300046519 | Bacteria | 7021 |
| 410 | Ga0495632_0010644 | 3300046519 | Bacteria | 5427 |
| 411 | Ga0495643_0031085 | 3300046522 | Bacteria | 2975 |
| 412 | Ga0495643_0148217 | 3300046522 | Bacteria | 1164 |
| 413 | Ga0495644_0342330 | 3300046523 | Bacteria | 588 |
| 414 | Ga0495648_0000083 | 3300046524 | Bacteria | 121164 |
| 415 | Ga0495648_0004279 | 3300046524 | Bacteria | 12239 |
| 416 | Ga0495648_0026745 | 3300046524 | Bacteria | 3878 |
| 417 | Ga0495648_0098802 | 3300046524 | Bacteria | 1616 |
| 418 | Ga0495648_0191969 | 3300046524 | Bacteria | 1029 |
| 419 | Ga0495666_0018424 | 3300046526 | Bacteria | 3474 |
| 420 | Ga0495642_0018770 | 3300046528 | Bacteria | 2708 |
| 421 | Ga0495642_0027277 | 3300046528 | Bacteria | 2272 |
| 422 | Ga0495654_0000762 | 3300046530 | Bacteria | 24922 |
| 423 | Ga0495654_0115390 | 3300046530 | Bacteria | 1221 |
| 424 | Ga0495665_0060673 | 3300046531 | Bacteria | 1996 |
| 425 | Ga0495587_0305934 | 3300046536 | Bacteria | 889 |
| 426 | Ga0495609_0000905 | 3300046538 | Bacteria | 21595 |
| 427 | Ga0495609_0002763 | 3300046538 | Bacteria | 10560 |
| 428 | Ga0495609_0170168 | 3300046538 | Bacteria | 920 |
| 429 | Ga0495597_0031345 | 3300046542 | Bacteria | 2420 |
| 430 | Ga0495597_0040811 | 3300046542 | Bacteria | 2074 |
| 431 | Ga0495597_0194564 | 3300046542 | Bacteria | 814 |
| 432 | Ga0495622_0109712 | 3300046557 | Bacteria | 1263 |
| 433 | Ga0495656_0138212 | 3300046615 | Bacteria | 1166 |
| 434 | Ga0495668_0013200 | 3300046616 | Bacteria | 4882 |
| 435 | Ga0495611_0000001 | 3300046648 | Bacteria | 2628469 |
| 436 | Ga0495611_0014748 | 3300046648 | Bacteria | 3341 |
| 437 | Ga0495625_0000001 | 3300046660 | Bacteria | 1641829 |
| 438 | Ga0495661_0000290 | 3300046665 | Bacteria | 56929 |
| 439 | Ga0495661_0001053 | 3300046665 | Bacteria | 24433 |
| 440 | Ga0495661_0002265 | 3300046665 | Bacteria | 14884 |
| 441 | Ga0495661_0008271 | 3300046665 | Bacteria | 7207 |
| 442 | Ga0495661_0040496 | 3300046665 | Bacteria | 2888 |
| 443 | Ga0495661_0388021 | 3300046665 | Bacteria | 681 |
| 444 | Ga0495669_0006796 | 3300046684 | Bacteria | 4788 |
| 445 | Ga0495669_0042422 | 3300046684 | Bacteria | 2023 |
| 446 | Ga0495670_0002621 | 3300046691 | Bacteria | 8881 |
| 447 | Ga0495670_0019906 | 3300046691 | Bacteria | 3307 |
| 448 | Ga0495670_0038206 | 3300046691 | Bacteria | 2393 |
| 449 | Ga0495671_0000723 | 3300046692 | Bacteria | 23834 |
| 450 | Ga0495671_0001777 | 3300046692 | Bacteria | 13946 |
| 451 | Ga0495671_0006719 | 3300046692 | Bacteria | 6625 |
| 452 | Ga0495671_0025501 | 3300046692 | Bacteria | 3072 |
| 453 | Ga0495671_0049635 | 3300046692 | Bacteria | 2091 |
| 454 | Ga0495671_0239734 | 3300046692 | Bacteria | 876 |
| 455 | Ga0495671_0324048 | 3300046692 | Bacteria | 740 |
| 456 | Ga0495649_0007424 | 3300046694 | Bacteria | 6682 |
| 457 | Ga0495649_0054692 | 3300046694 | Bacteria | 2157 |
| 458 | Ga0495649_0101989 | 3300046694 | Bacteria | 1524 |
| 459 | Ga0495589_0000314 | 3300046794 | Bacteria | 38602 |
| 460 | Ga0495589_0001164 | 3300046794 | Bacteria | 15661 |
| 461 | Ga0495589_0001578 | 3300046794 | Bacteria | 13095 |
| 462 | Ga0495589_0009411 | 3300046794 | Bacteria | 5082 |
| 463 | Ga0495660_0000008 | 3300046810 | Bacteria | 435769 |
| 464 | Ga0495660_0000180 | 3300046810 | Bacteria | 68501 |
| 465 | Ga0495660_0032348 | 3300046810 | Bacteria | 2937 |
| 466 | Ga0495660_0035700 | 3300046810 | Bacteria | 2776 |
| 467 | Ga0495674_1116356 | 3300047319 | Bacteria | 599 |
| 468 | Ga0495672_0017827 | 3300047320 | Bacteria | 4737 |
| 469 | Ga0495672_0028694 | 3300047320 | Bacteria | 3515 |
| 470 | Ga0495683_0002728 | 3300047323 | Bacteria | 10527 |
| 471 | Ga0495683_0006757 | 3300047323 | Bacteria | 6241 |
| 472 | Ga0495683_0081831 | 3300047323 | Bacteria | 1574 |
| 473 | Ga0495683_0231759 | 3300047323 | Bacteria | 818 |
| 474 | Ga0495679_000001 | 3300047446 | Bacteria | 1607568 |
| 475 | Ga0495679_000115 | 3300047446 | Bacteria | 71277 |
| 476 | Ga0495679_000353 | 3300047446 | Bacteria | 35879 |
| 477 | Ga0495679_001477 | 3300047446 | Bacteria | 13301 |
| 478 | Ga0495685_019269 | 3300047447 | Bacteria | 2344 |
| 479 | Ga0495685_105681 | 3300047447 | Bacteria | 928 |
| 480 | Ga0495673_0000001 | 3300047469 | Bacteria | 1630730 |
| 481 | Ga0495673_0000030 | 3300047469 | Bacteria | 468915 |
| 482 | Ga0495673_0000232 | 3300047469 | Bacteria | 81119 |
| 483 | Ga0495673_0060860 | 3300047469 | Bacteria | 1618 |
| 484 | Ga0495681_0005004 | 3300047470 | Bacteria | 8934 |
| 485 | Ga0495681_0038721 | 3300047470 | Bacteria | 2334 |
| 486 | Ga0495681_0147045 | 3300047470 | Bacteria | 991 |
| 487 | Ga0495686_0000019 | 3300047472 | Bacteria | 434054 |
| 488 | Ga0495686_0000077 | 3300047472 | Bacteria | 205924 |
| 489 | Ga0495686_0022484 | 3300047472 | Bacteria | 4173 |
| 490 | Ga0495686_0022650 | 3300047472 | Bacteria | 4154 |
| 491 | Ga0495686_0041028 | 3300047472 | Bacteria | 2948 |
| 492 | Ga0495686_0076792 | 3300047472 | Bacteria | 2046 |
| 493 | Ga0495602_0192922 | 3300048088 | Bacteria | 1560 |
| 494 | Ga0495626_0012020 | 3300048091 | Bacteria | 4556 |
| 495 | Ga0495626_0019776 | 3300048091 | Bacteria | 3363 |
| 496 | Ga0496102_0029176 | 3300048905 | Bacteria | 4934 |
| 497 | Ga0496103_0031599 | 3300048906 | Bacteria | 3227 |
| 498 | Ga0496105_0012131 | 3300048908 | Bacteria | 6823 |
| 499 | Ga0496106_0000034 | 3300048909 | Bacteria | 130368 |
| 500 | Ga0496106_0001636 | 3300048909 | Bacteria | 16807 |
| 501 | Ga0496106_0015200 | 3300048909 | Bacteria | 5697 |
| 502 | Ga0496112_0441348 | 3300048915 | Bacteria | 1240 |
| 503 | Ga0496115_0056353 | 3300048918 | Bacteria | 3159 |
| 504 | Ga0496116_0024416 | 3300048919 | Bacteria | 4472 |
| 505 | Ga0496116_0033295 | 3300048919 | Bacteria | 3659 |
| 506 | Ga0496116_0038617 | 3300048919 | Bacteria | 3312 |
| 507 | Ga0496117_0000876 | 3300048920 | Bacteria | 46421 |
| 508 | Ga0496117_0040887 | 3300048920 | Bacteria | 3404 |
| 509 | Ga0496117_0070320 | 3300048920 | Bacteria | 2352 |
| 510 | Ga0496117_0082586 | 3300048920 | Bacteria | 2104 |
| 511 | Ga0496117_0093467 | 3300048920 | Bacteria | 1928 |
| 512 | Ga0496117_0166931 | 3300048920 | Bacteria | 1282 |
| 513 | Ga0496118_0007642 | 3300048921 | Bacteria | 11383 |
| 514 | Ga0496118_0018109 | 3300048921 | Bacteria | 6372 |
| 515 | Ga0496118_0024104 | 3300048921 | Bacteria | 5262 |
| 516 | Ga0496118_0028642 | 3300048921 | Bacteria | 4686 |
| 517 | Ga0496118_0040829 | 3300048921 | Bacteria | 3683 |
| 518 | Ga0496118_0045206 | 3300048921 | Bacteria | 3440 |
| 519 | Ga0496118_0244343 | 3300048921 | Bacteria | 1025 |
| 520 | Ga0496119_0062587 | 3300048922 | Bacteria | 2216 |
| 521 | Ga0496119_0122302 | 3300048922 | Bacteria | 1429 |
| 522 | Ga0496120_0003942 | 3300048923 | Bacteria | 12927 |
| 523 | Ga0496120_0029932 | 3300048923 | Bacteria | 3318 |
| 524 | Ga0496120_0034799 | 3300048923 | Bacteria | 3014 |
| 525 | Ga0496120_0059413 | 3300048923 | Bacteria | 2143 |
| 526 | Ga0496121_0000278 | 3300048924 | Bacteria | 106838 |
| 527 | Ga0496121_0000431 | 3300048924 | Bacteria | 82456 |
| 528 | Ga0496121_0001587 | 3300048924 | Bacteria | 37821 |
| 529 | Ga0496121_0008874 | 3300048924 | Bacteria | 11691 |
| 530 | Ga0496121_0017270 | 3300048924 | Bacteria | 7383 |
| 531 | Ga0496121_0034837 | 3300048924 | Bacteria | 4522 |
| 532 | Ga0496121_0052326 | 3300048924 | Bacteria | 3431 |
| 533 | Ga0496121_0082577 | 3300048924 | Bacteria | 2539 |
| 534 | Ga0496121_0208549 | 3300048924 | Bacteria | 1386 |
| 535 | Ga0496121_0265551 | 3300048924 | Bacteria | 1182 |
| 536 | Ga0496121_0293537 | 3300048924 | Bacteria | 1106 |
| 537 | Ga0496122_0016926 | 3300048925 | Bacteria | 6851 |
| 538 | Ga0496122_0057665 | 3300048925 | Bacteria | 2882 |
| 539 | Ga0496122_0061624 | 3300048925 | Bacteria | 2752 |
| 540 | Ga0496122_0259322 | 3300048925 | Bacteria | 966 |
| 541 | Ga0496122_0287164 | 3300048925 | Bacteria | 895 |
| 542 | Ga0496122_0289509 | 3300048925 | Bacteria | 890 |
| 543 | Ga0496123_0003223 | 3300048926 | Bacteria | 18571 |
| 544 | Ga0496123_0011469 | 3300048926 | Bacteria | 7678 |
| 545 | Ga0496123_0052857 | 3300048926 | Bacteria | 2690 |
| 546 | Ga0496123_0074724 | 3300048926 | Bacteria | 2096 |
| 547 | Ga0496123_0177402 | 3300048926 | Bacteria | 1117 |
| 548 | Ga0496123_0273617 | 3300048926 | Bacteria | 820 |
| 549 | Ga0496124_0000948 | 3300048927 | Bacteria | 46382 |
| 550 | Ga0496124_0018685 | 3300048927 | Bacteria | 6485 |
| 551 | Ga0496124_0042475 | 3300048927 | Bacteria | 3915 |
| 552 | Ga0496124_0050938 | 3300048927 | Bacteria | 3525 |
| 553 | Ga0496124_0061560 | 3300048927 | Bacteria | 3145 |
| 554 | Ga0496124_0293175 | 3300048927 | Bacteria | 1179 |
| 555 | Ga0496124_0296988 | 3300048927 | Bacteria | 1169 |
| 556 | Ga0496124_0425366 | 3300048927 | Bacteria | 913 |
| 557 | Ga0496125_0000915 | 3300048928 | Bacteria | 46451 |
| 558 | Ga0496125_0004839 | 3300048928 | Bacteria | 15295 |
| 559 | Ga0496125_0020402 | 3300048928 | Bacteria | 6219 |
| 560 | Ga0496125_0059444 | 3300048928 | Bacteria | 3080 |
| 561 | Ga0496125_0060612 | 3300048928 | Bacteria | 3040 |
| 562 | Ga0496125_0099352 | 3300048928 | Bacteria | 2150 |
| 563 | Ga0496125_0107708 | 3300048928 | Bacteria | 2029 |
| 564 | Ga0496126_0000389 | 3300048929 | Bacteria | 90452 |
| 565 | Ga0496126_0036072 | 3300048929 | Bacteria | 4628 |
| 566 | Ga0496126_0042656 | 3300048929 | Bacteria | 4188 |
| 567 | Ga0496126_0123351 | 3300048929 | Bacteria | 2244 |
| 568 | Ga0496126_0137070 | 3300048929 | Bacteria | 2110 |
| 569 | Ga0496126_0211273 | 3300048929 | Bacteria | 1634 |
| 570 | Ga0496126_0251378 | 3300048929 | Bacteria | 1473 |
| 571 | Ga0496126_0577063 | 3300048929 | Bacteria | 889 |
| 572 | Ga0495678_000023 | 3300049459 | Bacteria | 233463 |
| 573 | Ga0495678_005024 | 3300049459 | Bacteria | 7448 |
| 574 | Ga0495682_0000048 | 3300049460 | Bacteria | 111881 |
| 575 | Ga0495682_0009290 | 3300049460 | Bacteria | 3841 |
| 576 | Ga0495682_0040669 | 3300049460 | Bacteria | 1704 |
| 577 | Ga0501031_0111305 | 3300049568 | Bacteria | 1788 |
| 578 | Ga0501031_0263145 | 3300049568 | Bacteria | 1120 |
| 579 | Ga0501032_0035390 | 3300049569 | Bacteria | 3414 |
| 580 | Ga0501033_0004794 | 3300049570 | Bacteria | 10800 |
| 581 | Ga0501033_0142874 | 3300049570 | Bacteria | 1730 |
| 582 | Ga0501033_0282525 | 3300049570 | Bacteria | 1171 |
| 583 | Ga0501034_0049617 | 3300049571 | Bacteria | 4234 |
| 584 | Ga0501036_0008151 | 3300049572 | Bacteria | 8585 |
| 585 | Ga0501036_0837465 | 3300049572 | Bacteria | 756 |
| 586 | Ga0501037_0032822 | 3300049573 | Bacteria | 3835 |
| 587 | Ga0501037_0073082 | 3300049573 | Bacteria | 2493 |
| 588 | Ga0501038_0073981 | 3300049574 | Bacteria | 2883 |
| 589 | Ga0501038_0171767 | 3300049574 | Bacteria | 1754 |
| 590 | Ga0501040_0324588 | 3300049576 | Bacteria | 1101 |
| 591 | Ga0501042_0206234 | 3300049578 | Bacteria | 1417 |
| 592 | Ga0501043_0012070 | 3300049579 | Bacteria | 6756 |
| 593 | Ga0501043_0352869 | 3300049579 | Bacteria | 1117 |
| 594 | Ga0501043_0383111 | 3300049579 | Bacteria | 1064 |
| 595 | Ga0501046_0026164 | 3300049580 | Bacteria | 4766 |
| 596 | Ga0501047_0034665 | 3300049581 | Bacteria | 4873 |
| 597 | Ga0501047_0067086 | 3300049581 | Bacteria | 3458 |
| 598 | Ga0501047_0147685 | 3300049581 | Bacteria | 2227 |
| 599 | Ga0501048_0075671 | 3300049582 | Bacteria | 2375 |
| 600 | Ga0501070_0040316 | 3300049586 | Bacteria | 3894 |
| 601 | Ga0501070_0136002 | 3300049586 | Bacteria | 2029 |
| 602 | Ga0501080_0100403 | 3300049742 | Bacteria | 2685 |
| 603 | Ga0501035_0006541 | 3300049822 | Bacteria | 10933 |
| 604 | Ga0501035_0040819 | 3300049822 | Bacteria | 4192 |
| 605 | Ga0501035_0123479 | 3300049822 | Bacteria | 2261 |
| 606 | Ga0501035_0245948 | 3300049822 | Bacteria | 1520 |
| 607 | Ga0501044_0026488 | 3300049823 | Bacteria | 6136 |
| 608 | Ga0501044_0089010 | 3300049823 | Bacteria | 3116 |
| 609 | Ga0501044_0128377 | 3300049823 | Bacteria | 2531 |
| 610 | Ga0501044_0261434 | 3300049823 | Bacteria | 1669 |
| 611 | Ga0501044_0314965 | 3300049823 | Bacteria | 1490 |
| 612 | Ga0501044_0388977 | 3300049823 | Bacteria | 1309 |
| 613 | Ga0500643_000002 | 3300053087 | Bacteria | 1277657 |
| 614 | Ga0500651_0139885 | 3300053093 | Bacteria | 1460 |
| 615 | Ga0500555_000716 | 3300053103 | Bacteria | 12470 |
| 616 | Ga0500595_008673 | 3300053119 | Bacteria | 4145 |
| 617 | Ga0500658_0072422 | 3300053134 | Bacteria | 1457 |
| 618 | Ga0500568_0010576 | 3300053139 | Bacteria | 4310 |
| 619 | Ga0500568_0110468 | 3300053139 | Bacteria | 1028 |
| 620 | Ga0500622_0001338 | 3300053156 | Bacteria | 19968 |
| 621 | Ga0500633_0000151 | 3300053160 | Bacteria | 9308 |
| 622 | Ga0500634_0002831 | 3300053161 | Bacteria | 7485 |
| 623 | Ga0500645_000704 | 3300053730 | Bacteria | 20751 |
| 624 | Ga0587088_038126 | 3300059508 | Bacteria | 893 |
| 625 | Ga0466962_0008594 | 3300061719 | Bacteria | 4895 |
| 626 | Ga0466962_0008862 | 3300061719 | Bacteria | 4821 |
| 627 | 2511196366 | 2510917030 | Bacteria | 7460662 |
| 628 | 2513597942 | 2513237088 | Bacteria | 6927906 |
| 629 | 2519457225 | 2519103095 | Bacteria | 6629912 |
| 630 | 2563062580 | 2562617112 | Bacteria | 10918404 |
| 631 | 2585226312 | 2582581298 | Bacteria | 7315509 |
| 632 | 2585292231 | 2582581311 | Bacteria | 6763856 |
| 633 | 2585548768 | 2585427529 | Bacteria | 7395659 |
| 634 | 2597864618 | 2597489888 | Bacteria | 6179543 |
| 635 | 2597870424 | 2597489889 | Bacteria | 6297495 |
| 636 | 2599397792 | 2599185167 | Bacteria | 6353609 |
| 637 | 2599452238 | 2599185179 | Bacteria | 6611171 |
| 638 | 2599506821 | 2599185189 | Bacteria | 5862825 |
| 639 | 2599513383 | 2599185190 | Bacteria | 6285678 |
| 640 | 2599518118 | 2599185191 | Bacteria | 6297582 |
| 641 | 2599738838 | 2599185239 | Bacteria | 8686614 |
| 642 | 2599747547 | 2599185240 | Bacteria | 7968121 |
| 643 | 2599880941 | 2599185288 | Bacteria | 6666191 |
| 644 | 2599892060 | 2599185290 | Bacteria | 6289611 |
| 645 | 2599949926 | 2599185303 | Bacteria | 6512725 |
| 646 | 2600209431 | 2599185355 | Bacteria | 7968906 |
| 647 | 2600811847 | 2600255067 | Bacteria | 6795583 |
| 648 | 2601690089 | 2600255296 | Bacteria | 5784754 |
| 649 | 2621298870 | 2619619299 | Bacteria | 6649820 |
| 650 | 2643871323 | 2643221571 | Bacteria | 6228673 |
| 651 | 2643894630 | 2643221577 | Bacteria | 3710843 |
| 652 | 2643974623 | 2643221593 | Bacteria | 6296053 |
| 653 | 2644476782 | 2643221685 | Bacteria | 3673288 |
| 654 | 2644622752 | 2643221713 | Bacteria | 6554480 |
| 655 | 2676745490 | 2675903129 | Bacteria | 7964495 |
| 656 | 2677900663 | 2675903420 | Bacteria | 6247433 |
| 657 | 2687582168 | 2687453130 | Bacteria | 4227172 |
| 658 | 2713476816 | 2711768613 | Bacteria | 11048459 |
| 659 | 2721027675 | 2718218334 | Bacteria | 4765486 |
| 660 | 2723249400 | 2721755607 | Bacteria | 5841722 |
| 661 | 2735836765 | 2734482264 | Unclassified | 5014763 |
| 662 | 2738672117 | 2738541265 | Bacteria | 6594665 |
| 663 | 2738750510 | 2738541282 | Bacteria | 6593925 |
| 664 | 2738806010 | 2738541294 | Bacteria | 6925949 |
| 665 | 2738859551 | 2738541303 | Bacteria | 6591772 |
| 666 | 2738893370 | 2738541309 | Bacteria | 6926455 |
| 667 | 2739228682 | 2738543009 | Bacteria | 4944499 |
| 668 | 2748018389 | 2747842501 | Bacteria | 5293829 |
| 669 | 2792839895 | 2791355137 | Bacteria | 9654227 |
| 670 | 2808971272 | 2808606384 | Bacteria | 8474373 |
| 671 | 2808979048 | 2808606385 | Bacteria | 6711065 |
| 672 | 2808994637 | 2808606388 | Bacteria | 6706662 |
| 673 | 2809006344 | 2808606390 | Bacteria | 8476311 |
| 674 | 2809013239 | 2808606391 | Bacteria | 8308166 |
| 675 | 2817259429 | 2816332253 | Bacteria | 6764532 |
| 676 | 2817277097 | 2816332256 | Bacteria | 6891714 |
| 677 | 2817454012 | 2816332286 | Bacteria | 6853759 |
| 678 | 2817491969 | 2816332298 | Bacteria | 6852809 |
| 679 | 2819562955 | 2818991440 | Bacteria | 4774720 |
| 680 | 2819634794 | 2818991452 | Bacteria | 8442785 |
| 681 | 2834032782 | 2834028612 | Bacteria | 6354979 |
| 682 | 2842805997 | 2842805378 | Bacteria | 5385175 |
| 683 | 2842828248 | 2842826826 | Bacteria | 5974129 |
| 684 | 2842841154 | 2842837860 | Bacteria | 6066181 |
| 685 | 2852613733 | 2852612431 | Bacteria | 6885235 |
| 686 | 2852668531 | 2852667396 | Bacteria | 6885555 |
| 687 | 2855734563 | 2855730933 | Bacteria | 7047938 |
| 688 | 2855770153 | 2855767633 | Bacteria | 7049357 |
| 689 | 2860871129 | 2860867994 | Bacteria | 5645326 |
| 690 | 2863425472 | 2863421361 | Bacteria | 7300805 |
| 691 | 2870069724 | 2870068957 | Bacteria | 8925310 |
| 692 | 2881414366 | 2881412998 | Bacteria | 6492157 |
| 693 | 2884340362 | 2884338543 | Bacteria | 4610696 |
| 694 | 2895396664 | 2895395659 | Bacteria | 3983269 |
| 695 | 2900641146 | 2900634093 | Bacteria | 10263517 |
| 696 | 2904463567 | 2904463128 | Bacteria | 4775606 |
| 697 | 2904570230 | 2904564687 | Bacteria | 7609577 |
| 698 | 2904577238 | 2904571731 | Bacteria | 7608790 |
| 699 | 2908450464 | 2908446538 | Bacteria | 6829095 |
| 700 | 2919104760 | 2919100787 | Bacteria | 7710546 |
| 701 | 2928108594 | 2928108538 | Bacteria | 7360024 |
| 702 | 2928135818 | 2928135762 | Bacteria | 7259641 |
| 703 | 2928163653 | 2928157003 | Bacteria | 7522202 |
| 704 | 2928170598 | 2928163908 | Bacteria | 7561269 |
| 705 | 2928175932 | 2928170801 | Bacteria | 8785406 |
| 706 | 2928541571 | 2928536128 | Bacteria | 7657547 |
| 707 | 2928964195 | 2928963466 | Bacteria | 5165703 |
| 708 | 2929193189 | 2929189879 | Bacteria | 5930554 |
| 709 | 2931393256 | 2931390751 | Bacteria | 6273349 |
| 710 | 2939614547 | 2939611941 | Bacteria | 3892017 |
| 711 | 2941473434 | 2941471342 | Bacteria | 5018624 |
| 712 | 2945932796 | 2945928738 | Bacteria | 6053221 |
| 713 | 2945964756 | 2945961074 | Bacteria | 7342064 |
| 714 | 2946009058 | 2946006987 | Bacteria | 6705746 |
| 715 | 2946031469 | 2946027586 | Bacteria | 6049274 |
| 716 | 2947238433 | 2947233263 | Bacteria | 6439278 |
| 717 | 2981995683 | 2981990288 | Bacteria | 7590678 |
| 718 | 3005452061 | 3005445848 | Bacteria | 6906074 |
| 719 | 642415063 | 641736154 | Bacteria | 7689995 |
| 720 | 642616070 | 642555113 | Bacteria | 8214658 |
| 721 | 643391069 | 643348555 | Bacteria | 3914947 |
| 722 | 8011352303 | 8011350971 | Bacteria | 6158957 |
| 723 | 8018851866 | 8018845410 | Bacteria | 8933938 |
| 724 | 8020813387 | 8020807995 | Bacteria | 6801506 |
| 725 | 8020939262 | 8020938398 | Bacteria | 7472757 |
| 726 | 8020958254 | 8020953355 | Bacteria | 7439080 |
| 727 | 8021128340 | 8021120328 | Bacteria | 8782274 |
| 728 | 8024487022 | 8024486573 | Bacteria | 6540512 |
| 729 | 8040169524 | 8040167225 | Bacteria | 6542727 |
| 730 | 8040174558 | 8040173305 | Bacteria | 6827067 |
| 731 | 8054287736 | 8054285046 | Bacteria | 6919322 |
| 732 | 8054348969 | 8054347763 | Bacteria | 5901107 |
| 733 | 8054506975 | 8054503363 | Bacteria | 6101651 |
| 734 | 8055821936 | 8055817908 | Bacteria | 6609162 |
| 735 | 8056154395 | 8056148874 | Bacteria | 6479865 |
| 736 | 8056165364 | 8056161164 | Bacteria | 6106669 |
| 737 | Ga0157370_10018169 | |||
| 738 | JGI25156J39149_1004808 | |||
| 739 | JGI25162J39368_1000709 | |||
| 740 | JGI25162J39368_1000822 | |||
| 741 | JGI25162J39368_1002764 | |||
| 742 | JGI25158J39367_1000059 | |||
| 743 | JGI25157J39369_1001626 | |||
| 744 | JGI25157J39369_1002929 | |||
| 745 | JGI25157J39369_1003012 | |||
| 746 | JGI25164J39214_1000149 | |||
| 747 | JGI25164J39214_1000553 | |||
| 748 | JGI25152J39213_1001248 | |||
| 749 | JGI25152J39213_1004153 | |||
| 750 | JGI25159J45721_1000504 | |||
| 751 | JGI25165J46597_1000643 | |||
| 752 | JGI25165J46597_1002587 | |||
| 753 | JGI25153J46596_10014206 | |||
| 754 | rootH2_10036142 | |||
| 755 | rootL2_10209767 | |||
| 756 | rootH1_10104958 | |||
| 757 | rootH1_10168750 | |||
| 758 | JGI25160J50197_1013524 | |||
| 759 | JGI25161J50226_1000123 | |||
| 760 | Ga0055538_1000072 | |||
| 761 | Ga0055539_1000107 | |||
| 762 | Ga0055533_1000116 | |||
| 763 | Ga0055532_1000103 | |||
| 764 | Ga0055532_1003352 | |||
| 765 | Ga0055525_1000160 | |||
| 766 | Ga0055525_1000242 | |||
| 767 | Ga0055527_1000248 | |||
| 768 | Ga0055527_1000743 | |||
| 769 | Ga0055527_1001164 | |||
| 770 | Ga0055527_1021903 | |||
| 771 | Ga0055535_1000398 | |||
| 772 | Ga0055535_1000680 | |||
| 773 | Ga0055535_1001824 | |||
| 774 | Ga0055535_1002504 | |||
| 775 | Ga0055535_1003305 | |||
| 776 | Ga0055542_1000264 | |||
| 777 | Ga0055542_1000552 | |||
| 778 | Ga0055542_1001663 | |||
| 779 | Ga0055542_1002426 | |||
| 780 | Ga0055542_1011628 | |||
| 781 | Ga0055529_1000448 | |||
| 782 | Ga0055529_1000912 | |||
| 783 | Ga0055529_1002010 | |||
| 784 | Ga0055529_1003524 | |||
| 785 | Ga0055529_1004565 | |||
| 786 | Ga0055526_1007035 | |||
| 787 | Ga0055526_1015265 | |||
| 788 | Ga0055524_1023420 | |||
| 789 | Ga0055528_1001408 | |||
| 790 | Ga0055528_1006055 | |||
| 791 | Ga0055540_1009899 | |||
| 792 | Ga0055541_1000073 | |||
| 793 | Ga0058692_1042727 | |||
| 794 | Ga0055543_1000116 | |||
| 795 | Ga0065714_10064735 | |||
| 796 | Ga0065712_10090700 | |||
| 797 | Ga0070670_100003042 | |||
| 798 | Ga0070680_101232918 | |||
| 799 | Ga0070661_100000036 | |||
| 800 | Ga0070661_100484145 | |||
| 801 | Ga0070692_10190799 | |||
| 802 | Ga0070669_100000957 | |||
| 803 | Ga0070675_100289915 | |||
| 804 | Ga0070671_100495032 | |||
| 805 | Ga0070673_100693858 | |||
| 806 | Ga0070659_100032863 | |||
| 807 | Ga0070667_100032538 | |||
| 808 | Ga0070714_100000034 | |||
| 809 | Ga0070714_100001388 | |||
| 810 | Ga0070714_100444550 | |||
| 811 | Ga0070713_100072468 | |||
| 812 | Ga0070678_100055749 | |||
| 813 | Ga0070662_100002793 | |||
| 814 | Ga0070662_100063289 | |||
| 815 | Ga0070681_10010947 | |||
| 816 | Ga0068853_100047582 | |||
| 817 | Ga0070696_100096309 | |||
| 818 | Ga0070693_100329374 | |||
| 819 | Ga0070665_100324744 | |||
| 820 | Ga0068855_100001262 | |||
| 821 | Ga0068855_100971569 | |||
| 822 | Ga0068855_101289442 | |||
| 823 | Ga0070664_100000486 | |||
| 824 | Ga0068854_100000826 | |||
| 825 | Ga0068854_100108357 | |||
| 826 | Ga0068854_100245888 | |||
| 827 | Ga0068856_100001540 | |||
| 828 | Ga0068856_101800351 | |||
| 829 | Ga0068851_10000103 | |||
| 830 | Ga0075362_10024489 | |||
| 831 | Ga0099826_10000027 | |||
| 832 | Ga0105251_10001158 | |||
| 833 | Ga0105251_10003812 | |||
| 834 | Ga0105251_10034598 | |||
| 835 | Ga0105251_10079460 | |||
| 836 | Ga0105244_10012702 | |||
| 837 | Ga0105244_10018596 | |||
| 838 | Ga0105244_10036357 | |||
| 839 | Ga0105244_10093304 | |||
| 840 | Ga0105250_10000128 | |||
| 841 | Ga0105250_10113269 | |||
| 842 | Ga0105240_10012639 | |||
| 843 | Ga0105240_10118123 | |||
| 844 | Ga0105243_10123874 | |||
| 845 | Ga0105243_10738890 | |||
| 846 | Ga0105241_10938122 | |||
| 847 | Ga0105242_10000520 | |||
| 848 | Ga0105248_10034883 | |||
| 849 | Ga0105248_10107818 | |||
| 850 | Ga0105237_10000163 | |||
| 851 | Ga0105237_10001127 | |||
| 852 | Ga0105237_10191665 | |||
| 853 | Ga0105238_10975370 | |||
| 854 | Ga0105249_10835182 | |||
| 855 | Ga0105147_105401 | |||
| 856 | Ga0105246_10022660 | |||
| 857 | Ga0157340_1000944 | |||
| 858 | Ga0157373_10005057 | |||
| 859 | Ga0157373_10006322 | |||
| 860 | Ga0157370_10045890 | |||
| 861 | Ga0157370_10072831 | |||
| 862 | Ga0157370_10149538 | |||
| 863 | Ga0157369_10009908 | |||
| 864 | Ga0157369_10019997 | |||
| 865 | Ga0157369_10030321 | |||
| 866 | Ga0157369_10100543 | |||
| 867 | Ga0163162_10001674 | |||
| 868 | Ga0163162_10005933 | |||
| 869 | Ga0163162_10268377 | |||
| 870 | Ga0157372_11717898 | |||
| 871 | Ga0157375_10001075 | |||
| 872 | Ga0157375_10011307 | |||
| 873 | Ga0157375_10021437 | |||
| 874 | Ga0157375_10050147 | |||
| 875 | Ga0163163_10996973 | |||
| 876 | Ga0182008_10002178 | |||
| 877 | Ga0182008_10003123 | |||
| 878 | Ga0182008_10036927 | |||
| 879 | Ga0182008_10078526 | |||
| 880 | Ga0182008_10082212 | |||
| 881 | Ga0182006_1000162 | |||
| 882 | Ga0182006_1002213 | |||
| 883 | Ga0182006_1125785 | |||
| 884 | Ga0182007_10012520 | |||
| 885 | Ga0182007_10020320 | |||
| 886 | Ga0182007_10102127 | |||
| 887 | Ga0183369_1003 | |||
| 888 | Ga0163161_10004002 | |||
| 889 | Ga0163161_10073634 | |||
| 890 | Ga0163161_10083107 | |||
| 891 | Ga0163161_10125285 | |||
| 892 | Ga0163161_10152942 | |||
| 893 | Ga0163161_10196117 | |||
| 894 | Ga0206356_11398797 | |||
| 895 | Ga0213876_10032386 | |||
| 896 | Ga0209435_101295 | |||
| 897 | Ga0209436_100066 | |||
| 898 | Ga0209784_100110 | |||
| 899 | Ga0209566_100131 | |||
| 900 | Ga0209674_100154 | |||
| 901 | Ga0209672_100007 | |||
| 902 | Ga0209672_100115 | |||
| 903 | Ga0209672_100552 | |||
| 904 | Ga0209672_100652 | |||
| 905 | Ga0209147_100158 | |||
| 906 | Ga0209147_100164 | |||
| 907 | Ga0209147_100412 | |||
| 908 | Ga0209563_100071 | |||
| 909 | Ga0209563_100133 | |||
| 910 | Ga0207427_100021 | |||
| 911 | Ga0207427_100123 | |||
| 912 | Ga0209437_100087 | |||
| 913 | Ga0209437_100106 | |||
| 914 | Ga0209437_100227 | |||
| 915 | Ga0209437_113517 | |||
| 916 | Ga0209258_100017 | |||
| 917 | Ga0209258_100260 | |||
| 918 | Ga0209258_100261 | |||
| 919 | Ga0209258_100271 | |||
| 920 | Ga0209258_100379 | |||
| 921 | Ga0209258_103817 | |||
| 922 | Ga0209646_1000454 | |||
| 923 | Ga0209646_1024566 | |||
| 924 | Ga0209026_1000158 | |||
| 925 | Ga0209026_1002678 | |||
| 926 | Ga0209026_1009325 | |||
| 927 | Ga0209677_100100 | |||
| 928 | Ga0209148_1000002 | |||
| 929 | Ga0209148_1000044 | |||
| 930 | Ga0209148_1000045 | |||
| 931 | Ga0209148_1000104 | |||
| 932 | Ga0209148_1008815 | |||
| 933 | Ga0209759_1000150 | |||
| 934 | Ga0209759_1001197 | |||
| 935 | Ga0209759_1003231 | |||
| 936 | Ga0209759_1013122 | |||
| 937 | Ga0209759_1037181 | |||
| 938 | Ga0209759_1046899 | |||
| 939 | Ga0209129_1000653 | |||
| 940 | Ga0209129_1003691 | |||
| 941 | Ga0209233_1000023 | |||
| 942 | Ga0209233_1000419 | |||
| 943 | Ga0209565_1003844 | |||
| 944 | Ga0209455_1000010 | |||
| 945 | Ga0209455_1000035 | |||
| 946 | Ga0209455_1000097 | |||
| 947 | Ga0209455_1000218 | |||
| 948 | Ga0209455_1000774 | |||
| 949 | Ga0209673_1000124 | |||
| 950 | Ga0209673_1005112 | |||
| 951 | Ga0209673_1007502 | |||
| 952 | Ga0209673_1032748 | |||
| 953 | Ga0209130_1000022 | |||
| 954 | Ga0209025_1000003 | |||
| 955 | Ga0209025_1028046 | |||
| 956 | Ga0209564_1000475 | |||
| 957 | Ga0209564_1025883 | |||
| 958 | Ga0209758_1028297 | |||
| 959 | Ga0209758_1068198 | |||
| 960 | Ga0209256_1004167 | |||
| 961 | Ga0209256_1020693 | |||
| 962 | Ga0207426_1000005 | |||
| 963 | Ga0209051_1018719 | |||
| 964 | Ga0209257_1012027 | |||
| 965 | Ga0207656_10002930 | |||
| 966 | Ga0207696_1000143 | |||
| 967 | Ga0207655_1000173 | |||
| 968 | Ga0207655_1032811 | |||
| 969 | Ga0207655_1037840 | |||
| 970 | Ga0207655_1107367 | |||
| 971 | Ga0207713_1000315 | |||
| 972 | Ga0207713_1001848 | |||
| 973 | Ga0207713_1006439 | |||
| 974 | Ga0207680_10000002 | |||
| 975 | Ga0207680_10032126 | |||
| 976 | Ga0207647_10003916 | |||
| 977 | Ga0207695_10010058 | |||
| 978 | Ga0207695_10088148 | |||
| 979 | Ga0207695_10142571 | |||
| 980 | Ga0207695_10223078 | |||
| 981 | Ga0207671_10000196 | |||
| 982 | Ga0207671_10001413 | |||
| 983 | Ga0207693_10072328 | |||
| 984 | Ga0207663_10330980 | |||
| 985 | Ga0207660_10677987 | |||
| 986 | Ga0207657_10056277 | |||
| 987 | Ga0207657_10433498 | |||
| 988 | Ga0207649_10000042 | |||
| 989 | Ga0207649_10119572 | |||
| 990 | Ga0207652_10153258 | |||
| 991 | Ga0207681_10745968 | |||
| 992 | Ga0207694_10257706 | |||
| 993 | Ga0207650_10000874 | |||
| 994 | Ga0207700_10010034 | |||
| 995 | Ga0207664_10000021 | |||
| 996 | Ga0207664_10006826 | |||
| 997 | Ga0207664_10119125 | |||
| 998 | Ga0207644_10140926 | |||
| 999 | Ga0207644_10595055 | |||
| 1000 | Ga0207690_10000384 | |||
| 1001 | Ga0207706_10000566 | |||
| 1002 | Ga0207706_10052954 | |||
| 1003 | Ga0207686_10039967 | |||
| 1004 | Ga0207709_10022553 | |||
| 1005 | Ga0207709_11047775 | |||
| 1006 | Ga0207711_10011256 | |||
| 1007 | Ga0207711_10019271 | |||
| 1008 | Ga0207711_10080447 | |||
| 1009 | Ga0207679_10000044 | |||
| 1010 | Ga0207667_10000486 | |||
| 1011 | Ga0207667_10274103 | |||
| 1012 | Ga0207640_10000042 | |||
| 1013 | Ga0207640_10014134 | |||
| 1014 | Ga0207658_10021663 | |||
| 1015 | Ga0207678_10270774 | |||
| 1016 | Ga0207702_10000290 | |||
| 1017 | Ga0207702_10456164 | |||
| 1018 | Ga0207674_10063437 | |||
| 1019 | Ga0209371_1000185 | |||
| 1020 | Ga0209995_1011811 | |||
| 1021 | Ga0209982_1000979 | |||
| 1022 | Ga0209282_1000141 | |||
| 1023 | Ga0209971_1010745 | |||
| 1024 | Ga0209974_10001007 | |||
| 1025 | Ga0268266_10237046 | |||
| 1026 | Ga0307517_10119698 | |||
| 1027 | Ga0265338_10001414 | |||
| 1028 | Ga0268256_1000211 | |||
| 1029 | Ga0307509_10133981 | |||
| 1030 | Ga0307405_10002959 | |||
| 1031 | Ga0307414_10190370 | |||
| 1032 | Ga0395899_0024399 | |||
| 1033 | Ga0395900_0456111 | |||
| 1034 | Ga0395898_0000078 | |||
| 1035 | Ga0395898_0034384 | |||
| 1036 | Ga0395905_0486937 | |||
| 1037 | Ga0395901_0036847 | |||
| 1038 | Ga0237819_00428 | |||
| 1039 | Ga0436365_0354829 | |||
| 1040 | Ga0436361_0398230 | |||
| 1041 | Ga0439447_013622 | |||
| 1042 | Ga0451795_1066095 | |||
| 1043 | Ga0451833_0445334 | |||
| 1044 | Ga0451835_0648597 | |||
| 1045 | Ga0451837_0320107 | |||
| 1046 | Ga0451845_0592791 | |||
| 1047 | Ga0451849_0216198 | |||
| 1048 | Ga0451851_0154268 | |||
| 1049 | Ga0451855_0271646 | |||
| 1050 | Ga0439432_001612 | |||
| 1051 | Ga0439432_087301 | |||
| 1052 | Ga0439452_101138 | |||
| 1053 | Ga0439463_072582 | |||
| 1054 | Ga0466969_0026432 | |||
| 1055 | Ga0466969_0376695 | |||
| 1056 | Ga0466972_0001620 | |||
| 1057 | Ga0466982_0000013 | |||
| 1058 | Ga0466965_0015127 | |||
| 1059 | Ga0466965_0203664 | |||
| 1060 | Ga0466966_0000593 | |||
| 1061 | Ga0466966_0018299 | |||
| 1062 | Ga0466961_0004765 | |||
| 1063 | Ga0466961_0007797 | |||
| 1064 | Ga0466961_0026181 | |||
| 1065 | Ga0466961_0048224 | |||
| 1066 | Ga0466971_0005784 | |||
| 1067 | Ga0466971_0012041 | |||
| 1068 | Ga0466968_0016998 | |||
| 1069 | Ga0466970_0003402 | |||
| 1070 | Ga0466970_0004073 | |||
| 1071 | Ga0466970_0011372 | |||
| 1072 | Ga0466970_0033761 | |||
| 1073 | Ga0466957_0079195 | |||
| 1074 | Ga0466957_0192323 | |||
| 1075 | Ga0466960_0009427 | |||
| 1076 | Ga0466959_0000172 | |||
| 1077 | Ga0466959_0019023 | |||
| 1078 | Ga0466959_0082073 | |||
| 1079 | Ga0466959_0521420 | |||
| 1080 | Ga0466958_0003894 | |||
| 1081 | Ga0466958_0006576 | |||
| 1082 | Ga0466967_0163594 | |||
| 1083 | Ga0495617_000111 | |||
| 1084 | Ga0495617_001833 | |||
| 1085 | Ga0495627_000668 | |||
| 1086 | Ga0495603_0149909 | |||
| 1087 | Ga0495590_0079138 | |||
| 1088 | Ga0495591_000762 | |||
| 1089 | Ga0495591_040804 | |||
| 1090 | Ga0495629_0113571 | |||
| 1091 | Ga0495638_0000233 | |||
| 1092 | Ga0495638_0004139 | |||
| 1093 | Ga0495638_0010997 | |||
| 1094 | Ga0495638_0121587 | |||
| 1095 | Ga0495650_0017391 | |||
| 1096 | Ga0495650_0025254 | |||
| 1097 | Ga0495650_0029335 | |||
| 1098 | Ga0495650_0084469 | |||
| 1099 | Ga0495580_0114346 | |||
| 1100 | Ga0495605_0001310 | |||
| 1101 | Ga0495605_0001363 | |||
| 1102 | Ga0495605_0006109 | |||
| 1103 | Ga0495605_0316500 | |||
| 1104 | Ga0495662_0113843 | |||
| 1105 | Ga0495584_0000839 | |||
| 1106 | Ga0495584_0024203 | |||
| 1107 | Ga0495585_0000001 | |||
| 1108 | Ga0495585_0007027 | |||
| 1109 | Ga0495585_0044730 | |||
| 1110 | Ga0495596_0000296 | |||
| 1111 | Ga0495596_0015426 | |||
| 1112 | Ga0495607_0000207 | |||
| 1113 | Ga0495607_0000336 | |||
| 1114 | Ga0495607_0015940 | |||
| 1115 | Ga0495607_0033870 | |||
| 1116 | Ga0495607_0035963 | |||
| 1117 | Ga0495607_0057233 | |||
| 1118 | Ga0495607_0083586 | |||
| 1119 | Ga0495583_0001210 | |||
| 1120 | Ga0495583_0004094 | |||
| 1121 | Ga0495583_0006444 | |||
| 1122 | Ga0495583_0009253 | |||
| 1123 | Ga0495606_0001292 | |||
| 1124 | Ga0495606_0007113 | |||
| 1125 | Ga0495606_0010131 | |||
| 1126 | Ga0495606_0052259 | |||
| 1127 | Ga0495606_0073822 | |||
| 1128 | Ga0495606_0074451 | |||
| 1129 | Ga0495606_0177576 | |||
| 1130 | Ga0495610_0000803 | |||
| 1131 | Ga0495610_0001466 | |||
| 1132 | Ga0495610_0043104 | |||
| 1133 | Ga0495616_0000001 | |||
| 1134 | Ga0495616_0007643 | |||
| 1135 | Ga0495618_0179571 | |||
| 1136 | Ga0495620_0000543 | |||
| 1137 | Ga0495620_0004657 | |||
| 1138 | Ga0495620_0009435 | |||
| 1139 | Ga0495630_0287432 | |||
| 1140 | Ga0495631_0000162 | |||
| 1141 | Ga0495631_0000617 | |||
| 1142 | Ga0495631_0072449 | |||
| 1143 | Ga0495631_0161795 | |||
| 1144 | Ga0495632_0002482 | |||
| 1145 | Ga0495632_0007207 | |||
| 1146 | Ga0495632_0010644 | |||
| 1147 | Ga0495643_0031085 | |||
| 1148 | Ga0495643_0148217 | |||
| 1149 | Ga0495644_0342330 | |||
| 1150 | Ga0495648_0000083 | |||
| 1151 | Ga0495648_0004279 | |||
| 1152 | Ga0495648_0026745 | |||
| 1153 | Ga0495648_0098802 | |||
| 1154 | Ga0495648_0191969 | |||
| 1155 | Ga0495666_0018424 | |||
| 1156 | Ga0495642_0018770 | |||
| 1157 | Ga0495642_0027277 | |||
| 1158 | Ga0495654_0000762 | |||
| 1159 | Ga0495654_0115390 | |||
| 1160 | Ga0495665_0060673 | |||
| 1161 | Ga0495587_0305934 | |||
| 1162 | Ga0495609_0000905 | |||
| 1163 | Ga0495609_0002763 | |||
| 1164 | Ga0495609_0170168 | |||
| 1165 | Ga0495597_0031345 | |||
| 1166 | Ga0495597_0040811 | |||
| 1167 | Ga0495597_0194564 | |||
| 1168 | Ga0495622_0109712 | |||
| 1169 | Ga0495656_0138212 | |||
| 1170 | Ga0495668_0013200 | |||
| 1171 | Ga0495611_0000001 | |||
| 1172 | Ga0495611_0014748 | |||
| 1173 | Ga0495625_0000001 | |||
| 1174 | Ga0495661_0000290 | |||
| 1175 | Ga0495661_0001053 | |||
| 1176 | Ga0495661_0002265 | |||
| 1177 | Ga0495661_0008271 | |||
| 1178 | Ga0495661_0040496 | |||
| 1179 | Ga0495661_0388021 | |||
| 1180 | Ga0495669_0006796 | |||
| 1181 | Ga0495669_0042422 | |||
| 1182 | Ga0495670_0002621 | |||
| 1183 | Ga0495670_0019906 | |||
| 1184 | Ga0495670_0038206 | |||
| 1185 | Ga0495671_0000723 | |||
| 1186 | Ga0495671_0001777 | |||
| 1187 | Ga0495671_0006719 | |||
| 1188 | Ga0495671_0025501 | |||
| 1189 | Ga0495671_0049635 | |||
| 1190 | Ga0495671_0239734 | |||
| 1191 | Ga0495671_0324048 | |||
| 1192 | Ga0495649_0007424 | |||
| 1193 | Ga0495649_0054692 | |||
| 1194 | Ga0495649_0101989 | |||
| 1195 | Ga0495589_0000314 | |||
| 1196 | Ga0495589_0001164 | |||
| 1197 | Ga0495589_0001578 | |||
| 1198 | Ga0495589_0009411 | |||
| 1199 | Ga0495660_0000008 | |||
| 1200 | Ga0495660_0000180 | |||
| 1201 | Ga0495660_0032348 | |||
| 1202 | Ga0495660_0035700 | |||
| 1203 | Ga0495674_1116356 | |||
| 1204 | Ga0495672_0017827 | |||
| 1205 | Ga0495672_0028694 | |||
| 1206 | Ga0495683_0002728 | |||
| 1207 | Ga0495683_0006757 | |||
| 1208 | Ga0495683_0081831 | |||
| 1209 | Ga0495683_0231759 | |||
| 1210 | Ga0495679_000001 | |||
| 1211 | Ga0495679_000115 | |||
| 1212 | Ga0495679_000353 | |||
| 1213 | Ga0495679_001477 | |||
| 1214 | Ga0495685_019269 | |||
| 1215 | Ga0495685_105681 | |||
| 1216 | Ga0495673_0000001 | |||
| 1217 | Ga0495673_0000030 | |||
| 1218 | Ga0495673_0000232 | |||
| 1219 | Ga0495673_0060860 | |||
| 1220 | Ga0495681_0005004 | |||
| 1221 | Ga0495681_0038721 | |||
| 1222 | Ga0495681_0147045 | |||
| 1223 | Ga0495686_0000019 | |||
| 1224 | Ga0495686_0000077 | |||
| 1225 | Ga0495686_0022484 | |||
| 1226 | Ga0495686_0022650 | |||
| 1227 | Ga0495686_0041028 | |||
| 1228 | Ga0495686_0076792 | |||
| 1229 | Ga0495602_0192922 | |||
| 1230 | Ga0495626_0012020 | |||
| 1231 | Ga0495626_0019776 | |||
| 1232 | Ga0496102_0029176 | |||
| 1233 | Ga0496103_0031599 | |||
| 1234 | Ga0496105_0012131 | |||
| 1235 | Ga0496106_0000034 | |||
| 1236 | Ga0496106_0001636 | |||
| 1237 | Ga0496106_0015200 | |||
| 1238 | Ga0496112_0441348 | |||
| 1239 | Ga0496115_0056353 | |||
| 1240 | Ga0496116_0024416 | |||
| 1241 | Ga0496116_0033295 | |||
| 1242 | Ga0496116_0038617 | |||
| 1243 | Ga0496117_0000876 | |||
| 1244 | Ga0496117_0040887 | |||
| 1245 | Ga0496117_0070320 | |||
| 1246 | Ga0496117_0082586 | |||
| 1247 | Ga0496117_0093467 | |||
| 1248 | Ga0496117_0166931 | |||
| 1249 | Ga0496118_0007642 | |||
| 1250 | Ga0496118_0018109 | |||
| 1251 | Ga0496118_0024104 | |||
| 1252 | Ga0496118_0028642 | |||
| 1253 | Ga0496118_0040829 | |||
| 1254 | Ga0496118_0045206 | |||
| 1255 | Ga0496118_0244343 | |||
| 1256 | Ga0496119_0062587 | |||
| 1257 | Ga0496119_0122302 | |||
| 1258 | Ga0496120_0003942 | |||
| 1259 | Ga0496120_0029932 | |||
| 1260 | Ga0496120_0034799 | |||
| 1261 | Ga0496120_0059413 | |||
| 1262 | Ga0496121_0000278 | |||
| 1263 | Ga0496121_0000431 | |||
| 1264 | Ga0496121_0001587 | |||
| 1265 | Ga0496121_0008874 | |||
| 1266 | Ga0496121_0017270 | |||
| 1267 | Ga0496121_0034837 | |||
| 1268 | Ga0496121_0052326 | |||
| 1269 | Ga0496121_0082577 | |||
| 1270 | Ga0496121_0208549 | |||
| 1271 | Ga0496121_0265551 | |||
| 1272 | Ga0496121_0293537 | |||
| 1273 | Ga0496122_0016926 | |||
| 1274 | Ga0496122_0057665 | |||
| 1275 | Ga0496122_0061624 | |||
| 1276 | Ga0496122_0259322 | |||
| 1277 | Ga0496122_0287164 | |||
| 1278 | Ga0496122_0289509 | |||
| 1279 | Ga0496123_0003223 | |||
| 1280 | Ga0496123_0011469 | |||
| 1281 | Ga0496123_0052857 | |||
| 1282 | Ga0496123_0074724 | |||
| 1283 | Ga0496123_0177402 | |||
| 1284 | Ga0496123_0273617 | |||
| 1285 | Ga0496124_0000948 | |||
| 1286 | Ga0496124_0018685 | |||
| 1287 | Ga0496124_0042475 | |||
| 1288 | Ga0496124_0050938 | |||
| 1289 | Ga0496124_0061560 | |||
| 1290 | Ga0496124_0293175 | |||
| 1291 | Ga0496124_0296988 | |||
| 1292 | Ga0496124_0425366 | |||
| 1293 | Ga0496125_0000915 | |||
| 1294 | Ga0496125_0004839 | |||
| 1295 | Ga0496125_0020402 | |||
| 1296 | Ga0496125_0059444 | |||
| 1297 | Ga0496125_0060612 | |||
| 1298 | Ga0496125_0099352 | |||
| 1299 | Ga0496125_0107708 | |||
| 1300 | Ga0496126_0000389 | |||
| 1301 | Ga0496126_0036072 | |||
| 1302 | Ga0496126_0042656 | |||
| 1303 | Ga0496126_0123351 | |||
| 1304 | Ga0496126_0137070 | |||
| 1305 | Ga0496126_0211273 | |||
| 1306 | Ga0496126_0251378 | |||
| 1307 | Ga0496126_0577063 | |||
| 1308 | Ga0495678_000023 | |||
| 1309 | Ga0495678_005024 | |||
| 1310 | Ga0495682_0000048 | |||
| 1311 | Ga0495682_0009290 | |||
| 1312 | Ga0495682_0040669 | |||
| 1313 | Ga0501031_0111305 | |||
| 1314 | Ga0501031_0263145 | |||
| 1315 | Ga0501032_0035390 | |||
| 1316 | Ga0501033_0004794 | |||
| 1317 | Ga0501033_0142874 | |||
| 1318 | Ga0501033_0282525 | |||
| 1319 | Ga0501034_0049617 | |||
| 1320 | Ga0501036_0008151 | |||
| 1321 | Ga0501036_0837465 | |||
| 1322 | Ga0501037_0032822 | |||
| 1323 | Ga0501037_0073082 | |||
| 1324 | Ga0501038_0073981 | |||
| 1325 | Ga0501038_0171767 | |||
| 1326 | Ga0501040_0324588 | |||
| 1327 | Ga0501042_0206234 | |||
| 1328 | Ga0501043_0012070 | |||
| 1329 | Ga0501043_0352869 | |||
| 1330 | Ga0501043_0383111 | |||
| 1331 | Ga0501046_0026164 | |||
| 1332 | Ga0501047_0034665 | |||
| 1333 | Ga0501047_0067086 | |||
| 1334 | Ga0501047_0147685 | |||
| 1335 | Ga0501048_0075671 | |||
| 1336 | Ga0501070_0040316 | |||
| 1337 | Ga0501070_0136002 | |||
| 1338 | Ga0501080_0100403 | |||
| 1339 | Ga0501035_0006541 | |||
| 1340 | Ga0501035_0040819 | |||
| 1341 | Ga0501035_0123479 | |||
| 1342 | Ga0501035_0245948 | |||
| 1343 | Ga0501044_0026488 | |||
| 1344 | Ga0501044_0089010 | |||
| 1345 | Ga0501044_0128377 | |||
| 1346 | Ga0501044_0261434 | |||
| 1347 | Ga0501044_0314965 | |||
| 1348 | Ga0501044_0388977 | |||
| 1349 | Ga0500643_000002 | |||
| 1350 | Ga0500651_0139885 | |||
| 1351 | Ga0500555_000716 | |||
| 1352 | Ga0500595_008673 | |||
| 1353 | Ga0500658_0072422 | |||
| 1354 | Ga0500568_0010576 | |||
| 1355 | Ga0500568_0110468 | |||
| 1356 | Ga0500622_0001338 | |||
| 1357 | Ga0500633_0000151 | |||
| 1358 | Ga0500634_0002831 | |||
| 1359 | Ga0500645_000704 | |||
| 1360 | Ga0587088_038126 | |||
| 1361 | Ga0466962_0008594 | |||
| 1362 | Ga0466962_0008862 | |||
| 1363 | 2511196366 | |||
| 1364 | 2513597942 | |||
| 1365 | 2519457225 | |||
| 1366 | 2563062580 | |||
| 1367 | 2585226312 | |||
| 1368 | 2585292231 | |||
| 1369 | 2585548768 | |||
| 1370 | 2597864618 | |||
| 1371 | 2597870424 | |||
| 1372 | 2599397792 | |||
| 1373 | 2599452238 | |||
| 1374 | 2599506821 | |||
| 1375 | 2599513383 | |||
| 1376 | 2599518118 | |||
| 1377 | 2599738838 | |||
| 1378 | 2599747547 | |||
| 1379 | 2599880941 | |||
| 1380 | 2599892060 | |||
| 1381 | 2599949926 | |||
| 1382 | 2600209431 | |||
| 1383 | 2600811847 | |||
| 1384 | 2601690089 | |||
| 1385 | 2621298870 | |||
| 1386 | 2643871323 | |||
| 1387 | 2643894630 | |||
| 1388 | 2643974623 | |||
| 1389 | 2644476782 | |||
| 1390 | 2644622752 | |||
| 1391 | 2676745490 | |||
| 1392 | 2677900663 | |||
| 1393 | 2687582168 | |||
| 1394 | 2713476816 | |||
| 1395 | 2721027675 | |||
| 1396 | 2723249400 | |||
| 1397 | 2735836765 | |||
| 1398 | 2738672117 | |||
| 1399 | 2738750510 | |||
| 1400 | 2738806010 | |||
| 1401 | 2738859551 | |||
| 1402 | 2738893370 | |||
| 1403 | 2739228682 | |||
| 1404 | 2748018389 | |||
| 1405 | 2792839895 | |||
| 1406 | 2808971272 | |||
| 1407 | 2808979048 | |||
| 1408 | 2808994637 | |||
| 1409 | 2809006344 | |||
| 1410 | 2809013239 | |||
| 1411 | 2817259429 | |||
| 1412 | 2817277097 | |||
| 1413 | 2817454012 | |||
| 1414 | 2817491969 | |||
| 1415 | 2819562955 | |||
| 1416 | 2819634794 | |||
| 1417 | 2834032782 | |||
| 1418 | 2842805997 | |||
| 1419 | 2842828248 | |||
| 1420 | 2842841154 | |||
| 1421 | 2852613733 | |||
| 1422 | 2852668531 | |||
| 1423 | 2855734563 | |||
| 1424 | 2855770153 | |||
| 1425 | 2860871129 | |||
| 1426 | 2863425472 | |||
| 1427 | 2870069724 | |||
| 1428 | 2881414366 | |||
| 1429 | 2884340362 | |||
| 1430 | 2895396664 | |||
| 1431 | 2900641146 | |||
| 1432 | 2904463567 | |||
| 1433 | 2904570230 | |||
| 1434 | 2904577238 | |||
| 1435 | 2908450464 | |||
| 1436 | 2919104760 | |||
| 1437 | 2928108594 | |||
| 1438 | 2928135818 | |||
| 1439 | 2928163653 | |||
| 1440 | 2928170598 | |||
| 1441 | 2928175932 | |||
| 1442 | 2928541571 | |||
| 1443 | 2928964195 | |||
| 1444 | 2929193189 | |||
| 1445 | 2931393256 | |||
| 1446 | 2939614547 | |||
| 1447 | 2941473434 | |||
| 1448 | 2945932796 | |||
| 1449 | 2945964756 | |||
| 1450 | 2946009058 | |||
| 1451 | 2946031469 | |||
| 1452 | 2947238433 | |||
| 1453 | 2981995683 | |||
| 1454 | 3005452061 | |||
| 1455 | 642415063 | |||
| 1456 | 642616070 | |||
| 1457 | 643391069 | |||
| 1458 | 8011352303 | |||
| 1459 | 8018851866 | |||
| 1460 | 8020813387 | |||
| 1461 | 8020939262 | |||
| 1462 | 8020958254 | |||
| 1463 | 8021128340 | |||
| 1464 | 8024487022 | |||
| 1465 | 8040169524 | |||
| 1466 | 8040174558 | |||
| 1467 | 8054287736 | |||
| 1468 | 8054348969 | |||
| 1469 | 8054506975 | |||
| 1470 | 8055821936 | |||
| 1471 | 8056154395 | |||
| 1472 | 8056165364 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5oc0-assembly1.cif.gz_A | structure of e. coli superoxide oxidase | 0.8759 | 6 | 174 |
| 5oc0-assembly1.cif.gz_A | structure of e. coli superoxide oxidase | 0.8434 | 6 | 174 |
| 1kqf-assembly1.cif.gz_C | formate dehydrogenase n from e. coli | 0.6641 | 8 | 173 |
| 4gd3-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 in complex with cytochrome b | 0.6552 | 8 | 165 |
| 6g94-assembly1.cif.gz_A | structure of e. coli hydrogenase-1 c19g variant in complex with cytochrome b | 0.612 | 8 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76345_3_174_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.8959 | 8 | 174 | 1.20.950.20 |
| af_P0ABE5_4_173_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.8763 | 8 | 174 | 1.20.950.20 |
| af_P76345_3_174_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.8667 | 8 | 174 | 1.20.950.20 |
| af_P0ABE5_4_173_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.8526 | 8 | 174 | 1.20.950.20 |
| af_P0AEL0_1_211_1.20.950.20 | Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C | 0.6715 | 8 | 177 | 1.20.950.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q1HPY8-F1-model_v4 | Cytochrome b | 0.9868 | 6 | 176 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A1B4HPD7-F1-model_v4 | deleted | 0.9847 | 6 | 176 |
|
| AF-A0A0S1Y1H0-F1-model_v4 | Cytochrome B | 0.9847 | 6 | 176 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A6P2SN87-F1-model_v4 | Cytochrome B561 | 0.9842 | 6 | 176 |
GO:0005886
GO:0009055 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A1I0KR83-F1-model_v4 | deleted | 0.9835 | 6 | 176 |
|