F478284
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 736 | 364 | 709 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0139643|Ga0436364_0139643_1063_1632 |
| Length | 189 |
| Sequence | VSDALEQQEQREQAEWPAETPAGGHTFGIVLEDVRQFLYREARYLDDREFEQWLECYHSDAEFWMPAWADDDNVTTDPQSEISLVYYPNRAGLEDRVFRIRTDRSSATSLPEPRTGHNITNVEITGQEGAFVDVRFNWFTLYYRYQTVDTYFGTSFYRLDLSGPKPLITRKKVVLKNDYVHHVVDIYHV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 3 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 4 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 5 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 6 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 7 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 8 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 9 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 10 | 2775506925 | Saccharopolyspora phatthalungensis NRRL B-24798 | Isolate | Rhizosphere |
| 11 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 12 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 13 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 14 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 15 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 16 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 17 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 18 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 19 | 2893684298 | Kocuria palustris DSM 11925 | Isolate | Rhizosphere |
| 20 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 21 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 22 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 23 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 24 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 25 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 26 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 27 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 28 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 29 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 30 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 31 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 32 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 34 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 35 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 36 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 37 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 47 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 49 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 74 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 80 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 89 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 90 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 91 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 93 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 105 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 108 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 109 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 112 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 116 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 150 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 154 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 155 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 215 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 219 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 220 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 221 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 222 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 223 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 224 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 232 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 233 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 238 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 240 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 241 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 242 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 243 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 244 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 245 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 246 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 247 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 248 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 249 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 250 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 251 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 257 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 258 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 259 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 260 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 261 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 262 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 263 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 264 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 265 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 266 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 267 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 268 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 269 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 270 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 271 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 272 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 273 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 274 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 275 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 276 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 277 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 278 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 279 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 280 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 281 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 282 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 283 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 284 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 313 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 314 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 315 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 316 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 317 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 319 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 320 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 321 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 322 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 323 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 324 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 325 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 330 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 331 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 338 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 339 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 340 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 341 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 342 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 343 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 344 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 345 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 346 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 347 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 348 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 349 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 350 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 351 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 352 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 353 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 354 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 362 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 363 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 364 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.49 |
| Metatranscriptomes | 5.84 |
| Isolates | 3.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.31 |
| Nodule | 0.27 |
| Rhizoplane | 7.74 |
| Rhizosphere | 86.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1000116 | 3300000549 | Bacteria | 13834 |
| 2 | LJQas_1004960 | 3300000549 | Bacteria | 1705 |
| 3 | JGI24737J22298_10049507 | 3300001990 | Bacteria | 1278 |
| 4 | JGI24743J22301_10003682 | 3300001991 | Bacteria | 2445 |
| 5 | JGI24735J21928_10042444 | 3300002067 | Bacteria | 1324 |
| 6 | JGI24738J21930_10007611 | 3300002075 | Bacteria | 2492 |
| 7 | JGI24034J26672_10005656 | 3300002239 | Bacteria | 1795 |
| 8 | JGI25406J46586_10079730 | 3300003203 | Bacteria | 1007 |
| 9 | Ga0058858_1421484 | 3300004785 | Bacteria | 1590 |
| 10 | Ga0058859_10009161 | 3300004798 | Bacteria | 1625 |
| 11 | Ga0058863_10041758 | 3300004799 | Bacteria | 1474 |
| 12 | Ga0058861_10087982 | 3300004800 | Bacteria | 2685 |
| 13 | Ga0058862_10099156 | 3300004803 | Bacteria | 2414 |
| 14 | Ga0070658_10130570 | 3300005327 | Bacteria | 2093 |
| 15 | Ga0070676_10020890 | 3300005328 | Bacteria | 3661 |
| 16 | Ga0070676_10118520 | 3300005328 | Bacteria | 1658 |
| 17 | Ga0070683_100567343 | 3300005329 | Bacteria | 1085 |
| 18 | Ga0070670_100209071 | 3300005331 | Bacteria | 1696 |
| 19 | Ga0068869_100035747 | 3300005334 | Bacteria | 3523 |
| 20 | Ga0068869_100039798 | 3300005334 | Bacteria | 3359 |
| 21 | Ga0070666_10009026 | 3300005335 | Bacteria | 6211 |
| 22 | Ga0070666_10096876 | 3300005335 | Bacteria | 2031 |
| 23 | Ga0070680_100275773 | 3300005336 | Bacteria | 1424 |
| 24 | Ga0070682_100030739 | 3300005337 | Bacteria | 3245 |
| 25 | Ga0070682_100042072 | 3300005337 | Bacteria | 2819 |
| 26 | Ga0070682_100167042 | 3300005337 | Bacteria | 1526 |
| 27 | Ga0070682_100174053 | 3300005337 | Bacteria | 1498 |
| 28 | Ga0070682_100361567 | 3300005337 | Bacteria | 1085 |
| 29 | Ga0068868_100000203 | 3300005338 | Bacteria | 40057 |
| 30 | Ga0068868_100219671 | 3300005338 | Bacteria | 1590 |
| 31 | Ga0070660_100289439 | 3300005339 | Bacteria | 1341 |
| 32 | Ga0070689_100040615 | 3300005340 | Bacteria | 3568 |
| 33 | Ga0070689_100331091 | 3300005340 | Bacteria | 1274 |
| 34 | Ga0070691_10000914 | 3300005341 | Bacteria | 11972 |
| 35 | Ga0070691_10020230 | 3300005341 | Bacteria | 3074 |
| 36 | Ga0070692_10019671 | 3300005345 | Bacteria | 3262 |
| 37 | Ga0070668_100005307 | 3300005347 | Bacteria | 9566 |
| 38 | Ga0070668_100152042 | 3300005347 | Bacteria | 1872 |
| 39 | Ga0070668_100197378 | 3300005347 | Bacteria | 1651 |
| 40 | Ga0070668_101364615 | 3300005347 | Bacteria | 646 |
| 41 | Ga0070669_100031637 | 3300005353 | Bacteria | 3822 |
| 42 | Ga0070669_100065201 | 3300005353 | Bacteria | 2683 |
| 43 | Ga0070675_100087473 | 3300005354 | Bacteria | 2605 |
| 44 | Ga0070675_100340366 | 3300005354 | Bacteria | 1328 |
| 45 | Ga0070675_100765381 | 3300005354 | Bacteria | 881 |
| 46 | Ga0070671_100021227 | 3300005355 | Bacteria | 5304 |
| 47 | Ga0070671_100178098 | 3300005355 | Bacteria | 1799 |
| 48 | Ga0070674_100000244 | 3300005356 | Bacteria | 26961 |
| 49 | Ga0070674_100212458 | 3300005356 | Bacteria | 1500 |
| 50 | Ga0070673_100449356 | 3300005364 | Bacteria | 1159 |
| 51 | Ga0070688_100002188 | 3300005365 | Bacteria | 9856 |
| 52 | Ga0070688_100018231 | 3300005365 | Bacteria | 4047 |
| 53 | Ga0070688_100144039 | 3300005365 | Bacteria | 1622 |
| 54 | Ga0070659_100028419 | 3300005366 | Bacteria | 4319 |
| 55 | Ga0070659_100038097 | 3300005366 | Bacteria | 3749 |
| 56 | Ga0070659_100049761 | 3300005366 | Bacteria | 3296 |
| 57 | Ga0070659_100088400 | 3300005366 | Bacteria | 2481 |
| 58 | Ga0070667_100066954 | 3300005367 | Bacteria | 3053 |
| 59 | Ga0070667_100163065 | 3300005367 | Bacteria | 1964 |
| 60 | Ga0070667_100850445 | 3300005367 | Bacteria | 848 |
| 61 | Ga0070709_10014652 | 3300005434 | Bacteria | 4438 |
| 62 | Ga0070709_10159348 | 3300005434 | Bacteria | 1568 |
| 63 | Ga0070709_10190005 | 3300005434 | Bacteria | 1448 |
| 64 | Ga0070709_10804763 | 3300005434 | Bacteria | 738 |
| 65 | Ga0070714_100828600 | 3300005435 | Bacteria | 897 |
| 66 | Ga0070713_100976370 | 3300005436 | Bacteria | 817 |
| 67 | Ga0070710_10007738 | 3300005437 | Bacteria | 5212 |
| 68 | Ga0070710_10025259 | 3300005437 | Bacteria | 3145 |
| 69 | Ga0070710_10083926 | 3300005437 | Bacteria | 1865 |
| 70 | Ga0070701_10055627 | 3300005438 | Bacteria | 2068 |
| 71 | Ga0070711_100002396 | 3300005439 | Bacteria | 10681 |
| 72 | Ga0070711_100005711 | 3300005439 | Bacteria | 7459 |
| 73 | Ga0070711_100132440 | 3300005439 | Bacteria | 1858 |
| 74 | Ga0070705_100005263 | 3300005440 | Bacteria | 6289 |
| 75 | Ga0070705_100084114 | 3300005440 | Bacteria | 1963 |
| 76 | Ga0070700_100012566 | 3300005441 | Bacteria | 4730 |
| 77 | Ga0070700_100029765 | 3300005441 | Bacteria | 3258 |
| 78 | Ga0070694_100044216 | 3300005444 | Bacteria | 2980 |
| 79 | Ga0070694_100335162 | 3300005444 | Bacteria | 1168 |
| 80 | Ga0070663_100012067 | 3300005455 | Bacteria | 5452 |
| 81 | Ga0070663_100173838 | 3300005455 | Bacteria | 1666 |
| 82 | Ga0070663_100694125 | 3300005455 | Bacteria | 864 |
| 83 | Ga0070678_100125867 | 3300005456 | Bacteria | 2028 |
| 84 | Ga0070678_100148518 | 3300005456 | Bacteria | 1885 |
| 85 | Ga0070678_100171114 | 3300005456 | Bacteria | 1769 |
| 86 | Ga0070678_100402445 | 3300005456 | Bacteria | 1189 |
| 87 | Ga0070662_100000713 | 3300005457 | Bacteria | 20417 |
| 88 | Ga0070662_100023543 | 3300005457 | Bacteria | 4231 |
| 89 | Ga0070662_100190515 | 3300005457 | Bacteria | 1621 |
| 90 | Ga0070662_100410529 | 3300005457 | Bacteria | 1119 |
| 91 | Ga0068867_100001211 | 3300005459 | Bacteria | 17725 |
| 92 | Ga0068867_100070477 | 3300005459 | Bacteria | 2613 |
| 93 | Ga0068867_100163388 | 3300005459 | Bacteria | 1757 |
| 94 | Ga0068867_100579396 | 3300005459 | Bacteria | 976 |
| 95 | Ga0070685_10405609 | 3300005466 | Bacteria | 945 |
| 96 | Ga0070685_10924288 | 3300005466 | Bacteria | 650 |
| 97 | Ga0070706_101140514 | 3300005467 | Bacteria | 717 |
| 98 | Ga0070698_100349102 | 3300005471 | Bacteria | 1411 |
| 99 | Ga0070679_100231529 | 3300005530 | Bacteria | 1807 |
| 100 | Ga0070684_100259830 | 3300005535 | Bacteria | 1588 |
| 101 | Ga0070684_100790738 | 3300005535 | Bacteria | 887 |
| 102 | Ga0070697_100578301 | 3300005536 | Bacteria | 986 |
| 103 | Ga0068853_100020911 | 3300005539 | Bacteria | 5445 |
| 104 | Ga0070672_100084142 | 3300005543 | Bacteria | 2554 |
| 105 | Ga0070672_100252351 | 3300005543 | Bacteria | 1486 |
| 106 | Ga0070686_100520250 | 3300005544 | Bacteria | 926 |
| 107 | Ga0070695_100002690 | 3300005545 | Bacteria | 10289 |
| 108 | Ga0070695_100105423 | 3300005545 | Bacteria | 1905 |
| 109 | Ga0070696_100035559 | 3300005546 | Bacteria | 3431 |
| 110 | Ga0070696_100044126 | 3300005546 | Bacteria | 3087 |
| 111 | Ga0070696_100121686 | 3300005546 | Bacteria | 1889 |
| 112 | Ga0070693_100035467 | 3300005547 | Bacteria | 2767 |
| 113 | Ga0070693_100094314 | 3300005547 | Bacteria | 1810 |
| 114 | Ga0070693_100292561 | 3300005547 | Bacteria | 1095 |
| 115 | Ga0070693_100312734 | 3300005547 | Bacteria | 1063 |
| 116 | Ga0070665_100005218 | 3300005548 | Bacteria | 13443 |
| 117 | Ga0070665_100269005 | 3300005548 | Bacteria | 1706 |
| 118 | Ga0070665_100443494 | 3300005548 | Bacteria | 1307 |
| 119 | Ga0070665_100915168 | 3300005548 | Bacteria | 890 |
| 120 | Ga0070665_101299194 | 3300005548 | Bacteria | 737 |
| 121 | Ga0070704_100032452 | 3300005549 | Bacteria | 3522 |
| 122 | Ga0070704_100330316 | 3300005549 | Bacteria | 1280 |
| 123 | Ga0068855_100184547 | 3300005563 | Bacteria | 2357 |
| 124 | Ga0068855_100320302 | 3300005563 | Bacteria | 1714 |
| 125 | Ga0068855_100473773 | 3300005563 | Bacteria | 1363 |
| 126 | Ga0068855_101153401 | 3300005563 | Bacteria | 808 |
| 127 | Ga0068857_100068268 | 3300005577 | Bacteria | 3164 |
| 128 | Ga0068854_100000262 | 3300005578 | Bacteria | 35841 |
| 129 | Ga0068854_100017580 | 3300005578 | Bacteria | 4785 |
| 130 | Ga0068854_100103823 | 3300005578 | Bacteria | 2134 |
| 131 | Ga0068854_100775741 | 3300005578 | Bacteria | 833 |
| 132 | Ga0068854_101038324 | 3300005578 | Bacteria | 727 |
| 133 | Ga0068856_100095930 | 3300005614 | Bacteria | 2954 |
| 134 | Ga0068856_100226532 | 3300005614 | Bacteria | 1885 |
| 135 | Ga0070702_100001129 | 3300005615 | Bacteria | 10713 |
| 136 | Ga0070702_100011029 | 3300005615 | Bacteria | 4482 |
| 137 | Ga0068852_100097532 | 3300005616 | Bacteria | 2645 |
| 138 | Ga0068852_100160012 | 3300005616 | Bacteria | 2102 |
| 139 | Ga0068852_100316407 | 3300005616 | Bacteria | 1514 |
| 140 | Ga0068852_100328356 | 3300005616 | Bacteria | 1488 |
| 141 | Ga0068852_100396309 | 3300005616 | Bacteria | 1357 |
| 142 | Ga0068859_100002266 | 3300005617 | Bacteria | 19509 |
| 143 | Ga0068859_100018292 | 3300005617 | Bacteria | 7045 |
| 144 | Ga0068859_100171048 | 3300005617 | Bacteria | 2253 |
| 145 | Ga0068859_100903846 | 3300005617 | Bacteria | 967 |
| 146 | Ga0068859_101674409 | 3300005617 | Bacteria | 703 |
| 147 | Ga0068864_100357442 | 3300005618 | Bacteria | 1379 |
| 148 | Ga0068864_100380674 | 3300005618 | Bacteria | 1337 |
| 149 | Ga0068866_10000681 | 3300005718 | Bacteria | 15451 |
| 150 | Ga0068866_10013634 | 3300005718 | Bacteria | 3572 |
| 151 | Ga0068866_10069881 | 3300005718 | Bacteria | 1851 |
| 152 | Ga0068866_10366871 | 3300005718 | Bacteria | 919 |
| 153 | Ga0068866_10374820 | 3300005718 | Bacteria | 911 |
| 154 | Ga0068861_100018017 | 3300005719 | Bacteria | 5022 |
| 155 | Ga0068861_100031467 | 3300005719 | Bacteria | 3898 |
| 156 | Ga0068861_100293577 | 3300005719 | Bacteria | 1405 |
| 157 | Ga0068851_10036766 | 3300005834 | Bacteria | 2453 |
| 158 | Ga0068870_10130974 | 3300005840 | Bacteria | 1457 |
| 159 | Ga0068870_10374851 | 3300005840 | Bacteria | 919 |
| 160 | Ga0068863_100064551 | 3300005841 | Bacteria | 3462 |
| 161 | Ga0068863_100163747 | 3300005841 | Bacteria | 2132 |
| 162 | Ga0068863_100325055 | 3300005841 | Bacteria | 1494 |
| 163 | Ga0068858_100001689 | 3300005842 | Bacteria | 22563 |
| 164 | Ga0068858_100072930 | 3300005842 | Bacteria | 3186 |
| 165 | Ga0068858_100102866 | 3300005842 | Bacteria | 2664 |
| 166 | Ga0068858_100143657 | 3300005842 | Bacteria | 2241 |
| 167 | Ga0068858_100544263 | 3300005842 | Bacteria | 1124 |
| 168 | Ga0068860_100001255 | 3300005843 | Bacteria | 27661 |
| 169 | Ga0068860_100037958 | 3300005843 | Bacteria | 4609 |
| 170 | Ga0068860_100084902 | 3300005843 | Bacteria | 3011 |
| 171 | Ga0068860_100376133 | 3300005843 | Bacteria | 1402 |
| 172 | Ga0068860_101278075 | 3300005843 | Bacteria | 754 |
| 173 | Ga0068862_100001317 | 3300005844 | Bacteria | 23074 |
| 174 | Ga0068862_100114511 | 3300005844 | Bacteria | 2370 |
| 175 | Ga0068862_100174243 | 3300005844 | Bacteria | 1927 |
| 176 | Ga0068862_100384621 | 3300005844 | Bacteria | 1309 |
| 177 | Ga0081455_10007611 | 3300005937 | Bacteria | 11384 |
| 178 | Ga0081455_10018209 | 3300005937 | Bacteria | 6704 |
| 179 | Ga0081539_10006743 | 3300005985 | Bacteria | 10787 |
| 180 | Ga0081539_10031667 | 3300005985 | Bacteria | 3255 |
| 181 | Ga0070717_10121739 | 3300006028 | Bacteria | 2236 |
| 182 | Ga0075365_10215282 | 3300006038 | Bacteria | 1347 |
| 183 | Ga0075364_10244722 | 3300006051 | Bacteria | 1218 |
| 184 | Ga0075364_10591662 | 3300006051 | Bacteria | 758 |
| 185 | Ga0075432_10004226 | 3300006058 | Bacteria | 4887 |
| 186 | Ga0075432_10085879 | 3300006058 | Bacteria | 1146 |
| 187 | Ga0070715_10016658 | 3300006163 | Bacteria | 2767 |
| 188 | Ga0070715_10041328 | 3300006163 | Bacteria | 1932 |
| 189 | Ga0070716_100001673 | 3300006173 | Bacteria | 9998 |
| 190 | Ga0070716_100001813 | 3300006173 | Bacteria | 9669 |
| 191 | Ga0070712_100001225 | 3300006175 | Bacteria | 15514 |
| 192 | Ga0070712_100056512 | 3300006175 | Bacteria | 2753 |
| 193 | Ga0070712_100206841 | 3300006175 | Bacteria | 1545 |
| 194 | Ga0097621_100038572 | 3300006237 | Bacteria | 3834 |
| 195 | Ga0097621_100217142 | 3300006237 | Bacteria | 1665 |
| 196 | Ga0068871_100044030 | 3300006358 | Bacteria | 3588 |
| 197 | Ga0068871_100080370 | 3300006358 | Bacteria | 2699 |
| 198 | Ga0068871_100274619 | 3300006358 | Bacteria | 1473 |
| 199 | Ga0075428_100092968 | 3300006844 | Bacteria | 3288 |
| 200 | Ga0068865_100300952 | 3300006881 | Bacteria | 1284 |
| 201 | Ga0068865_100461217 | 3300006881 | Bacteria | 1052 |
| 202 | Ga0097620_100002267 | 3300006931 | Bacteria | 19509 |
| 203 | Ga0097620_100018292 | 3300006931 | Bacteria | 7045 |
| 204 | Ga0097620_100171066 | 3300006931 | Bacteria | 2253 |
| 205 | Ga0097620_100903897 | 3300006931 | Bacteria | 967 |
| 206 | Ga0097620_101674463 | 3300006931 | Bacteria | 703 |
| 207 | Ga0105251_10137392 | 3300009011 | Bacteria | 1106 |
| 208 | Ga0105250_10206822 | 3300009092 | Bacteria | 829 |
| 209 | Ga0111539_10438119 | 3300009094 | Bacteria | 1522 |
| 210 | Ga0111539_10690177 | 3300009094 | Bacteria | 1188 |
| 211 | Ga0111539_10861476 | 3300009094 | Bacteria | 1054 |
| 212 | Ga0111539_10902890 | 3300009094 | Bacteria | 1028 |
| 213 | Ga0111539_11205917 | 3300009094 | Bacteria | 879 |
| 214 | Ga0105245_10001005 | 3300009098 | Bacteria | 25622 |
| 215 | Ga0105245_10092913 | 3300009098 | Bacteria | 2779 |
| 216 | Ga0105245_10207686 | 3300009098 | Bacteria | 1883 |
| 217 | Ga0105245_10361532 | 3300009098 | Bacteria | 1441 |
| 218 | Ga0105247_10000372 | 3300009101 | Bacteria | 38190 |
| 219 | Ga0105247_10094069 | 3300009101 | Bacteria | 1906 |
| 220 | Ga0105247_10185883 | 3300009101 | Bacteria | 1389 |
| 221 | Ga0105247_10213937 | 3300009101 | Bacteria | 1301 |
| 222 | Ga0105247_10714032 | 3300009101 | Bacteria | 756 |
| 223 | Ga0105247_10954126 | 3300009101 | Bacteria | 666 |
| 224 | Ga0114129_10111628 | 3300009147 | Bacteria | 3772 |
| 225 | Ga0105243_10000676 | 3300009148 | Bacteria | 33249 |
| 226 | Ga0105243_10092718 | 3300009148 | Bacteria | 2491 |
| 227 | Ga0105243_10178741 | 3300009148 | Bacteria | 1844 |
| 228 | Ga0105243_10573239 | 3300009148 | Bacteria | 1082 |
| 229 | Ga0105243_11161613 | 3300009148 | Bacteria | 783 |
| 230 | Ga0105241_10030340 | 3300009174 | Bacteria | 4040 |
| 231 | Ga0105241_10641842 | 3300009174 | Bacteria | 963 |
| 232 | Ga0105242_10000197 | 3300009176 | Bacteria | 46948 |
| 233 | Ga0105242_10060569 | 3300009176 | Bacteria | 3111 |
| 234 | Ga0105242_10081548 | 3300009176 | Bacteria | 2705 |
| 235 | Ga0105242_10835790 | 3300009176 | Bacteria | 915 |
| 236 | Ga0105248_10014539 | 3300009177 | Bacteria | 8663 |
| 237 | Ga0105248_10016388 | 3300009177 | Bacteria | 8156 |
| 238 | Ga0105248_10027828 | 3300009177 | Bacteria | 6294 |
| 239 | Ga0105248_10177001 | 3300009177 | Bacteria | 2404 |
| 240 | Ga0105248_12625132 | 3300009177 | Bacteria | 574 |
| 241 | Ga0105237_10005565 | 3300009545 | Bacteria | 14206 |
| 242 | Ga0105237_10168447 | 3300009545 | Bacteria | 2190 |
| 243 | Ga0105237_10414322 | 3300009545 | Bacteria | 1352 |
| 244 | Ga0105238_10093100 | 3300009551 | Bacteria | 3002 |
| 245 | Ga0105238_10320379 | 3300009551 | Bacteria | 1536 |
| 246 | Ga0105238_10515638 | 3300009551 | Bacteria | 1198 |
| 247 | Ga0105238_11642875 | 3300009551 | Bacteria | 673 |
| 248 | Ga0105249_10355110 | 3300009553 | Bacteria | 1486 |
| 249 | Ga0105249_10378634 | 3300009553 | Bacteria | 1441 |
| 250 | Ga0105239_10004408 | 3300010375 | Bacteria | 16853 |
| 251 | Ga0105246_10018879 | 3300011119 | Bacteria | 4397 |
| 252 | Ga0105246_10310978 | 3300011119 | Bacteria | 1276 |
| 253 | Ga0105246_11397793 | 3300011119 | Bacteria | 653 |
| 254 | Ga0157371_10249588 | 3300013102 | Bacteria | 1277 |
| 255 | Ga0157370_10739994 | 3300013104 | Bacteria | 896 |
| 256 | Ga0157370_10864992 | 3300013104 | Bacteria | 821 |
| 257 | Ga0157369_10375380 | 3300013105 | Bacteria | 1476 |
| 258 | Ga0157369_10597261 | 3300013105 | Bacteria | 1139 |
| 259 | Ga0157374_10047682 | 3300013296 | Bacteria | 3973 |
| 260 | Ga0157374_10052951 | 3300013296 | Bacteria | 3782 |
| 261 | Ga0157374_10645124 | 3300013296 | Bacteria | 1070 |
| 262 | Ga0157378_10002889 | 3300013297 | Bacteria | 15295 |
| 263 | Ga0157378_10030416 | 3300013297 | Bacteria | 4771 |
| 264 | Ga0157378_10978990 | 3300013297 | Bacteria | 879 |
| 265 | Ga0163162_10002808 | 3300013306 | Bacteria | 16565 |
| 266 | Ga0163162_10120757 | 3300013306 | Bacteria | 2725 |
| 267 | Ga0163162_10210930 | 3300013306 | Bacteria | 2072 |
| 268 | Ga0163162_10630926 | 3300013306 | Bacteria | 1196 |
| 269 | Ga0163162_11750459 | 3300013306 | Bacteria | 710 |
| 270 | Ga0157372_10090951 | 3300013307 | Bacteria | 3470 |
| 271 | Ga0157372_10303835 | 3300013307 | Bacteria | 1856 |
| 272 | Ga0157372_10610941 | 3300013307 | Bacteria | 1271 |
| 273 | Ga0157372_11187422 | 3300013307 | Bacteria | 882 |
| 274 | Ga0157375_10001551 | 3300013308 | Bacteria | 19772 |
| 275 | Ga0157375_10228743 | 3300013308 | Bacteria | 2018 |
| 276 | Ga0157375_10303332 | 3300013308 | Bacteria | 1761 |
| 277 | Ga0157375_10337393 | 3300013308 | Bacteria | 1673 |
| 278 | Ga0157375_10470027 | 3300013308 | Bacteria | 1423 |
| 279 | Ga0157375_11573654 | 3300013308 | Bacteria | 777 |
| 280 | Ga0163163_10329677 | 3300014325 | Bacteria | 1581 |
| 281 | Ga0163163_11921292 | 3300014325 | Bacteria | 652 |
| 282 | Ga0157380_10000136 | 3300014326 | Bacteria | 41118 |
| 283 | Ga0157380_10023621 | 3300014326 | Bacteria | 4641 |
| 284 | Ga0157380_10542956 | 3300014326 | Bacteria | 1139 |
| 285 | Ga0157377_10019708 | 3300014745 | Bacteria | 3527 |
| 286 | Ga0157377_10021065 | 3300014745 | Bacteria | 3424 |
| 287 | Ga0157377_10051551 | 3300014745 | Bacteria | 2321 |
| 288 | Ga0157379_10002115 | 3300014968 | Bacteria | 16461 |
| 289 | Ga0157379_10181559 | 3300014968 | Bacteria | 1901 |
| 290 | Ga0157379_10967930 | 3300014968 | Bacteria | 810 |
| 291 | Ga0157376_10039949 | 3300014969 | Bacteria | 3831 |
| 292 | Ga0157376_10171043 | 3300014969 | Bacteria | 1979 |
| 293 | Ga0157376_10355796 | 3300014969 | Bacteria | 1403 |
| 294 | Ga0163161_10012707 | 3300017792 | Bacteria | 5848 |
| 295 | Ga0163161_10338074 | 3300017792 | Bacteria | 1194 |
| 296 | Ga0163161_10360074 | 3300017792 | Bacteria | 1158 |
| 297 | Ga0163161_11163407 | 3300017792 | Bacteria | 665 |
| 298 | Ga0197907_10831311 | 3300020069 | Bacteria | 1987 |
| 299 | Ga0206356_10184193 | 3300020070 | Bacteria | 2400 |
| 300 | Ga0206356_10309572 | 3300020070 | Bacteria | 2818 |
| 301 | Ga0206356_11613575 | 3300020070 | Bacteria | 831 |
| 302 | Ga0206349_1889663 | 3300020075 | Bacteria | 1114 |
| 303 | Ga0206355_1246002 | 3300020076 | Bacteria | 2492 |
| 304 | Ga0206355_1653515 | 3300020076 | Bacteria | 1593 |
| 305 | Ga0206351_10992062 | 3300020077 | Bacteria | 814 |
| 306 | Ga0206352_10290768 | 3300020078 | Bacteria | 983 |
| 307 | Ga0206352_11145297 | 3300020078 | Bacteria | 2584 |
| 308 | Ga0206354_11208453 | 3300020081 | Bacteria | 1806 |
| 309 | Ga0206353_11504654 | 3300020082 | Bacteria | 966 |
| 310 | Ga0206353_11544153 | 3300020082 | Bacteria | 1990 |
| 311 | Ga0224712_10004343 | 3300022467 | Bacteria | 3812 |
| 312 | Ga0207426_1009534 | 3300025302 | Bacteria | 3832 |
| 313 | Ga0207653_10028622 | 3300025885 | Bacteria | 1793 |
| 314 | Ga0207692_10018628 | 3300025898 | Bacteria | 3120 |
| 315 | Ga0207692_10027995 | 3300025898 | Bacteria | 2660 |
| 316 | Ga0207692_10345997 | 3300025898 | Bacteria | 915 |
| 317 | Ga0207642_10000178 | 3300025899 | Bacteria | 18339 |
| 318 | Ga0207642_10049043 | 3300025899 | Bacteria | 1896 |
| 319 | Ga0207642_10067860 | 3300025899 | Bacteria | 1685 |
| 320 | Ga0207642_10306547 | 3300025899 | Bacteria | 922 |
| 321 | Ga0207710_10011878 | 3300025900 | Bacteria | 3664 |
| 322 | Ga0207710_10309640 | 3300025900 | Bacteria | 799 |
| 323 | Ga0207710_10459625 | 3300025900 | Bacteria | 658 |
| 324 | Ga0207710_10594830 | 3300025900 | Bacteria | 578 |
| 325 | Ga0207688_10002022 | 3300025901 | Bacteria | 10880 |
| 326 | Ga0207688_10004903 | 3300025901 | Bacteria | 7285 |
| 327 | Ga0207688_10007863 | 3300025901 | Bacteria | 5803 |
| 328 | Ga0207688_10335108 | 3300025901 | Bacteria | 930 |
| 329 | Ga0207680_10007555 | 3300025903 | Bacteria | 5308 |
| 330 | Ga0207647_10008739 | 3300025904 | Bacteria | 7232 |
| 331 | Ga0207647_10034190 | 3300025904 | Bacteria | 3248 |
| 332 | Ga0207647_10060164 | 3300025904 | Bacteria | 2322 |
| 333 | Ga0207647_10075426 | 3300025904 | Bacteria | 2030 |
| 334 | Ga0207685_10028489 | 3300025905 | Bacteria | 1968 |
| 335 | Ga0207699_10057278 | 3300025906 | Bacteria | 2326 |
| 336 | Ga0207645_10010732 | 3300025907 | Bacteria | 6280 |
| 337 | Ga0207645_10653094 | 3300025907 | Bacteria | 715 |
| 338 | Ga0207643_10185680 | 3300025908 | Bacteria | 1260 |
| 339 | Ga0207654_10159947 | 3300025911 | Bacteria | 1454 |
| 340 | Ga0207707_11068289 | 3300025912 | Bacteria | 659 |
| 341 | Ga0207671_10056867 | 3300025914 | Bacteria | 2899 |
| 342 | Ga0207671_10234171 | 3300025914 | Bacteria | 1441 |
| 343 | Ga0207693_10000507 | 3300025915 | Bacteria | 35136 |
| 344 | Ga0207693_10004862 | 3300025915 | Bacteria | 11307 |
| 345 | Ga0207693_10006779 | 3300025915 | Bacteria | 9457 |
| 346 | Ga0207663_10006272 | 3300025916 | Bacteria | 6068 |
| 347 | Ga0207663_10045140 | 3300025916 | Bacteria | 2709 |
| 348 | Ga0207663_10051804 | 3300025916 | Bacteria | 2558 |
| 349 | Ga0207660_10374424 | 3300025917 | Bacteria | 1144 |
| 350 | Ga0207660_10384185 | 3300025917 | Bacteria | 1129 |
| 351 | Ga0207660_10676576 | 3300025917 | Bacteria | 842 |
| 352 | Ga0207662_10015986 | 3300025918 | Bacteria | 4230 |
| 353 | Ga0207662_10314910 | 3300025918 | Bacteria | 1043 |
| 354 | Ga0207657_10206611 | 3300025919 | Bacteria | 1577 |
| 355 | Ga0207652_10188672 | 3300025921 | Bacteria | 1854 |
| 356 | Ga0207652_11096743 | 3300025921 | Bacteria | 696 |
| 357 | Ga0207681_10032097 | 3300025923 | Bacteria | 3437 |
| 358 | Ga0207681_10039095 | 3300025923 | Bacteria | 3147 |
| 359 | Ga0207681_10140195 | 3300025923 | Bacteria | 1800 |
| 360 | Ga0207681_10443862 | 3300025923 | Bacteria | 1055 |
| 361 | Ga0207694_10548643 | 3300025924 | Bacteria | 970 |
| 362 | Ga0207650_11108999 | 3300025925 | Bacteria | 673 |
| 363 | Ga0207659_11420819 | 3300025926 | Bacteria | 594 |
| 364 | Ga0207687_10003137 | 3300025927 | Bacteria | 11208 |
| 365 | Ga0207687_10054043 | 3300025927 | Bacteria | 2808 |
| 366 | Ga0207687_10200706 | 3300025927 | Bacteria | 1559 |
| 367 | Ga0207687_11324535 | 3300025927 | Bacteria | 619 |
| 368 | Ga0207700_10274240 | 3300025928 | Bacteria | 1449 |
| 369 | Ga0207700_11046575 | 3300025928 | Bacteria | 730 |
| 370 | Ga0207664_10137255 | 3300025929 | Bacteria | 2065 |
| 371 | Ga0207664_10533673 | 3300025929 | Bacteria | 1052 |
| 372 | Ga0207644_10031815 | 3300025931 | Bacteria | 3678 |
| 373 | Ga0207690_10034702 | 3300025932 | Bacteria | 3252 |
| 374 | Ga0207690_10161856 | 3300025932 | Bacteria | 1669 |
| 375 | Ga0207706_10001533 | 3300025933 | Bacteria | 22933 |
| 376 | Ga0207706_10012019 | 3300025933 | Bacteria | 7886 |
| 377 | Ga0207706_10014036 | 3300025933 | Bacteria | 7265 |
| 378 | Ga0207706_10026774 | 3300025933 | Bacteria | 5161 |
| 379 | Ga0207706_10372102 | 3300025933 | Bacteria | 1241 |
| 380 | Ga0207686_10001322 | 3300025934 | Bacteria | 14150 |
| 381 | Ga0207686_10078273 | 3300025934 | Bacteria | 2150 |
| 382 | Ga0207686_10086228 | 3300025934 | Bacteria | 2062 |
| 383 | Ga0207709_10003151 | 3300025935 | Bacteria | 9912 |
| 384 | Ga0207709_10071722 | 3300025935 | Bacteria | 2201 |
| 385 | Ga0207670_10005363 | 3300025936 | Bacteria | 7032 |
| 386 | Ga0207670_10254533 | 3300025936 | Bacteria | 1358 |
| 387 | Ga0207670_10569550 | 3300025936 | Bacteria | 927 |
| 388 | Ga0207669_10002448 | 3300025937 | Bacteria | 7918 |
| 389 | Ga0207669_10010783 | 3300025937 | Bacteria | 4416 |
| 390 | Ga0207669_10027073 | 3300025937 | Bacteria | 3131 |
| 391 | Ga0207669_10250046 | 3300025937 | Bacteria | 1319 |
| 392 | Ga0207669_10257420 | 3300025937 | Bacteria | 1303 |
| 393 | Ga0207704_10000458 | 3300025938 | Bacteria | 18202 |
| 394 | Ga0207704_10138481 | 3300025938 | Bacteria | 1698 |
| 395 | Ga0207704_10165215 | 3300025938 | Bacteria | 1580 |
| 396 | Ga0207704_10355392 | 3300025938 | Bacteria | 1142 |
| 397 | Ga0207665_10001870 | 3300025939 | Bacteria | 14190 |
| 398 | Ga0207665_10006046 | 3300025939 | Bacteria | 8044 |
| 399 | Ga0207665_10031079 | 3300025939 | Bacteria | 3531 |
| 400 | Ga0207691_10041110 | 3300025940 | Bacteria | 4270 |
| 401 | Ga0207691_10142949 | 3300025940 | Bacteria | 2107 |
| 402 | Ga0207711_10023282 | 3300025941 | Bacteria | 5184 |
| 403 | Ga0207711_10108648 | 3300025941 | Bacteria | 2464 |
| 404 | Ga0207711_10556727 | 3300025941 | Bacteria | 1070 |
| 405 | Ga0207711_10691785 | 3300025941 | Bacteria | 951 |
| 406 | Ga0207689_10012131 | 3300025942 | Bacteria | 7375 |
| 407 | Ga0207689_10012362 | 3300025942 | Bacteria | 7302 |
| 408 | Ga0207689_10534632 | 3300025942 | Bacteria | 984 |
| 409 | Ga0207661_10747266 | 3300025944 | Bacteria | 900 |
| 410 | Ga0207667_10156712 | 3300025949 | Bacteria | 2343 |
| 411 | Ga0207667_10596152 | 3300025949 | Bacteria | 1114 |
| 412 | Ga0207667_10832049 | 3300025949 | Bacteria | 918 |
| 413 | Ga0207651_10362039 | 3300025960 | Bacteria | 1224 |
| 414 | Ga0207651_10992737 | 3300025960 | Bacteria | 750 |
| 415 | Ga0207712_10005323 | 3300025961 | Bacteria | 8124 |
| 416 | Ga0207712_10131269 | 3300025961 | Bacteria | 1909 |
| 417 | Ga0207712_10259405 | 3300025961 | Bacteria | 1409 |
| 418 | Ga0207668_10001538 | 3300025972 | Bacteria | 13494 |
| 419 | Ga0207668_10111361 | 3300025972 | Bacteria | 2055 |
| 420 | Ga0207668_10134239 | 3300025972 | Bacteria | 1894 |
| 421 | Ga0207668_10188472 | 3300025972 | Bacteria | 1632 |
| 422 | Ga0207668_10553031 | 3300025972 | Bacteria | 997 |
| 423 | Ga0207640_10000827 | 3300025981 | Bacteria | 17626 |
| 424 | Ga0207640_10116261 | 3300025981 | Bacteria | 1906 |
| 425 | Ga0207640_10264466 | 3300025981 | Bacteria | 1342 |
| 426 | Ga0207658_10018537 | 3300025986 | Bacteria | 4807 |
| 427 | Ga0207658_10312260 | 3300025986 | Bacteria | 1358 |
| 428 | Ga0207658_10751297 | 3300025986 | Bacteria | 883 |
| 429 | Ga0207677_10018504 | 3300026023 | Bacteria | 4182 |
| 430 | Ga0207677_10075635 | 3300026023 | Bacteria | 2394 |
| 431 | Ga0207677_10384001 | 3300026023 | Bacteria | 1186 |
| 432 | Ga0207703_10000920 | 3300026035 | Bacteria | 28669 |
| 433 | Ga0207703_10055283 | 3300026035 | Bacteria | 3229 |
| 434 | Ga0207703_10464993 | 3300026035 | Bacteria | 1183 |
| 435 | Ga0207678_10003253 | 3300026067 | Bacteria | 14661 |
| 436 | Ga0207678_10024038 | 3300026067 | Bacteria | 5325 |
| 437 | Ga0207678_10358757 | 3300026067 | Bacteria | 1258 |
| 438 | Ga0207678_10407898 | 3300026067 | Bacteria | 1177 |
| 439 | Ga0207708_10024290 | 3300026075 | Bacteria | 4584 |
| 440 | Ga0207708_10063951 | 3300026075 | Bacteria | 2811 |
| 441 | Ga0207708_10091736 | 3300026075 | Bacteria | 2343 |
| 442 | Ga0207702_10420643 | 3300026078 | Bacteria | 1292 |
| 443 | Ga0207702_10852773 | 3300026078 | Bacteria | 902 |
| 444 | Ga0207641_10297562 | 3300026088 | Bacteria | 1523 |
| 445 | Ga0207641_10451556 | 3300026088 | Bacteria | 1242 |
| 446 | Ga0207648_10000929 | 3300026089 | Bacteria | 33018 |
| 447 | Ga0207648_10033327 | 3300026089 | Bacteria | 4543 |
| 448 | Ga0207648_10120299 | 3300026089 | Bacteria | 2309 |
| 449 | Ga0207676_10432246 | 3300026095 | Bacteria | 1237 |
| 450 | Ga0207676_10551392 | 3300026095 | Bacteria | 1101 |
| 451 | Ga0207674_10017599 | 3300026116 | Bacteria | 7795 |
| 452 | Ga0207675_100000544 | 3300026118 | Bacteria | 36830 |
| 453 | Ga0207675_100041890 | 3300026118 | Bacteria | 4276 |
| 454 | Ga0207675_100497880 | 3300026118 | Bacteria | 1213 |
| 455 | Ga0207675_100723494 | 3300026118 | Bacteria | 1005 |
| 456 | Ga0207683_10000335 | 3300026121 | Bacteria | 42789 |
| 457 | Ga0207683_10013403 | 3300026121 | Bacteria | 6991 |
| 458 | Ga0207683_10180226 | 3300026121 | Bacteria | 1915 |
| 459 | Ga0207683_11145132 | 3300026121 | Bacteria | 721 |
| 460 | Ga0207698_10073687 | 3300026142 | Bacteria | 2720 |
| 461 | Ga0207698_10148975 | 3300026142 | Bacteria | 2028 |
| 462 | Ga0207698_10350143 | 3300026142 | Bacteria | 1395 |
| 463 | Ga0207698_10633796 | 3300026142 | Bacteria | 1057 |
| 464 | Ga0207428_10006323 | 3300027907 | Bacteria | 10951 |
| 465 | Ga0207428_10219838 | 3300027907 | Bacteria | 1424 |
| 466 | Ga0207428_10379496 | 3300027907 | Bacteria | 1037 |
| 467 | Ga0268266_10673515 | 3300028379 | Bacteria | 996 |
| 468 | Ga0268265_10236677 | 3300028380 | Bacteria | 1608 |
| 469 | Ga0268265_10310037 | 3300028380 | Bacteria | 1425 |
| 470 | Ga0268265_10379022 | 3300028380 | Bacteria | 1300 |
| 471 | Ga0268264_10001041 | 3300028381 | Bacteria | 27858 |
| 472 | Ga0268264_10443187 | 3300028381 | Bacteria | 1257 |
| 473 | Ga0268264_10586425 | 3300028381 | Bacteria | 1097 |
| 474 | Ga0268264_10684798 | 3300028381 | Bacteria | 1017 |
| 475 | Ga0307511_10001365 | 3300030521 | Bacteria | 25829 |
| 476 | Ga0314311_1002826 | 3300030733 | Bacteria | 1023 |
| 477 | Ga0307513_10000684 | 3300031456 | Bacteria | 48768 |
| 478 | Ga0307408_100058841 | 3300031548 | Bacteria | 2795 |
| 479 | Ga0307408_100380303 | 3300031548 | Bacteria | 1207 |
| 480 | Ga0307408_101807763 | 3300031548 | Bacteria | 584 |
| 481 | Ga0307405_10458926 | 3300031731 | Bacteria | 1012 |
| 482 | Ga0307413_10064012 | 3300031824 | Bacteria | 2283 |
| 483 | Ga0307413_10329929 | 3300031824 | Bacteria | 1169 |
| 484 | Ga0307518_10000028 | 3300031838 | Bacteria | 98010 |
| 485 | Ga0307410_10070078 | 3300031852 | Bacteria | 2427 |
| 486 | Ga0307410_10093619 | 3300031852 | Bacteria | 2138 |
| 487 | Ga0307410_10101609 | 3300031852 | Bacteria | 2062 |
| 488 | Ga0307406_10079533 | 3300031901 | Bacteria | 2174 |
| 489 | Ga0307406_10716839 | 3300031901 | Bacteria | 837 |
| 490 | Ga0307407_10002834 | 3300031903 | Bacteria | 6929 |
| 491 | Ga0307407_10148401 | 3300031903 | Bacteria | 1521 |
| 492 | Ga0307407_10228782 | 3300031903 | Bacteria | 1262 |
| 493 | Ga0307409_100042297 | 3300031995 | Bacteria | 3411 |
| 494 | Ga0307409_100114582 | 3300031995 | Bacteria | 2268 |
| 495 | Ga0307409_100122689 | 3300031995 | Bacteria | 2204 |
| 496 | Ga0307409_100356020 | 3300031995 | Bacteria | 1383 |
| 497 | Ga0307409_100418559 | 3300031995 | Bacteria | 1285 |
| 498 | Ga0307409_100453166 | 3300031995 | Bacteria | 1239 |
| 499 | Ga0307409_100528314 | 3300031995 | Bacteria | 1154 |
| 500 | Ga0307416_100150513 | 3300032002 | Bacteria | 2133 |
| 501 | Ga0307416_101509024 | 3300032002 | Bacteria | 778 |
| 502 | Ga0307414_10588819 | 3300032004 | Bacteria | 996 |
| 503 | Ga0307415_100230900 | 3300032126 | Bacteria | 1490 |
| 504 | Ga0307415_101428380 | 3300032126 | Bacteria | 660 |
| 505 | Ga0373958_0065009 | 3300034819 | Bacteria | 798 |
| 506 | Ga0373959_0067870 | 3300034820 | Bacteria | 801 |
| 507 | Ga0373951_0201422 | 3300035091 | Bacteria | 580 |
| 508 | Ga0373932_0021433 | 3300035112 | Bacteria | 1706 |
| 509 | Ga0373960_0051766 | 3300035121 | Bacteria | 1221 |
| 510 | Ga0373942_0108728 | 3300035207 | Bacteria | 855 |
| 511 | Ga0373961_0034242 | 3300035241 | Bacteria | 1435 |
| 512 | Ga0373931_0036791 | 3300035691 | Bacteria | 2553 |
| 513 | Ga0373931_0126691 | 3300035691 | Bacteria | 1465 |
| 514 | Ga0373931_0300983 | 3300035691 | Bacteria | 990 |
| 515 | Ga0395900_0117571 | 3300037418 | Bacteria | 2728 |
| 516 | Ga0395900_0450194 | 3300037418 | Bacteria | 1244 |
| 517 | Ga0395898_0334390 | 3300037466 | Bacteria | 1444 |
| 518 | Ga0436364_0139643 | 3300037853 | Bacteria | 10617 |
| 519 | Ga0395901_0069819 | 3300038443 | Bacteria | 3659 |
| 520 | Ga0439436_0007353 | 3300041404 | Bacteria | 3390 |
| 521 | Ga0439438_027619 | 3300041405 | Bacteria | 1531 |
| 522 | Ga0439439_0014801 | 3300041406 | Bacteria | 1901 |
| 523 | Ga0439466_0014804 | 3300041411 | Bacteria | 2837 |
| 524 | Ga0439466_0205833 | 3300041411 | Bacteria | 598 |
| 525 | Ga0439465_0026887 | 3300041413 | Bacteria | 1821 |
| 526 | Ga0451789_0783324 | 3300041443 | Bacteria | 1510 |
| 527 | Ga0451793_0320317 | 3300041452 | Bacteria | 2384 |
| 528 | Ga0451797_0745449 | 3300041453 | Bacteria | 1398 |
| 529 | Ga0451797_1178160 | 3300041453 | Bacteria | 1009 |
| 530 | Ga0451795_0224208 | 3300041456 | Bacteria | 1550 |
| 531 | Ga0451802_0591086 | 3300041460 | Bacteria | 751 |
| 532 | Ga0451806_806050 | 3300041462 | Bacteria | 1451 |
| 533 | Ga0451804_0721298 | 3300041463 | Bacteria | 726 |
| 534 | Ga0451841_0419520 | 3300041498 | Bacteria | 595 |
| 535 | Ga0451845_0365457 | 3300041501 | Bacteria | 1337 |
| 536 | Ga0451853_0649725 | 3300041512 | Bacteria | 729 |
| 537 | Ga0439433_0001119 | 3300041999 | Bacteria | 5477 |
| 538 | Ga0439442_000790 | 3300042002 | Bacteria | 6582 |
| 539 | Ga0439448_0027472 | 3300042005 | Bacteria | 1794 |
| 540 | Ga0439449_0001002 | 3300042007 | Bacteria | 11117 |
| 541 | Ga0439452_030960 | 3300042010 | Bacteria | 1316 |
| 542 | Ga0439457_005622 | 3300042014 | Bacteria | 3132 |
| 543 | Ga0439462_0007839 | 3300042015 | Bacteria | 2680 |
| 544 | Ga0439463_051944 | 3300042016 | Bacteria | 1046 |
| 545 | Ga0439446_0013747 | 3300042156 | Bacteria | 2226 |
| 546 | Ga0439434_0020631 | 3300042435 | Bacteria | 1979 |
| 547 | Ga0439434_0031878 | 3300042435 | Bacteria | 1603 |
| 548 | Ga0439459_0042308 | 3300042438 | Bacteria | 973 |
| 549 | Ga0439464_0082322 | 3300042439 | Bacteria | 963 |
| 550 | Ga0466969_0043728 | 3300044656 | Bacteria | 2231 |
| 551 | Ga0466972_0022428 | 3300044658 | Bacteria | 3145 |
| 552 | Ga0466965_0380622 | 3300044683 | Bacteria | 777 |
| 553 | Ga0466966_0009336 | 3300044684 | Bacteria | 6496 |
| 554 | Ga0466966_0048045 | 3300044684 | Bacteria | 2719 |
| 555 | Ga0466961_0025109 | 3300044693 | Bacteria | 3835 |
| 556 | Ga0466963_0014835 | 3300044694 | Bacteria | 4812 |
| 557 | Ga0466971_0008198 | 3300044719 | Bacteria | 4556 |
| 558 | Ga0466971_0043951 | 3300044719 | Bacteria | 2007 |
| 559 | Ga0466970_0007129 | 3300044765 | Bacteria | 5596 |
| 560 | Ga0466970_0012159 | 3300044765 | Bacteria | 4396 |
| 561 | Ga0466970_0019982 | 3300044765 | Bacteria | 3477 |
| 562 | Ga0466957_0107245 | 3300044842 | Bacteria | 1768 |
| 563 | Ga0466957_0334522 | 3300044842 | Bacteria | 1024 |
| 564 | Ga0466960_0001756 | 3300044901 | Bacteria | 7961 |
| 565 | Ga0466960_0394323 | 3300044901 | Bacteria | 796 |
| 566 | Ga0466959_0032739 | 3300045049 | Bacteria | 3848 |
| 567 | Ga0466959_0080005 | 3300045049 | Bacteria | 2356 |
| 568 | Ga0466959_0113302 | 3300045049 | Bacteria | 1934 |
| 569 | Ga0466958_0101292 | 3300045836 | Bacteria | 1791 |
| 570 | Ga0466958_0153823 | 3300045836 | Bacteria | 1451 |
| 571 | Ga0466958_0711955 | 3300045836 | Bacteria | 654 |
| 572 | Ga0466967_0003341 | 3300045976 | Bacteria | 10433 |
| 573 | Ga0466967_0115293 | 3300045976 | Bacteria | 2474 |
| 574 | Ga0495627_134968 | 3300046453 | Bacteria | 693 |
| 575 | Ga0495603_0084998 | 3300046455 | Bacteria | 1852 |
| 576 | Ga0495638_0021571 | 3300046460 | Bacteria | 4242 |
| 577 | Ga0495650_0056992 | 3300046471 | Bacteria | 1583 |
| 578 | Ga0495664_0092530 | 3300046477 | Bacteria | 1819 |
| 579 | Ga0495585_0111285 | 3300046492 | Bacteria | 1456 |
| 580 | Ga0495585_0265819 | 3300046492 | Bacteria | 852 |
| 581 | Ga0495594_0044020 | 3300046499 | Bacteria | 2448 |
| 582 | Ga0495608_0174282 | 3300046511 | Bacteria | 1363 |
| 583 | Ga0495631_0308848 | 3300046518 | Bacteria | 673 |
| 584 | Ga0495654_0000140 | 3300046530 | Bacteria | 75508 |
| 585 | Ga0495587_0534783 | 3300046536 | Bacteria | 647 |
| 586 | Ga0495622_0256308 | 3300046557 | Bacteria | 769 |
| 587 | Ga0495656_0052761 | 3300046615 | Bacteria | 1744 |
| 588 | Ga0495669_0164467 | 3300046684 | Bacteria | 1054 |
| 589 | Ga0495613_0274905 | 3300046689 | Bacteria | 1171 |
| 590 | Ga0495613_0308785 | 3300046689 | Bacteria | 1094 |
| 591 | Ga0495624_0276047 | 3300046690 | Bacteria | 1015 |
| 592 | Ga0495624_0396558 | 3300046690 | Bacteria | 829 |
| 593 | Ga0495670_0057578 | 3300046691 | Bacteria | 1951 |
| 594 | Ga0495670_0087786 | 3300046691 | Bacteria | 1589 |
| 595 | Ga0495589_0011210 | 3300046794 | Bacteria | 4652 |
| 596 | Ga0495589_0209124 | 3300046794 | Bacteria | 919 |
| 597 | Ga0495600_0329958 | 3300046809 | Bacteria | 958 |
| 598 | Ga0495636_0001755 | 3300047318 | Bacteria | 8263 |
| 599 | Ga0495636_0072739 | 3300047318 | Bacteria | 1470 |
| 600 | Ga0495676_0017481 | 3300047321 | Bacteria | 6339 |
| 601 | Ga0495676_0264355 | 3300047321 | Bacteria | 1169 |
| 602 | Ga0495680_0708361 | 3300047322 | Bacteria | 664 |
| 603 | Ga0495687_003383 | 3300047443 | Bacteria | 11627 |
| 604 | Ga0495685_001492 | 3300047447 | Bacteria | 7162 |
| 605 | Ga0495686_0003364 | 3300047472 | Bacteria | 13933 |
| 606 | Ga0495686_0521345 | 3300047472 | Bacteria | 624 |
| 607 | Ga0495593_0099908 | 3300047673 | Bacteria | 1489 |
| 608 | Ga0496100_0000383 | 3300048903 | Bacteria | 21527 |
| 609 | Ga0496100_0004863 | 3300048903 | Bacteria | 7176 |
| 610 | Ga0496100_0184615 | 3300048903 | Bacteria | 1510 |
| 611 | Ga0496101_0000593 | 3300048904 | Bacteria | 22016 |
| 612 | Ga0496101_0011857 | 3300048904 | Bacteria | 5801 |
| 613 | Ga0496101_0126305 | 3300048904 | Bacteria | 1938 |
| 614 | Ga0496102_0004668 | 3300048905 | Bacteria | 11588 |
| 615 | Ga0496102_0084290 | 3300048905 | Bacteria | 2933 |
| 616 | Ga0496102_0205197 | 3300048905 | Bacteria | 1858 |
| 617 | Ga0496102_0415120 | 3300048905 | Bacteria | 1264 |
| 618 | Ga0496102_0457661 | 3300048905 | Bacteria | 1197 |
| 619 | Ga0496102_1244908 | 3300048905 | Bacteria | 663 |
| 620 | Ga0496103_0002854 | 3300048906 | Bacteria | 10742 |
| 621 | Ga0496103_0054366 | 3300048906 | Bacteria | 2482 |
| 622 | Ga0496103_0054478 | 3300048906 | Bacteria | 2479 |
| 623 | Ga0496104_0006811 | 3300048907 | Bacteria | 10067 |
| 624 | Ga0496104_0018259 | 3300048907 | Bacteria | 6399 |
| 625 | Ga0496104_0193330 | 3300048907 | Bacteria | 1947 |
| 626 | Ga0496104_0392167 | 3300048907 | Bacteria | 1301 |
| 627 | Ga0496106_0000615 | 3300048909 | Bacteria | 25459 |
| 628 | Ga0496106_0039922 | 3300048909 | Bacteria | 3514 |
| 629 | Ga0496106_0102409 | 3300048909 | Bacteria | 2221 |
| 630 | Ga0496106_0365916 | 3300048909 | Bacteria | 1158 |
| 631 | Ga0496107_0001171 | 3300048910 | Bacteria | 15903 |
| 632 | Ga0496107_0027686 | 3300048910 | Bacteria | 4025 |
| 633 | Ga0496107_0186574 | 3300048910 | Bacteria | 1540 |
| 634 | Ga0496107_0255911 | 3300048910 | Bacteria | 1303 |
| 635 | Ga0496107_0330251 | 3300048910 | Bacteria | 1135 |
| 636 | Ga0496108_0004415 | 3300048911 | Bacteria | 11319 |
| 637 | Ga0496108_0012219 | 3300048911 | Bacteria | 6986 |
| 638 | Ga0496108_0135328 | 3300048911 | Bacteria | 2120 |
| 639 | Ga0496108_0601994 | 3300048911 | Bacteria | 958 |
| 640 | Ga0496109_0028038 | 3300048912 | Bacteria | 5033 |
| 641 | Ga0496109_0129519 | 3300048912 | Bacteria | 2354 |
| 642 | Ga0496109_0460088 | 3300048912 | Bacteria | 1201 |
| 643 | Ga0496110_0088759 | 3300048913 | Bacteria | 2762 |
| 644 | Ga0496110_0092534 | 3300048913 | Bacteria | 2706 |
| 645 | Ga0496110_0722379 | 3300048913 | Bacteria | 898 |
| 646 | Ga0496111_0368990 | 3300048914 | Bacteria | 1062 |
| 647 | Ga0496111_0529616 | 3300048914 | Bacteria | 866 |
| 648 | Ga0496113_0408736 | 3300048916 | Bacteria | 1090 |
| 649 | Ga0496114_0000517 | 3300048917 | Bacteria | 28403 |
| 650 | Ga0496114_0040677 | 3300048917 | Bacteria | 3849 |
| 651 | Ga0496114_0426964 | 3300048917 | Bacteria | 1174 |
| 652 | Ga0496115_0008256 | 3300048918 | Bacteria | 7695 |
| 653 | Ga0496115_0053453 | 3300048918 | Bacteria | 3241 |
| 654 | Ga0496115_0118950 | 3300048918 | Bacteria | 2173 |
| 655 | Ga0496115_1089090 | 3300048918 | Bacteria | 606 |
| 656 | Ga0496119_0015035 | 3300048922 | Bacteria | 5996 |
| 657 | Ga0501041_0098351 | 3300049577 | Bacteria | 1810 |
| 658 | Ga0501042_0223871 | 3300049578 | Bacteria | 1357 |
| 659 | Ga0501075_0580022 | 3300049591 | Bacteria | 856 |
| 660 | Ga0501076_0623511 | 3300049592 | Bacteria | 890 |
| 661 | Ga0501045_0334080 | 3300049824 | Bacteria | 1128 |
| 662 | nmdc:mga0yw44_136577_c1 | 3300050492 | Bacteria | 1591 |
| 663 | nmdc:mga05p37_151291_c1 | 3300050507 | Bacteria | 1372 |
| 664 | nmdc:mga0qj67_232358_c1 | 3300050509 | Bacteria | 1496 |
| 665 | nmdc:mga0qj67_475227_c1 | 3300050509 | Bacteria | 1006 |
| 666 | nmdc:mga08y16_1306930_c1 | 3300050511 | Bacteria | 692 |
| 667 | nmdc:mga08y16_338710_c1 | 3300050511 | Bacteria | 1546 |
| 668 | nmdc:mga08y16_933665_c1 | 3300050511 | Bacteria | 852 |
| 669 | nmdc:mga0rr50_591096_c1 | 3300050513 | Bacteria | 946 |
| 670 | Ga0495655_0230238 | 3300053083 | Bacteria | 617 |
| 671 | Ga0495595_0409082 | 3300053084 | Bacteria | 688 |
| 672 | Ga0500660_099896 | 3300053100 | Bacteria | 1269 |
| 673 | Ga0500556_0000472 | 3300053104 | Bacteria | 28259 |
| 674 | Ga0500560_000103 | 3300053107 | Bacteria | 8711 |
| 675 | Ga0500562_015745 | 3300053108 | Bacteria | 1941 |
| 676 | Ga0500593_003899 | 3300053117 | Bacteria | 5721 |
| 677 | Ga0500628_136542 | 3300053129 | Bacteria | 677 |
| 678 | Ga0500655_002692 | 3300053133 | Bacteria | 3219 |
| 679 | Ga0500559_0019671 | 3300053136 | Bacteria | 2853 |
| 680 | Ga0500573_0227834 | 3300053140 | Bacteria | 973 |
| 681 | Ga0500616_0000027 | 3300053153 | Bacteria | 441053 |
| 682 | Ga0500620_115434 | 3300053155 | Bacteria | 940 |
| 683 | Ga0500645_004203 | 3300053730 | Bacteria | 5602 |
| 684 | Ga0587093_053513 | 3300059478 | Bacteria | 643 |
| 685 | Ga0587066_012376 | 3300059490 | Bacteria | 1272 |
| 686 | Ga0587070_035744 | 3300059491 | Bacteria | 926 |
| 687 | Ga0587070_050901 | 3300059491 | Bacteria | 827 |
| 688 | Ga0587077_082409 | 3300059493 | Bacteria | 741 |
| 689 | Ga0587080_032628 | 3300059503 | Bacteria | 915 |
| 690 | Ga0587080_060492 | 3300059503 | Bacteria | 737 |
| 691 | Ga0587082_016022 | 3300059504 | Bacteria | 1165 |
| 692 | Ga0587082_029850 | 3300059504 | Bacteria | 944 |
| 693 | Ga0587082_069561 | 3300059504 | Bacteria | 712 |
| 694 | Ga0587082_084282 | 3300059504 | Bacteria | 668 |
| 695 | Ga0587086_040533 | 3300059507 | Bacteria | 719 |
| 696 | Ga0587088_047972 | 3300059508 | Bacteria | 827 |
| 697 | Ga0587088_061262 | 3300059508 | Bacteria | 763 |
| 698 | Ga0587075_008119 | 3300059644 | Bacteria | 1334 |
| 699 | Ga0587075_035026 | 3300059644 | Bacteria | 817 |
| 700 | Ga0587078_049321 | 3300059646 | Bacteria | 614 |
| 701 | Ga0587079_004925 | 3300059647 | Bacteria | 1853 |
| 702 | Ga0587079_034119 | 3300059647 | Bacteria | 994 |
| 703 | Ga0587079_137505 | 3300059647 | Bacteria | 620 |
| 704 | Ga0587079_168628 | 3300059647 | Bacteria | 578 |
| 705 | Ga0587071_071833 | 3300060344 | Bacteria | 755 |
| 706 | Ga0587071_114682 | 3300060344 | Bacteria | 637 |
| 707 | Ga0587071_123693 | 3300060344 | Bacteria | 621 |
| 708 | Ga0466962_0290710 | 3300061719 | Bacteria | 807 |
| 709 | Ga0530510_0010046 | 3300061734 | Bacteria | 6639 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031548 | Ga0307408_100380303 | Ga0307408_1003803032 | 151 |
| 2 | 3300049824 | Ga0501045_0334080 | Ga0501045_0334080_585_1115 | 151 |
| 3 | 3300031995 | Ga0307409_100122689 | Ga0307409_1001226893 | 154 |
| 4 | 3300046460 | Ga0495638_0021571 | Ga0495638_0021571_1275_1745 | 156 |
| 5 | 3300046530 | Ga0495654_0000140 | Ga0495654_0000140_17269_17739 | 156 |
| 6 | 3300009094 | Ga0111539_10861476 | Ga0111539_108614762 | 157 |
| 7 | 3300047472 | Ga0495686_0521345 | Ga0495686_0521345_61_534 | 157 |
| 8 | iso_pu_bacteria | 8011350971 | 8011356985 | 157 |
| 9 | iso_pu_bacteria | 2554235132 | 2554815058 | 158 |
| 10 | iso_pu_bacteria | 2606217733 | 2608383560 | 158 |
| 11 | iso_pu_bacteria | 2791355253 | 2793283815 | 158 |
| 12 | iso_pu_bacteria | 3005409236 | 3005416110 | 159 |
| 13 | 3300045836 | Ga0466958_0711955 | Ga0466958_0711955_57_602 | 160 |
| 14 | 3300005337 | Ga0070682_100174053 | Ga0070682_1001740532 | 161 |
| 15 | 3300005367 | Ga0070667_100850445 | Ga0070667_1008504451 | 161 |
| 16 | 3300005456 | Ga0070678_100148518 | Ga0070678_1001485182 | 161 |
| 17 | 3300005618 | Ga0068864_100380674 | Ga0068864_1003806742 | 161 |
| 18 | 3300009098 | Ga0105245_10092913 | Ga0105245_100929131 | 161 |
| 19 | 3300009101 | Ga0105247_10185883 | Ga0105247_101858831 | 161 |
| 20 | 3300025901 | Ga0207688_10335108 | Ga0207688_103351082 | 161 |
| 21 | 3300025986 | Ga0207658_10751297 | Ga0207658_107512972 | 161 |
| 22 | 3300026095 | Ga0207676_10551392 | Ga0207676_105513922 | 161 |
| 23 | 3300026121 | Ga0207683_10180226 | Ga0207683_101802262 | 161 |
| 24 | 3300048905 | Ga0496102_0205197 | Ga0496102_0205197_540_1064 | 161 |
| 25 | 3300048911 | Ga0496108_0012219 | Ga0496108_0012219_4957_5481 | 161 |
| 26 | 3300048912 | Ga0496109_0460088 | Ga0496109_0460088_63_587 | 161 |
| 27 | 3300048922 | Ga0496119_0015035 | Ga0496119_0015035_5008_5496 | 161 |
| 28 | iso_pu_bacteria | 8054472261 | 8054479161 | 161 |
| 29 | 3300006051 | Ga0075364_10244722 | Ga0075364_102447222 | 162 |
| 30 | 3300041411 | Ga0439466_0205833 | Ga0439466_0205833_32_520 | 162 |
| 31 | 3300042156 | Ga0439446_0013747 | Ga0439446_0013747_1289_1777 | 162 |
| 32 | 3300042435 | Ga0439434_0020631 | Ga0439434_0020631_50_538 | 162 |
| 33 | 3300044658 | Ga0466972_0022428 | Ga0466972_0022428_255_776 | 162 |
| 34 | 3300044765 | Ga0466970_0007129 | Ga0466970_0007129_2291_2812 | 162 |
| 35 | 3300044842 | Ga0466957_0107245 | Ga0466957_0107245_957_1478 | 162 |
| 36 | 3300044901 | Ga0466960_0001756 | Ga0466960_0001756_2132_2653 | 162 |
| 37 | 3300045836 | Ga0466958_0101292 | Ga0466958_0101292_394_915 | 162 |
| 38 | 3300003203 | JGI25406J46586_10079730 | JGI25406J46586_100797301 | 163 |
| 39 | 3300004785 | Ga0058858_1421484 | Ga0058858_14214842 | 163 |
| 40 | 3300004798 | Ga0058859_10009161 | Ga0058859_100091612 | 163 |
| 41 | 3300004799 | Ga0058863_10041758 | Ga0058863_100417582 | 163 |
| 42 | 3300004800 | Ga0058861_10087982 | Ga0058861_100879822 | 163 |
| 43 | 3300004803 | Ga0058862_10099156 | Ga0058862_100991562 | 163 |
| 44 | 3300005327 | Ga0070658_10130570 | Ga0070658_101305702 | 163 |
| 45 | 3300005329 | Ga0070683_100567343 | Ga0070683_1005673432 | 163 |
| 46 | 3300005331 | Ga0070670_100209071 | Ga0070670_1002090712 | 163 |
| 47 | 3300005337 | Ga0070682_100361567 | Ga0070682_1003615672 | 163 |
| 48 | 3300005338 | Ga0068868_100219671 | Ga0068868_1002196712 | 163 |
| 49 | 3300005345 | Ga0070692_10019671 | Ga0070692_100196712 | 163 |
| 50 | 3300005347 | Ga0070668_101364615 | Ga0070668_1013646151 | 163 |
| 51 | 3300005354 | Ga0070675_100087473 | Ga0070675_1000874731 | 163 |
| 52 | 3300005354 | Ga0070675_100765381 | Ga0070675_1007653811 | 163 |
| 53 | 3300005366 | Ga0070659_100088400 | Ga0070659_1000884002 | 163 |
| 54 | 3300005436 | Ga0070713_100976370 | Ga0070713_1009763702 | 163 |
| 55 | 3300005455 | Ga0070663_100173838 | Ga0070663_1001738382 | 163 |
| 56 | 3300005455 | Ga0070663_100694125 | Ga0070663_1006941252 | 163 |
| 57 | 3300005456 | Ga0070678_100402445 | Ga0070678_1004024452 | 163 |
| 58 | 3300005457 | Ga0070662_100190515 | Ga0070662_1001905152 | 163 |
| 59 | 3300005459 | Ga0068867_100579396 | Ga0068867_1005793962 | 163 |
| 60 | 3300005466 | Ga0070685_10924288 | Ga0070685_109242881 | 163 |
| 61 | 3300005467 | Ga0070706_101140514 | Ga0070706_1011405141 | 163 |
| 62 | 3300005535 | Ga0070684_100259830 | Ga0070684_1002598302 | 163 |
| 63 | 3300005535 | Ga0070684_100790738 | Ga0070684_1007907382 | 163 |
| 64 | 3300005547 | Ga0070693_100094314 | Ga0070693_1000943142 | 163 |
| 65 | 3300005548 | Ga0070665_100443494 | Ga0070665_1004434942 | 163 |
| 66 | 3300005548 | Ga0070665_100915168 | Ga0070665_1009151682 | 163 |
| 67 | 3300005548 | Ga0070665_101299194 | Ga0070665_1012991942 | 163 |
| 68 | 3300005563 | Ga0068855_101153401 | Ga0068855_1011534012 | 163 |
| 69 | 3300005577 | Ga0068857_100068268 | Ga0068857_1000682683 | 163 |
| 70 | 3300005578 | Ga0068854_100017580 | Ga0068854_1000175806 | 163 |
| 71 | 3300005578 | Ga0068854_101038324 | Ga0068854_1010383241 | 163 |
| 72 | 3300005614 | Ga0068856_100095930 | Ga0068856_1000959302 | 163 |
| 73 | 3300005616 | Ga0068852_100316407 | Ga0068852_1003164072 | 163 |
| 74 | 3300005616 | Ga0068852_100328356 | Ga0068852_1003283562 | 163 |
| 75 | 3300005617 | Ga0068859_100903846 | Ga0068859_1009038462 | 163 |
| 76 | 3300005617 | Ga0068859_101674409 | Ga0068859_1016744091 | 163 |
| 77 | 3300005618 | Ga0068864_100357442 | Ga0068864_1003574422 | 163 |
| 78 | 3300005718 | Ga0068866_10366871 | Ga0068866_103668712 | 163 |
| 79 | 3300005834 | Ga0068851_10036766 | Ga0068851_100367663 | 163 |
| 80 | 3300005840 | Ga0068870_10374851 | Ga0068870_103748512 | 163 |
| 81 | 3300005841 | Ga0068863_100064551 | Ga0068863_1000645514 | 163 |
| 82 | 3300005841 | Ga0068863_100325055 | Ga0068863_1003250552 | 163 |
| 83 | 3300005842 | Ga0068858_100102866 | Ga0068858_1001028663 | 163 |
| 84 | 3300005842 | Ga0068858_100544263 | Ga0068858_1005442632 | 163 |
| 85 | 3300005843 | Ga0068860_100376133 | Ga0068860_1003761332 | 163 |
| 86 | 3300005843 | Ga0068860_101278075 | Ga0068860_1012780752 | 163 |
| 87 | 3300005844 | Ga0068862_100384621 | Ga0068862_1003846212 | 163 |
| 88 | 3300005937 | Ga0081455_10007611 | Ga0081455_1000761112 | 163 |
| 89 | 3300005985 | Ga0081539_10006743 | Ga0081539_1000674310 | 163 |
| 90 | 3300005985 | Ga0081539_10031667 | Ga0081539_100316672 | 163 |
| 91 | 3300006881 | Ga0068865_100300952 | Ga0068865_1003009522 | 163 |
| 92 | 3300006931 | Ga0097620_100903897 | Ga0097620_1009038972 | 163 |
| 93 | 3300006931 | Ga0097620_101674463 | Ga0097620_1016744632 | 163 |
| 94 | 3300009011 | Ga0105251_10137392 | Ga0105251_101373922 | 163 |
| 95 | 3300009094 | Ga0111539_10438119 | Ga0111539_104381191 | 163 |
| 96 | 3300009094 | Ga0111539_10690177 | Ga0111539_106901772 | 163 |
| 97 | 3300009094 | Ga0111539_10902890 | Ga0111539_109028902 | 163 |
| 98 | 3300009094 | Ga0111539_11205917 | Ga0111539_112059172 | 163 |
| 99 | 3300009098 | Ga0105245_10207686 | Ga0105245_102076862 | 163 |
| 100 | 3300009101 | Ga0105247_10213937 | Ga0105247_102139371 | 163 |
| 101 | 3300009101 | Ga0105247_10714032 | Ga0105247_107140321 | 163 |
| 102 | 3300009101 | Ga0105247_10954126 | Ga0105247_109541262 | 163 |
| 103 | 3300009148 | Ga0105243_10573239 | Ga0105243_105732392 | 163 |
| 104 | 3300009148 | Ga0105243_11161613 | Ga0105243_111616131 | 163 |
| 105 | 3300009174 | Ga0105241_10641842 | Ga0105241_106418422 | 163 |
| 106 | 3300009176 | Ga0105242_10060569 | Ga0105242_100605692 | 163 |
| 107 | 3300009177 | Ga0105248_12625132 | Ga0105248_126251321 | 163 |
| 108 | 3300009545 | Ga0105237_10168447 | Ga0105237_101684472 | 163 |
| 109 | 3300009551 | Ga0105238_10515638 | Ga0105238_105156382 | 163 |
| 110 | 3300009551 | Ga0105238_11642875 | Ga0105238_116428752 | 163 |
| 111 | 3300009553 | Ga0105249_10355110 | Ga0105249_103551102 | 163 |
| 112 | 3300011119 | Ga0105246_10310978 | Ga0105246_103109782 | 163 |
| 113 | 3300013102 | Ga0157371_10249588 | Ga0157371_102495882 | 163 |
| 114 | 3300013104 | Ga0157370_10864992 | Ga0157370_108649922 | 163 |
| 115 | 3300013105 | Ga0157369_10597261 | Ga0157369_105972612 | 163 |
| 116 | 3300013296 | Ga0157374_10645124 | Ga0157374_106451242 | 163 |
| 117 | 3300013307 | Ga0157372_10090951 | Ga0157372_100909511 | 163 |
| 118 | 3300013307 | Ga0157372_10610941 | Ga0157372_106109412 | 163 |
| 119 | 3300013308 | Ga0157375_10470027 | Ga0157375_104700272 | 163 |
| 120 | 3300013308 | Ga0157375_11573654 | Ga0157375_115736542 | 163 |
| 121 | 3300014325 | Ga0163163_10329677 | Ga0163163_103296771 | 163 |
| 122 | 3300014968 | Ga0157379_10967930 | Ga0157379_109679302 | 163 |
| 123 | 3300017792 | Ga0163161_10360074 | Ga0163161_103600742 | 163 |
| 124 | 3300017792 | Ga0163161_11163407 | Ga0163161_111634071 | 163 |
| 125 | 3300020069 | Ga0197907_10831311 | Ga0197907_108313112 | 163 |
| 126 | 3300020070 | Ga0206356_10184193 | Ga0206356_101841932 | 163 |
| 127 | 3300020070 | Ga0206356_10309572 | Ga0206356_103095722 | 163 |
| 128 | 3300020070 | Ga0206356_11613575 | Ga0206356_116135752 | 163 |
| 129 | 3300020075 | Ga0206349_1889663 | Ga0206349_18896632 | 163 |
| 130 | 3300020076 | Ga0206355_1246002 | Ga0206355_12460022 | 163 |
| 131 | 3300020076 | Ga0206355_1653515 | Ga0206355_16535152 | 163 |
| 132 | 3300020077 | Ga0206351_10992062 | Ga0206351_109920622 | 163 |
| 133 | 3300020078 | Ga0206352_10290768 | Ga0206352_102907681 | 163 |
| 134 | 3300020078 | Ga0206352_11145297 | Ga0206352_111452972 | 163 |
| 135 | 3300020081 | Ga0206354_11208453 | Ga0206354_112084532 | 163 |
| 136 | 3300020082 | Ga0206353_11504654 | Ga0206353_115046541 | 163 |
| 137 | 3300020082 | Ga0206353_11544153 | Ga0206353_115441532 | 163 |
| 138 | 3300022467 | Ga0224712_10004343 | Ga0224712_100043432 | 163 |
| 139 | 3300025898 | Ga0207692_10345997 | Ga0207692_103459971 | 163 |
| 140 | 3300025900 | Ga0207710_10459625 | Ga0207710_104596252 | 163 |
| 141 | 3300025900 | Ga0207710_10594830 | Ga0207710_105948301 | 163 |
| 142 | 3300025901 | Ga0207688_10002022 | Ga0207688_100020226 | 163 |
| 143 | 3300025904 | Ga0207647_10034190 | Ga0207647_100341904 | 163 |
| 144 | 3300025907 | Ga0207645_10010732 | Ga0207645_100107325 | 163 |
| 145 | 3300025917 | Ga0207660_10676576 | Ga0207660_106765762 | 163 |
| 146 | 3300025918 | Ga0207662_10015986 | Ga0207662_100159862 | 163 |
| 147 | 3300025921 | Ga0207652_11096743 | Ga0207652_110967432 | 163 |
| 148 | 3300025923 | Ga0207681_10140195 | Ga0207681_101401952 | 163 |
| 149 | 3300025924 | Ga0207694_10548643 | Ga0207694_105486431 | 163 |
| 150 | 3300025925 | Ga0207650_11108999 | Ga0207650_111089992 | 163 |
| 151 | 3300025926 | Ga0207659_11420819 | Ga0207659_114208191 | 163 |
| 152 | 3300025927 | Ga0207687_10054043 | Ga0207687_100540432 | 163 |
| 153 | 3300025927 | Ga0207687_11324535 | Ga0207687_113245352 | 163 |
| 154 | 3300025928 | Ga0207700_10274240 | Ga0207700_102742402 | 163 |
| 155 | 3300025932 | Ga0207690_10161856 | Ga0207690_101618562 | 163 |
| 156 | 3300025933 | Ga0207706_10026774 | Ga0207706_100267746 | 163 |
| 157 | 3300025934 | Ga0207686_10086228 | Ga0207686_100862282 | 163 |
| 158 | 3300025936 | Ga0207670_10254533 | Ga0207670_102545332 | 163 |
| 159 | 3300025936 | Ga0207670_10569550 | Ga0207670_105695502 | 163 |
| 160 | 3300025937 | Ga0207669_10010783 | Ga0207669_100107832 | 163 |
| 161 | 3300025938 | Ga0207704_10355392 | Ga0207704_103553922 | 163 |
| 162 | 3300025941 | Ga0207711_10691785 | Ga0207711_106917852 | 163 |
| 163 | 3300025942 | Ga0207689_10534632 | Ga0207689_105346322 | 163 |
| 164 | 3300025944 | Ga0207661_10747266 | Ga0207661_107472662 | 163 |
| 165 | 3300025949 | Ga0207667_10832049 | Ga0207667_108320492 | 163 |
| 166 | 3300025960 | Ga0207651_10992737 | Ga0207651_109927372 | 163 |
| 167 | 3300025961 | Ga0207712_10131269 | Ga0207712_101312692 | 163 |
| 168 | 3300025972 | Ga0207668_10553031 | Ga0207668_105530312 | 163 |
| 169 | 3300026067 | Ga0207678_10358757 | Ga0207678_103587572 | 163 |
| 170 | 3300026075 | Ga0207708_10091736 | Ga0207708_100917362 | 163 |
| 171 | 3300026078 | Ga0207702_10420643 | Ga0207702_104206432 | 163 |
| 172 | 3300026088 | Ga0207641_10297562 | Ga0207641_102975622 | 163 |
| 173 | 3300026095 | Ga0207676_10432246 | Ga0207676_104322461 | 163 |
| 174 | 3300026116 | Ga0207674_10017599 | Ga0207674_100175994 | 163 |
| 175 | 3300026118 | Ga0207675_100497880 | Ga0207675_1004978802 | 163 |
| 176 | 3300026121 | Ga0207683_11145132 | Ga0207683_111451322 | 163 |
| 177 | 3300026142 | Ga0207698_10148975 | Ga0207698_101489752 | 163 |
| 178 | 3300026142 | Ga0207698_10633796 | Ga0207698_106337962 | 163 |
| 179 | 3300027907 | Ga0207428_10219838 | Ga0207428_102198382 | 163 |
| 180 | 3300027907 | Ga0207428_10379496 | Ga0207428_103794962 | 163 |
| 181 | 3300028380 | Ga0268265_10310037 | Ga0268265_103100372 | 163 |
| 182 | 3300028381 | Ga0268264_10443187 | Ga0268264_104431872 | 163 |
| 183 | 3300031456 | Ga0307513_10000684 | Ga0307513_1000068421 | 163 |
| 184 | 3300031901 | Ga0307406_10716839 | Ga0307406_107168392 | 163 |
| 185 | 3300031995 | Ga0307409_100418559 | Ga0307409_1004185592 | 163 |
| 186 | 3300031995 | Ga0307409_100453166 | Ga0307409_1004531662 | 163 |
| 187 | 3300032126 | Ga0307415_101428380 | Ga0307415_1014283802 | 163 |
| 188 | 3300035091 | Ga0373951_0201422 | Ga0373951_0201422_57_548 | 163 |
| 189 | 3300035691 | Ga0373931_0300983 | Ga0373931_0300983_71_562 | 163 |
| 190 | 3300037418 | Ga0395900_0450194 | Ga0395900_0450194_715_1209 | 163 |
| 191 | 3300037466 | Ga0395898_0334390 | Ga0395898_0334390_495_989 | 163 |
| 192 | 3300038443 | Ga0395901_0069819 | Ga0395901_0069819_2942_3436 | 163 |
| 193 | 3300041460 | Ga0451802_0591086 | Ga0451802_0591086_62_553 | 163 |
| 194 | 3300041463 | Ga0451804_0721298 | Ga0451804_0721298_214_705 | 163 |
| 195 | 3300041498 | Ga0451841_0419520 | Ga0451841_0419520_35_526 | 163 |
| 196 | 3300041501 | Ga0451845_0365457 | Ga0451845_0365457_369_860 | 163 |
| 197 | 3300041512 | Ga0451853_0649725 | Ga0451853_0649725_131_622 | 163 |
| 198 | 3300042016 | Ga0439463_051944 | Ga0439463_051944_344_835 | 163 |
| 199 | 3300042438 | Ga0439459_0042308 | Ga0439459_0042308_353_844 | 163 |
| 200 | 3300042439 | Ga0439464_0082322 | Ga0439464_0082322_361_852 | 163 |
| 201 | 3300045976 | Ga0466967_0115293 | Ga0466967_0115293_912_1403 | 163 |
| 202 | 3300046477 | Ga0495664_0092530 | Ga0495664_0092530_323_814 | 163 |
| 203 | 3300046511 | Ga0495608_0174282 | Ga0495608_0174282_133_624 | 163 |
| 204 | 3300046536 | Ga0495587_0534783 | Ga0495587_0534783_130_621 | 163 |
| 205 | 3300046689 | Ga0495613_0274905 | Ga0495613_0274905_230_721 | 163 |
| 206 | 3300046690 | Ga0495624_0396558 | Ga0495624_0396558_14_505 | 163 |
| 207 | 3300046809 | Ga0495600_0329958 | Ga0495600_0329958_133_624 | 163 |
| 208 | 3300047322 | Ga0495680_0708361 | Ga0495680_0708361_106_597 | 163 |
| 209 | 3300048907 | Ga0496104_0392167 | Ga0496104_0392167_533_1024 | 163 |
| 210 | 3300048910 | Ga0496107_0330251 | Ga0496107_0330251_167_658 | 163 |
| 211 | 3300048911 | Ga0496108_0135328 | Ga0496108_0135328_1166_1657 | 163 |
| 212 | 3300048912 | Ga0496109_0129519 | Ga0496109_0129519_970_1461 | 163 |
| 213 | 3300048913 | Ga0496110_0092534 | Ga0496110_0092534_324_815 | 163 |
| 214 | 3300048913 | Ga0496110_0722379 | Ga0496110_0722379_307_798 | 163 |
| 215 | 3300048914 | Ga0496111_0529616 | Ga0496111_0529616_279_770 | 163 |
| 216 | 3300048916 | Ga0496113_0408736 | Ga0496113_0408736_569_1060 | 163 |
| 217 | 3300050509 | nmdc:mga0qj67_475227_c1 | nmdc:mga0qj67_475227_c1_25_516 | 163 |
| 218 | 3300050511 | nmdc:mga08y16_1306930_c1 | nmdc:mga08y16_1306930_c1_93_584 | 163 |
| 219 | 3300050511 | nmdc:mga08y16_338710_c1 | nmdc:mga08y16_338710_c1_720_1211 | 163 |
| 220 | 3300050513 | nmdc:mga0rr50_591096_c1 | nmdc:mga0rr50_591096_c1_283_774 | 163 |
| 221 | 3300053083 | Ga0495655_0230238 | Ga0495655_0230238_27_518 | 163 |
| 222 | 3300053084 | Ga0495595_0409082 | Ga0495595_0409082_39_530 | 163 |
| 223 | 3300053136 | Ga0500559_0019671 | Ga0500559_0019671_2204_2704 | 163 |
| 224 | 3300059478 | Ga0587093_053513 | Ga0587093_053513_117_608 | 163 |
| 225 | 3300059490 | Ga0587066_012376 | Ga0587066_012376_140_631 | 163 |
| 226 | 3300059491 | Ga0587070_035744 | Ga0587070_035744_86_577 | 163 |
| 227 | 3300059491 | Ga0587070_050901 | Ga0587070_050901_146_637 | 163 |
| 228 | 3300059493 | Ga0587077_082409 | Ga0587077_082409_123_614 | 163 |
| 229 | 3300059503 | Ga0587080_032628 | Ga0587080_032628_303_794 | 163 |
| 230 | 3300059503 | Ga0587080_060492 | Ga0587080_060492_117_608 | 163 |
| 231 | 3300059504 | Ga0587082_016022 | Ga0587082_016022_358_849 | 163 |
| 232 | 3300059504 | Ga0587082_029850 | Ga0587082_029850_70_561 | 163 |
| 233 | 3300059504 | Ga0587082_069561 | Ga0587082_069561_144_635 | 163 |
| 234 | 3300059504 | Ga0587082_084282 | Ga0587082_084282_67_558 | 163 |
| 235 | 3300059507 | Ga0587086_040533 | Ga0587086_040533_40_531 | 163 |
| 236 | 3300059508 | Ga0587088_047972 | Ga0587088_047972_279_770 | 163 |
| 237 | 3300059508 | Ga0587088_061262 | Ga0587088_061262_184_675 | 163 |
| 238 | 3300059644 | Ga0587075_008119 | Ga0587075_008119_755_1246 | 163 |
| 239 | 3300059644 | Ga0587075_035026 | Ga0587075_035026_119_610 | 163 |
| 240 | 3300059646 | Ga0587078_049321 | Ga0587078_049321_82_573 | 163 |
| 241 | 3300059647 | Ga0587079_004925 | Ga0587079_004925_613_1104 | 163 |
| 242 | 3300059647 | Ga0587079_034119 | Ga0587079_034119_313_804 | 163 |
| 243 | 3300059647 | Ga0587079_137505 | Ga0587079_137505_86_577 | 163 |
| 244 | 3300059647 | Ga0587079_168628 | Ga0587079_168628_19_510 | 163 |
| 245 | 3300060344 | Ga0587071_071833 | Ga0587071_071833_34_525 | 163 |
| 246 | 3300060344 | Ga0587071_114682 | Ga0587071_114682_122_613 | 163 |
| 247 | 3300060344 | Ga0587071_123693 | Ga0587071_123693_85_576 | 163 |
| 248 | iso_pu_bacteria | 2893684298 | 2893685409 | 163 |
| 249 | iso_pu_bacteria | 2974315732 | 2974315792 | 163 |
| 250 | 3300025302 | Ga0207426_1009534 | Ga0207426_10095343 | 164 |
| 251 | 3300031548 | Ga0307408_101807763 | Ga0307408_1018077631 | 164 |
| 252 | 3300037418 | Ga0395900_0117571 | Ga0395900_0117571_1075_1581 | 164 |
| 253 | 3300041453 | Ga0451797_0745449 | Ga0451797_0745449_250_753 | 164 |
| 254 | 3300044656 | Ga0466969_0043728 | Ga0466969_0043728_1660_2166 | 164 |
| 255 | 3300044684 | Ga0466966_0009336 | Ga0466966_0009336_4657_5163 | 164 |
| 256 | 3300044684 | Ga0466966_0048045 | Ga0466966_0048045_1954_2460 | 164 |
| 257 | 3300044693 | Ga0466961_0025109 | Ga0466961_0025109_615_1121 | 164 |
| 258 | 3300044694 | Ga0466963_0014835 | Ga0466963_0014835_1081_1587 | 164 |
| 259 | 3300044719 | Ga0466971_0008198 | Ga0466971_0008198_1908_2414 | 164 |
| 260 | 3300044765 | Ga0466970_0019982 | Ga0466970_0019982_2809_3315 | 164 |
| 261 | 3300044842 | Ga0466957_0334522 | Ga0466957_0334522_109_615 | 164 |
| 262 | 3300045049 | Ga0466959_0032739 | Ga0466959_0032739_584_1090 | 164 |
| 263 | 3300045049 | Ga0466959_0113302 | Ga0466959_0113302_275_781 | 164 |
| 264 | 3300046689 | Ga0495613_0308785 | Ga0495613_0308785_499_999 | 164 |
| 265 | 3300047318 | Ga0495636_0001755 | Ga0495636_0001755_2667_3173 | 164 |
| 266 | 3300047443 | Ga0495687_003383 | Ga0495687_003383_1564_2070 | 164 |
| 267 | 3300053100 | Ga0500660_099896 | Ga0500660_099896_22_528 | 164 |
| 268 | iso_pu_bacteria | 2751185725 | 2753036186 | 164 |
| 269 | iso_pu_bacteria | 2751185792 | 2753324058 | 164 |
| 270 | iso_pu_bacteria | 2775506925 | 2776374623 | 164 |
| 271 | iso_pu_bacteria | 2862507626 | 2862514025 | 164 |
| 272 | iso_pu_bacteria | 2862574272 | 2862581646 | 164 |
| 273 | iso_pu_bacteria | 2863067949 | 2863075421 | 164 |
| 274 | 3300006038 | Ga0075365_10215282 | Ga0075365_102152822 | 165 |
| 275 | 3300046455 | Ga0495603_0084998 | Ga0495603_0084998_206_754 | 165 |
| 276 | 3300046492 | Ga0495585_0111285 | Ga0495585_0111285_765_1313 | 165 |
| 277 | 3300046499 | Ga0495594_0044020 | Ga0495594_0044020_274_822 | 165 |
| 278 | 3300046557 | Ga0495622_0256308 | Ga0495622_0256308_77_625 | 165 |
| 279 | 3300046690 | Ga0495624_0276047 | Ga0495624_0276047_481_990 | 165 |
| 280 | 3300046691 | Ga0495670_0087786 | Ga0495670_0087786_672_1220 | 165 |
| 281 | 3300046794 | Ga0495589_0011210 | Ga0495589_0011210_2583_3131 | 165 |
| 282 | 3300047318 | Ga0495636_0072739 | Ga0495636_0072739_788_1336 | 165 |
| 283 | 3300047321 | Ga0495676_0017481 | Ga0495676_0017481_1273_1821 | 165 |
| 284 | 3300047321 | Ga0495676_0264355 | Ga0495676_0264355_454_1002 | 165 |
| 285 | 3300047447 | Ga0495685_001492 | Ga0495685_001492_5232_5780 | 165 |
| 286 | 3300050492 | nmdc:mga0yw44_136577_c1 | nmdc:mga0yw44_136577_c1_461_979 | 165 |
| 287 | 3300053107 | Ga0500560_000103 | Ga0500560_000103_5683_6192 | 165 |
| 288 | 3300053140 | Ga0500573_0227834 | Ga0500573_0227834_94_603 | 165 |
| 289 | iso_pu_bacteria | 2537561592 | 2537898874 | 165 |
| 290 | iso_pu_bacteria | 2565956761 | 2566993344 | 165 |
| 291 | iso_pu_bacteria | 2643221561 | 2643827360 | 165 |
| 292 | iso_pu_bacteria | 2643221696 | 2644533813 | 165 |
| 293 | iso_pu_bacteria | 2773857762 | 2774396716 | 165 |
| 294 | iso_pu_bacteria | 2811994878 | 2812349557 | 165 |
| 295 | iso_pu_bacteria | 2842134933 | 2842137130 | 165 |
| 296 | iso_pu_bacteria | 2891968417 | 2891969407 | 165 |
| 297 | iso_pu_bacteria | 2922554459 | 2922559674 | 165 |
| 298 | 3300001990 | JGI24737J22298_10049507 | JGI24737J22298_100495072 | 166 |
| 299 | 3300002239 | JGI24034J26672_10005656 | JGI24034J26672_100056562 | 166 |
| 300 | 3300005328 | Ga0070676_10020890 | Ga0070676_100208904 | 166 |
| 301 | 3300005334 | Ga0068869_100039798 | Ga0068869_1000397982 | 166 |
| 302 | 3300005335 | Ga0070666_10009026 | Ga0070666_100090263 | 166 |
| 303 | 3300005337 | Ga0070682_100042072 | Ga0070682_1000420722 | 166 |
| 304 | 3300005338 | Ga0068868_100000203 | Ga0068868_10000020318 | 166 |
| 305 | 3300005340 | Ga0070689_100040615 | Ga0070689_1000406152 | 166 |
| 306 | 3300005341 | Ga0070691_10000914 | Ga0070691_1000091411 | 166 |
| 307 | 3300005347 | Ga0070668_100005307 | Ga0070668_1000053078 | 166 |
| 308 | 3300005353 | Ga0070669_100065201 | Ga0070669_1000652012 | 166 |
| 309 | 3300005355 | Ga0070671_100021227 | Ga0070671_1000212272 | 166 |
| 310 | 3300005356 | Ga0070674_100000244 | Ga0070674_10000024415 | 166 |
| 311 | 3300005364 | Ga0070673_100449356 | Ga0070673_1004493562 | 166 |
| 312 | 3300005365 | Ga0070688_100002188 | Ga0070688_10000218811 | 166 |
| 313 | 3300005366 | Ga0070659_100049761 | Ga0070659_1000497612 | 166 |
| 314 | 3300005367 | Ga0070667_100066954 | Ga0070667_1000669543 | 166 |
| 315 | 3300005434 | Ga0070709_10159348 | Ga0070709_101593482 | 166 |
| 316 | 3300005434 | Ga0070709_10804763 | Ga0070709_108047632 | 166 |
| 317 | 3300005437 | Ga0070710_10025259 | Ga0070710_100252592 | 166 |
| 318 | 3300005439 | Ga0070711_100002396 | Ga0070711_1000023963 | 166 |
| 319 | 3300005440 | Ga0070705_100005263 | Ga0070705_1000052632 | 166 |
| 320 | 3300005441 | Ga0070700_100012566 | Ga0070700_1000125662 | 166 |
| 321 | 3300005444 | Ga0070694_100044216 | Ga0070694_1000442163 | 166 |
| 322 | 3300005455 | Ga0070663_100012067 | Ga0070663_1000120675 | 166 |
| 323 | 3300005457 | Ga0070662_100000713 | Ga0070662_10000071318 | 166 |
| 324 | 3300005459 | Ga0068867_100001211 | Ga0068867_1000012117 | 166 |
| 325 | 3300005466 | Ga0070685_10405609 | Ga0070685_104056092 | 166 |
| 326 | 3300005530 | Ga0070679_100231529 | Ga0070679_1002315292 | 166 |
| 327 | 3300005543 | Ga0070672_100084142 | Ga0070672_1000841422 | 166 |
| 328 | 3300005545 | Ga0070695_100002690 | Ga0070695_1000026902 | 166 |
| 329 | 3300005546 | Ga0070696_100044126 | Ga0070696_1000441262 | 166 |
| 330 | 3300005547 | Ga0070693_100312734 | Ga0070693_1003127342 | 166 |
| 331 | 3300005563 | Ga0068855_100184547 | Ga0068855_1001845472 | 166 |
| 332 | 3300005578 | Ga0068854_100000262 | Ga0068854_10000026211 | 166 |
| 333 | 3300005614 | Ga0068856_100226532 | Ga0068856_1002265322 | 166 |
| 334 | 3300005615 | Ga0070702_100001129 | Ga0070702_1000011293 | 166 |
| 335 | 3300005616 | Ga0068852_100396309 | Ga0068852_1003963092 | 166 |
| 336 | 3300005617 | Ga0068859_100002266 | Ga0068859_10000226610 | 166 |
| 337 | 3300005718 | Ga0068866_10000681 | Ga0068866_100006812 | 166 |
| 338 | 3300005719 | Ga0068861_100018017 | Ga0068861_1000180172 | 166 |
| 339 | 3300005842 | Ga0068858_100001689 | Ga0068858_10000168911 | 166 |
| 340 | 3300005843 | Ga0068860_100001255 | Ga0068860_10000125513 | 166 |
| 341 | 3300005844 | Ga0068862_100001317 | Ga0068862_10000131712 | 166 |
| 342 | 3300005937 | Ga0081455_10018209 | Ga0081455_100182092 | 166 |
| 343 | 3300006163 | Ga0070715_10016658 | Ga0070715_100166582 | 166 |
| 344 | 3300006173 | Ga0070716_100001813 | Ga0070716_1000018132 | 166 |
| 345 | 3300006175 | Ga0070712_100001225 | Ga0070712_1000012259 | 166 |
| 346 | 3300006237 | Ga0097621_100038572 | Ga0097621_1000385722 | 166 |
| 347 | 3300006358 | Ga0068871_100080370 | Ga0068871_1000803703 | 166 |
| 348 | 3300006931 | Ga0097620_100002267 | Ga0097620_10000226711 | 166 |
| 349 | 3300009098 | Ga0105245_10001005 | Ga0105245_1000100524 | 166 |
| 350 | 3300009101 | Ga0105247_10000372 | Ga0105247_1000037212 | 166 |
| 351 | 3300009148 | Ga0105243_10000676 | Ga0105243_1000067614 | 166 |
| 352 | 3300009176 | Ga0105242_10000197 | Ga0105242_1000019726 | 166 |
| 353 | 3300009177 | Ga0105248_10014539 | Ga0105248_100145398 | 166 |
| 354 | 3300009545 | Ga0105237_10005565 | Ga0105237_100055653 | 166 |
| 355 | 3300009551 | Ga0105238_10093100 | Ga0105238_100931002 | 166 |
| 356 | 3300010375 | Ga0105239_10004408 | Ga0105239_100044082 | 166 |
| 357 | 3300013104 | Ga0157370_10739994 | Ga0157370_107399942 | 166 |
| 358 | 3300013297 | Ga0157378_10002889 | Ga0157378_1000288914 | 166 |
| 359 | 3300013306 | Ga0163162_10002808 | Ga0163162_1000280811 | 166 |
| 360 | 3300013308 | Ga0157375_10001551 | Ga0157375_1000155113 | 166 |
| 361 | 3300014326 | Ga0157380_10000136 | Ga0157380_1000013617 | 166 |
| 362 | 3300014745 | Ga0157377_10051551 | Ga0157377_100515512 | 166 |
| 363 | 3300014968 | Ga0157379_10002115 | Ga0157379_1000211515 | 166 |
| 364 | 3300014969 | Ga0157376_10039949 | Ga0157376_100399492 | 166 |
| 365 | 3300017792 | Ga0163161_10012707 | Ga0163161_100127072 | 166 |
| 366 | 3300025885 | Ga0207653_10028622 | Ga0207653_100286222 | 166 |
| 367 | 3300025898 | Ga0207692_10018628 | Ga0207692_100186282 | 166 |
| 368 | 3300025899 | Ga0207642_10000178 | Ga0207642_100001784 | 166 |
| 369 | 3300025900 | Ga0207710_10011878 | Ga0207710_100118783 | 166 |
| 370 | 3300025901 | Ga0207688_10007863 | Ga0207688_100078633 | 166 |
| 371 | 3300025903 | Ga0207680_10007555 | Ga0207680_100075553 | 166 |
| 372 | 3300025904 | Ga0207647_10075426 | Ga0207647_100754262 | 166 |
| 373 | 3300025907 | Ga0207645_10653094 | Ga0207645_106530942 | 166 |
| 374 | 3300025914 | Ga0207671_10056867 | Ga0207671_100568672 | 166 |
| 375 | 3300025915 | Ga0207693_10000507 | Ga0207693_1000050714 | 166 |
| 376 | 3300025916 | Ga0207663_10051804 | Ga0207663_100518042 | 166 |
| 377 | 3300025917 | Ga0207660_10384185 | Ga0207660_103841852 | 166 |
| 378 | 3300025921 | Ga0207652_10188672 | Ga0207652_101886722 | 166 |
| 379 | 3300025923 | Ga0207681_10039095 | Ga0207681_100390952 | 166 |
| 380 | 3300025927 | Ga0207687_10003137 | Ga0207687_100031378 | 166 |
| 381 | 3300025929 | Ga0207664_10137255 | Ga0207664_101372552 | 166 |
| 382 | 3300025931 | Ga0207644_10031815 | Ga0207644_100318152 | 166 |
| 383 | 3300025932 | Ga0207690_10034702 | Ga0207690_100347022 | 166 |
| 384 | 3300025933 | Ga0207706_10001533 | Ga0207706_1000153313 | 166 |
| 385 | 3300025934 | Ga0207686_10001322 | Ga0207686_1000132213 | 166 |
| 386 | 3300025935 | Ga0207709_10003151 | Ga0207709_100031514 | 166 |
| 387 | 3300025936 | Ga0207670_10005363 | Ga0207670_100053633 | 166 |
| 388 | 3300025937 | Ga0207669_10002448 | Ga0207669_100024482 | 166 |
| 389 | 3300025938 | Ga0207704_10000458 | Ga0207704_1000045816 | 166 |
| 390 | 3300025939 | Ga0207665_10001870 | Ga0207665_1000187011 | 166 |
| 391 | 3300025940 | Ga0207691_10041110 | Ga0207691_100411102 | 166 |
| 392 | 3300025941 | Ga0207711_10023282 | Ga0207711_100232822 | 166 |
| 393 | 3300025942 | Ga0207689_10012131 | Ga0207689_100121311 | 166 |
| 394 | 3300025949 | Ga0207667_10156712 | Ga0207667_101567122 | 166 |
| 395 | 3300025960 | Ga0207651_10362039 | Ga0207651_103620392 | 166 |
| 396 | 3300025961 | Ga0207712_10005323 | Ga0207712_100053232 | 166 |
| 397 | 3300025972 | Ga0207668_10001538 | Ga0207668_1000153810 | 166 |
| 398 | 3300025981 | Ga0207640_10000827 | Ga0207640_1000082711 | 166 |
| 399 | 3300025986 | Ga0207658_10018537 | Ga0207658_100185372 | 166 |
| 400 | 3300026023 | Ga0207677_10018504 | Ga0207677_100185042 | 166 |
| 401 | 3300026035 | Ga0207703_10000920 | Ga0207703_1000092014 | 166 |
| 402 | 3300026067 | Ga0207678_10003253 | Ga0207678_1000325313 | 166 |
| 403 | 3300026067 | Ga0207678_10407898 | Ga0207678_104078982 | 166 |
| 404 | 3300026075 | Ga0207708_10024290 | Ga0207708_100242902 | 166 |
| 405 | 3300026078 | Ga0207702_10852773 | Ga0207702_108527732 | 166 |
| 406 | 3300026089 | Ga0207648_10000929 | Ga0207648_100009298 | 166 |
| 407 | 3300026118 | Ga0207675_100000544 | Ga0207675_10000054427 | 166 |
| 408 | 3300026121 | Ga0207683_10000335 | Ga0207683_1000033528 | 166 |
| 409 | 3300026142 | Ga0207698_10350143 | Ga0207698_103501432 | 166 |
| 410 | 3300028380 | Ga0268265_10236677 | Ga0268265_102366772 | 166 |
| 411 | 3300028381 | Ga0268264_10001041 | Ga0268264_1000104113 | 166 |
| 412 | 3300031838 | Ga0307518_10000028 | Ga0307518_1000002852 | 166 |
| 413 | 3300034819 | Ga0373958_0065009 | Ga0373958_0065009_14_529 | 166 |
| 414 | 3300035241 | Ga0373961_0034242 | Ga0373961_0034242_177_692 | 166 |
| 415 | 3300035691 | Ga0373931_0036791 | Ga0373931_0036791_1175_1690 | 166 |
| 416 | 3300041443 | Ga0451789_0783324 | Ga0451789_0783324_346_861 | 166 |
| 417 | 3300041452 | Ga0451793_0320317 | Ga0451793_0320317_1359_1874 | 166 |
| 418 | 3300041456 | Ga0451795_0224208 | Ga0451795_0224208_732_1247 | 166 |
| 419 | 3300041462 | Ga0451806_806050 | Ga0451806_806050_20_535 | 166 |
| 420 | 3300044719 | Ga0466971_0043951 | Ga0466971_0043951_180_737 | 166 |
| 421 | 3300044765 | Ga0466970_0012159 | Ga0466970_0012159_3276_3833 | 166 |
| 422 | 3300045049 | Ga0466959_0080005 | Ga0466959_0080005_1268_1825 | 166 |
| 423 | 3300045836 | Ga0466958_0153823 | Ga0466958_0153823_173_730 | 166 |
| 424 | 3300047472 | Ga0495686_0003364 | Ga0495686_0003364_10241_10756 | 166 |
| 425 | 3300048903 | Ga0496100_0000383 | Ga0496100_0000383_12084_12599 | 166 |
| 426 | 3300048904 | Ga0496101_0011857 | Ga0496101_0011857_3623_4138 | 166 |
| 427 | 3300048905 | Ga0496102_0004668 | Ga0496102_0004668_10747_11262 | 166 |
| 428 | 3300048906 | Ga0496103_0002854 | Ga0496103_0002854_3469_3984 | 166 |
| 429 | 3300048907 | Ga0496104_0193330 | Ga0496104_0193330_951_1466 | 166 |
| 430 | 3300048909 | Ga0496106_0000615 | Ga0496106_0000615_13511_14026 | 166 |
| 431 | 3300048910 | Ga0496107_0001171 | Ga0496107_0001171_8914_9429 | 166 |
| 432 | 3300048911 | Ga0496108_0601994 | Ga0496108_0601994_157_672 | 166 |
| 433 | 3300048917 | Ga0496114_0000517 | Ga0496114_0000517_15211_15726 | 166 |
| 434 | 3300048918 | Ga0496115_0008256 | Ga0496115_0008256_1010_1525 | 166 |
| 435 | 3300050511 | nmdc:mga08y16_933665_c1 | nmdc:mga08y16_933665_c1_224_739 | 166 |
| 436 | 3300061719 | Ga0466962_0290710 | Ga0466962_0290710_147_704 | 166 |
| 437 | 3300005719 | Ga0068861_100293577 | Ga0068861_1002935772 | 167 |
| 438 | 3300006058 | Ga0075432_10085879 | Ga0075432_100858791 | 167 |
| 439 | 3300030521 | Ga0307511_10001365 | Ga0307511_1000136517 | 167 |
| 440 | 3300030733 | Ga0314311_1002826 | Ga0314311_10028261 | 167 |
| 441 | 3300031548 | Ga0307408_100058841 | Ga0307408_1000588412 | 167 |
| 442 | 3300031824 | Ga0307413_10329929 | Ga0307413_103299292 | 167 |
| 443 | 3300031901 | Ga0307406_10079533 | Ga0307406_100795332 | 167 |
| 444 | 3300031903 | Ga0307407_10148401 | Ga0307407_101484012 | 167 |
| 445 | 3300031903 | Ga0307407_10228782 | Ga0307407_102287822 | 167 |
| 446 | 3300031995 | Ga0307409_100114582 | Ga0307409_1001145822 | 167 |
| 447 | 3300031995 | Ga0307409_100528314 | Ga0307409_1005283142 | 167 |
| 448 | 3300046453 | Ga0495627_134968 | Ga0495627_134968_65_586 | 167 |
| 449 | iso_pu_bacteria | 2808606439 | 2809198363 | 167 |
| 450 | iso_pu_bacteria | 2919391150 | 2919395199 | 167 |
| 451 | iso_pu_bacteria | 2945956166 | 2945958916 | 167 |
| 452 | 3300001991 | JGI24743J22301_10003682 | JGI24743J22301_100036822 | 168 |
| 453 | 3300002067 | JGI24735J21928_10042444 | JGI24735J21928_100424442 | 168 |
| 454 | 3300002075 | JGI24738J21930_10007611 | JGI24738J21930_100076112 | 168 |
| 455 | 3300005328 | Ga0070676_10118520 | Ga0070676_101185201 | 168 |
| 456 | 3300005334 | Ga0068869_100035747 | Ga0068869_1000357472 | 168 |
| 457 | 3300005335 | Ga0070666_10096876 | Ga0070666_100968762 | 168 |
| 458 | 3300005336 | Ga0070680_100275773 | Ga0070680_1002757732 | 168 |
| 459 | 3300005337 | Ga0070682_100030739 | Ga0070682_1000307392 | 168 |
| 460 | 3300005337 | Ga0070682_100167042 | Ga0070682_1001670422 | 168 |
| 461 | 3300005339 | Ga0070660_100289439 | Ga0070660_1002894392 | 168 |
| 462 | 3300005340 | Ga0070689_100331091 | Ga0070689_1003310912 | 168 |
| 463 | 3300005341 | Ga0070691_10020230 | Ga0070691_100202302 | 168 |
| 464 | 3300005347 | Ga0070668_100152042 | Ga0070668_1001520422 | 168 |
| 465 | 3300005347 | Ga0070668_100197378 | Ga0070668_1001973782 | 168 |
| 466 | 3300005353 | Ga0070669_100031637 | Ga0070669_1000316372 | 168 |
| 467 | 3300005354 | Ga0070675_100340366 | Ga0070675_1003403662 | 168 |
| 468 | 3300005355 | Ga0070671_100178098 | Ga0070671_1001780982 | 168 |
| 469 | 3300005356 | Ga0070674_100212458 | Ga0070674_1002124582 | 168 |
| 470 | 3300005365 | Ga0070688_100018231 | Ga0070688_1000182312 | 168 |
| 471 | 3300005365 | Ga0070688_100144039 | Ga0070688_1001440392 | 168 |
| 472 | 3300005366 | Ga0070659_100028419 | Ga0070659_1000284193 | 168 |
| 473 | 3300005366 | Ga0070659_100038097 | Ga0070659_1000380972 | 168 |
| 474 | 3300005367 | Ga0070667_100163065 | Ga0070667_1001630652 | 168 |
| 475 | 3300005434 | Ga0070709_10014652 | Ga0070709_100146522 | 168 |
| 476 | 3300005434 | Ga0070709_10190005 | Ga0070709_101900052 | 168 |
| 477 | 3300005435 | Ga0070714_100828600 | Ga0070714_1008286001 | 168 |
| 478 | 3300005437 | Ga0070710_10007738 | Ga0070710_100077383 | 168 |
| 479 | 3300005437 | Ga0070710_10083926 | Ga0070710_100839262 | 168 |
| 480 | 3300005438 | Ga0070701_10055627 | Ga0070701_100556272 | 168 |
| 481 | 3300005439 | Ga0070711_100005711 | Ga0070711_1000057116 | 168 |
| 482 | 3300005439 | Ga0070711_100132440 | Ga0070711_1001324402 | 168 |
| 483 | 3300005440 | Ga0070705_100084114 | Ga0070705_1000841142 | 168 |
| 484 | 3300005441 | Ga0070700_100029765 | Ga0070700_1000297652 | 168 |
| 485 | 3300005444 | Ga0070694_100335162 | Ga0070694_1003351622 | 168 |
| 486 | 3300005456 | Ga0070678_100125867 | Ga0070678_1001258672 | 168 |
| 487 | 3300005456 | Ga0070678_100171114 | Ga0070678_1001711142 | 168 |
| 488 | 3300005457 | Ga0070662_100023543 | Ga0070662_1000235435 | 168 |
| 489 | 3300005457 | Ga0070662_100410529 | Ga0070662_1004105292 | 168 |
| 490 | 3300005459 | Ga0068867_100070477 | Ga0068867_1000704772 | 168 |
| 491 | 3300005459 | Ga0068867_100163388 | Ga0068867_1001633882 | 168 |
| 492 | 3300005471 | Ga0070698_100349102 | Ga0070698_1003491021 | 168 |
| 493 | 3300005536 | Ga0070697_100578301 | Ga0070697_1005783012 | 168 |
| 494 | 3300005539 | Ga0068853_100020911 | Ga0068853_1000209113 | 168 |
| 495 | 3300005543 | Ga0070672_100252351 | Ga0070672_1002523512 | 168 |
| 496 | 3300005544 | Ga0070686_100520250 | Ga0070686_1005202502 | 168 |
| 497 | 3300005545 | Ga0070695_100105423 | Ga0070695_1001054232 | 168 |
| 498 | 3300005546 | Ga0070696_100035559 | Ga0070696_1000355592 | 168 |
| 499 | 3300005546 | Ga0070696_100121686 | Ga0070696_1001216862 | 168 |
| 500 | 3300005547 | Ga0070693_100035467 | Ga0070693_1000354672 | 168 |
| 501 | 3300005547 | Ga0070693_100292561 | Ga0070693_1002925612 | 168 |
| 502 | 3300005548 | Ga0070665_100005218 | Ga0070665_1000052187 | 168 |
| 503 | 3300005548 | Ga0070665_100269005 | Ga0070665_1002690052 | 168 |
| 504 | 3300005549 | Ga0070704_100032452 | Ga0070704_1000324522 | 168 |
| 505 | 3300005549 | Ga0070704_100330316 | Ga0070704_1003303162 | 168 |
| 506 | 3300005563 | Ga0068855_100320302 | Ga0068855_1003203022 | 168 |
| 507 | 3300005563 | Ga0068855_100473773 | Ga0068855_1004737731 | 168 |
| 508 | 3300005578 | Ga0068854_100103823 | Ga0068854_1001038232 | 168 |
| 509 | 3300005578 | Ga0068854_100775741 | Ga0068854_1007757411 | 168 |
| 510 | 3300005615 | Ga0070702_100011029 | Ga0070702_1000110292 | 168 |
| 511 | 3300005616 | Ga0068852_100097532 | Ga0068852_1000975322 | 168 |
| 512 | 3300005616 | Ga0068852_100160012 | Ga0068852_1001600122 | 168 |
| 513 | 3300005617 | Ga0068859_100018292 | Ga0068859_1000182922 | 168 |
| 514 | 3300005617 | Ga0068859_100171048 | Ga0068859_1001710482 | 168 |
| 515 | 3300005718 | Ga0068866_10013634 | Ga0068866_100136342 | 168 |
| 516 | 3300005718 | Ga0068866_10069881 | Ga0068866_100698812 | 168 |
| 517 | 3300005718 | Ga0068866_10374820 | Ga0068866_103748202 | 168 |
| 518 | 3300005719 | Ga0068861_100031467 | Ga0068861_1000314672 | 168 |
| 519 | 3300005840 | Ga0068870_10130974 | Ga0068870_101309742 | 168 |
| 520 | 3300005841 | Ga0068863_100163747 | Ga0068863_1001637472 | 168 |
| 521 | 3300005842 | Ga0068858_100072930 | Ga0068858_1000729302 | 168 |
| 522 | 3300005842 | Ga0068858_100143657 | Ga0068858_1001436572 | 168 |
| 523 | 3300005843 | Ga0068860_100037958 | Ga0068860_1000379582 | 168 |
| 524 | 3300005843 | Ga0068860_100084902 | Ga0068860_1000849022 | 168 |
| 525 | 3300005844 | Ga0068862_100114511 | Ga0068862_1001145112 | 168 |
| 526 | 3300005844 | Ga0068862_100174243 | Ga0068862_1001742432 | 168 |
| 527 | 3300006028 | Ga0070717_10121739 | Ga0070717_101217392 | 168 |
| 528 | 3300006051 | Ga0075364_10591662 | Ga0075364_105916621 | 168 |
| 529 | 3300006163 | Ga0070715_10041328 | Ga0070715_100413282 | 168 |
| 530 | 3300006173 | Ga0070716_100001673 | Ga0070716_1000016733 | 168 |
| 531 | 3300006175 | Ga0070712_100056512 | Ga0070712_1000565122 | 168 |
| 532 | 3300006175 | Ga0070712_100206841 | Ga0070712_1002068412 | 168 |
| 533 | 3300006237 | Ga0097621_100217142 | Ga0097621_1002171422 | 168 |
| 534 | 3300006358 | Ga0068871_100044030 | Ga0068871_1000440302 | 168 |
| 535 | 3300006358 | Ga0068871_100274619 | Ga0068871_1002746192 | 168 |
| 536 | 3300006844 | Ga0075428_100092968 | Ga0075428_1000929682 | 168 |
| 537 | 3300006881 | Ga0068865_100461217 | Ga0068865_1004612172 | 168 |
| 538 | 3300006931 | Ga0097620_100018292 | Ga0097620_1000182922 | 168 |
| 539 | 3300006931 | Ga0097620_100171066 | Ga0097620_1001710662 | 168 |
| 540 | 3300009092 | Ga0105250_10206822 | Ga0105250_102068222 | 168 |
| 541 | 3300009098 | Ga0105245_10361532 | Ga0105245_103615322 | 168 |
| 542 | 3300009101 | Ga0105247_10094069 | Ga0105247_100940692 | 168 |
| 543 | 3300009147 | Ga0114129_10111628 | Ga0114129_101116282 | 168 |
| 544 | 3300009148 | Ga0105243_10092718 | Ga0105243_100927181 | 168 |
| 545 | 3300009148 | Ga0105243_10178741 | Ga0105243_101787412 | 168 |
| 546 | 3300009174 | Ga0105241_10030340 | Ga0105241_100303402 | 168 |
| 547 | 3300009176 | Ga0105242_10081548 | Ga0105242_100815482 | 168 |
| 548 | 3300009176 | Ga0105242_10835790 | Ga0105242_108357902 | 168 |
| 549 | 3300009177 | Ga0105248_10016388 | Ga0105248_100163882 | 168 |
| 550 | 3300009177 | Ga0105248_10027828 | Ga0105248_100278289 | 168 |
| 551 | 3300009177 | Ga0105248_10177001 | Ga0105248_101770012 | 168 |
| 552 | 3300009545 | Ga0105237_10414322 | Ga0105237_104143222 | 168 |
| 553 | 3300009551 | Ga0105238_10320379 | Ga0105238_103203792 | 168 |
| 554 | 3300009553 | Ga0105249_10378634 | Ga0105249_103786342 | 168 |
| 555 | 3300011119 | Ga0105246_10018879 | Ga0105246_100188792 | 168 |
| 556 | 3300011119 | Ga0105246_11397793 | Ga0105246_113977931 | 168 |
| 557 | 3300013105 | Ga0157369_10375380 | Ga0157369_103753802 | 168 |
| 558 | 3300013296 | Ga0157374_10047682 | Ga0157374_100476822 | 168 |
| 559 | 3300013296 | Ga0157374_10052951 | Ga0157374_100529512 | 168 |
| 560 | 3300013297 | Ga0157378_10030416 | Ga0157378_100304162 | 168 |
| 561 | 3300013297 | Ga0157378_10978990 | Ga0157378_109789902 | 168 |
| 562 | 3300013306 | Ga0163162_10120757 | Ga0163162_101207572 | 168 |
| 563 | 3300013306 | Ga0163162_10210930 | Ga0163162_102109302 | 168 |
| 564 | 3300013306 | Ga0163162_10630926 | Ga0163162_106309262 | 168 |
| 565 | 3300013306 | Ga0163162_11750459 | Ga0163162_117504591 | 168 |
| 566 | 3300013307 | Ga0157372_10303835 | Ga0157372_103038351 | 168 |
| 567 | 3300013307 | Ga0157372_11187422 | Ga0157372_111874221 | 168 |
| 568 | 3300013308 | Ga0157375_10228743 | Ga0157375_102287432 | 168 |
| 569 | 3300013308 | Ga0157375_10303332 | Ga0157375_103033322 | 168 |
| 570 | 3300013308 | Ga0157375_10337393 | Ga0157375_103373932 | 168 |
| 571 | 3300014325 | Ga0163163_11921292 | Ga0163163_119212921 | 168 |
| 572 | 3300014326 | Ga0157380_10023621 | Ga0157380_100236213 | 168 |
| 573 | 3300014326 | Ga0157380_10542956 | Ga0157380_105429562 | 168 |
| 574 | 3300014745 | Ga0157377_10019708 | Ga0157377_100197082 | 168 |
| 575 | 3300014745 | Ga0157377_10021065 | Ga0157377_100210652 | 168 |
| 576 | 3300014968 | Ga0157379_10181559 | Ga0157379_101815592 | 168 |
| 577 | 3300014969 | Ga0157376_10171043 | Ga0157376_101710432 | 168 |
| 578 | 3300014969 | Ga0157376_10355796 | Ga0157376_103557962 | 168 |
| 579 | 3300017792 | Ga0163161_10338074 | Ga0163161_103380742 | 168 |
| 580 | 3300025898 | Ga0207692_10027995 | Ga0207692_100279952 | 168 |
| 581 | 3300025899 | Ga0207642_10049043 | Ga0207642_100490432 | 168 |
| 582 | 3300025899 | Ga0207642_10067860 | Ga0207642_100678602 | 168 |
| 583 | 3300025899 | Ga0207642_10306547 | Ga0207642_103065472 | 168 |
| 584 | 3300025900 | Ga0207710_10309640 | Ga0207710_103096401 | 168 |
| 585 | 3300025901 | Ga0207688_10004903 | Ga0207688_100049035 | 168 |
| 586 | 3300025904 | Ga0207647_10008739 | Ga0207647_100087395 | 168 |
| 587 | 3300025904 | Ga0207647_10060164 | Ga0207647_100601642 | 168 |
| 588 | 3300025905 | Ga0207685_10028489 | Ga0207685_100284892 | 168 |
| 589 | 3300025906 | Ga0207699_10057278 | Ga0207699_100572782 | 168 |
| 590 | 3300025908 | Ga0207643_10185680 | Ga0207643_101856802 | 168 |
| 591 | 3300025911 | Ga0207654_10159947 | Ga0207654_101599472 | 168 |
| 592 | 3300025914 | Ga0207671_10234171 | Ga0207671_102341712 | 168 |
| 593 | 3300025915 | Ga0207693_10004862 | Ga0207693_100048628 | 168 |
| 594 | 3300025915 | Ga0207693_10006779 | Ga0207693_100067796 | 168 |
| 595 | 3300025916 | Ga0207663_10006272 | Ga0207663_100062722 | 168 |
| 596 | 3300025916 | Ga0207663_10045140 | Ga0207663_100451402 | 168 |
| 597 | 3300025917 | Ga0207660_10374424 | Ga0207660_103744242 | 168 |
| 598 | 3300025919 | Ga0207657_10206611 | Ga0207657_102066112 | 168 |
| 599 | 3300025923 | Ga0207681_10032097 | Ga0207681_100320972 | 168 |
| 600 | 3300025923 | Ga0207681_10443862 | Ga0207681_104438622 | 168 |
| 601 | 3300025927 | Ga0207687_10200706 | Ga0207687_102007062 | 168 |
| 602 | 3300025928 | Ga0207700_11046575 | Ga0207700_110465752 | 168 |
| 603 | 3300025929 | Ga0207664_10533673 | Ga0207664_105336732 | 168 |
| 604 | 3300025933 | Ga0207706_10012019 | Ga0207706_100120198 | 168 |
| 605 | 3300025933 | Ga0207706_10014036 | Ga0207706_100140365 | 168 |
| 606 | 3300025933 | Ga0207706_10372102 | Ga0207706_103721022 | 168 |
| 607 | 3300025934 | Ga0207686_10078273 | Ga0207686_100782732 | 168 |
| 608 | 3300025935 | Ga0207709_10071722 | Ga0207709_100717222 | 168 |
| 609 | 3300025937 | Ga0207669_10027073 | Ga0207669_100270732 | 168 |
| 610 | 3300025937 | Ga0207669_10250046 | Ga0207669_102500461 | 168 |
| 611 | 3300025937 | Ga0207669_10257420 | Ga0207669_102574202 | 168 |
| 612 | 3300025938 | Ga0207704_10138481 | Ga0207704_101384812 | 168 |
| 613 | 3300025938 | Ga0207704_10165215 | Ga0207704_101652151 | 168 |
| 614 | 3300025939 | Ga0207665_10006046 | Ga0207665_100060462 | 168 |
| 615 | 3300025939 | Ga0207665_10031079 | Ga0207665_100310792 | 168 |
| 616 | 3300025940 | Ga0207691_10142949 | Ga0207691_101429492 | 168 |
| 617 | 3300025941 | Ga0207711_10108648 | Ga0207711_101086482 | 168 |
| 618 | 3300025941 | Ga0207711_10556727 | Ga0207711_105567271 | 168 |
| 619 | 3300025942 | Ga0207689_10012362 | Ga0207689_100123622 | 168 |
| 620 | 3300025949 | Ga0207667_10596152 | Ga0207667_105961522 | 168 |
| 621 | 3300025961 | Ga0207712_10259405 | Ga0207712_102594051 | 168 |
| 622 | 3300025972 | Ga0207668_10111361 | Ga0207668_101113612 | 168 |
| 623 | 3300025972 | Ga0207668_10134239 | Ga0207668_101342392 | 168 |
| 624 | 3300025972 | Ga0207668_10188472 | Ga0207668_101884722 | 168 |
| 625 | 3300025981 | Ga0207640_10116261 | Ga0207640_101162612 | 168 |
| 626 | 3300025981 | Ga0207640_10264466 | Ga0207640_102644662 | 168 |
| 627 | 3300025986 | Ga0207658_10312260 | Ga0207658_103122602 | 168 |
| 628 | 3300026023 | Ga0207677_10075635 | Ga0207677_100756352 | 168 |
| 629 | 3300026023 | Ga0207677_10384001 | Ga0207677_103840012 | 168 |
| 630 | 3300026035 | Ga0207703_10055283 | Ga0207703_100552833 | 168 |
| 631 | 3300026035 | Ga0207703_10464993 | Ga0207703_104649932 | 168 |
| 632 | 3300026067 | Ga0207678_10024038 | Ga0207678_100240386 | 168 |
| 633 | 3300026075 | Ga0207708_10063951 | Ga0207708_100639512 | 168 |
| 634 | 3300026088 | Ga0207641_10451556 | Ga0207641_104515562 | 168 |
| 635 | 3300026089 | Ga0207648_10033327 | Ga0207648_100333273 | 168 |
| 636 | 3300026089 | Ga0207648_10120299 | Ga0207648_101202992 | 168 |
| 637 | 3300026118 | Ga0207675_100041890 | Ga0207675_1000418902 | 168 |
| 638 | 3300026118 | Ga0207675_100723494 | Ga0207675_1007234942 | 168 |
| 639 | 3300026121 | Ga0207683_10013403 | Ga0207683_100134035 | 168 |
| 640 | 3300026142 | Ga0207698_10073687 | Ga0207698_100736872 | 168 |
| 641 | 3300028379 | Ga0268266_10673515 | Ga0268266_106735152 | 168 |
| 642 | 3300028380 | Ga0268265_10379022 | Ga0268265_103790222 | 168 |
| 643 | 3300028381 | Ga0268264_10586425 | Ga0268264_105864252 | 168 |
| 644 | 3300028381 | Ga0268264_10684798 | Ga0268264_106847982 | 168 |
| 645 | 3300031731 | Ga0307405_10458926 | Ga0307405_104589261 | 168 |
| 646 | 3300031824 | Ga0307413_10064012 | Ga0307413_100640122 | 168 |
| 647 | 3300031852 | Ga0307410_10093619 | Ga0307410_100936191 | 168 |
| 648 | 3300031903 | Ga0307407_10002834 | Ga0307407_100028342 | 168 |
| 649 | 3300031995 | Ga0307409_100042297 | Ga0307409_1000422972 | 168 |
| 650 | 3300032002 | Ga0307416_100150513 | Ga0307416_1001505132 | 168 |
| 651 | 3300032126 | Ga0307415_100230900 | Ga0307415_1002309002 | 168 |
| 652 | 3300034820 | Ga0373959_0067870 | Ga0373959_0067870_21_539 | 168 |
| 653 | 3300035112 | Ga0373932_0021433 | Ga0373932_0021433_323_862 | 168 |
| 654 | 3300035121 | Ga0373960_0051766 | Ga0373960_0051766_46_585 | 168 |
| 655 | 3300035207 | Ga0373942_0108728 | Ga0373942_0108728_174_713 | 168 |
| 656 | 3300035691 | Ga0373931_0126691 | Ga0373931_0126691_493_1032 | 168 |
| 657 | 3300042005 | Ga0439448_0027472 | Ga0439448_0027472_223_747 | 168 |
| 658 | 3300044683 | Ga0466965_0380622 | Ga0466965_0380622_216_764 | 168 |
| 659 | 3300044901 | Ga0466960_0394323 | Ga0466960_0394323_215_763 | 168 |
| 660 | 3300046471 | Ga0495650_0056992 | Ga0495650_0056992_403_927 | 168 |
| 661 | 3300046492 | Ga0495585_0265819 | Ga0495585_0265819_135_653 | 168 |
| 662 | 3300046518 | Ga0495631_0308848 | Ga0495631_0308848_113_631 | 168 |
| 663 | 3300046615 | Ga0495656_0052761 | Ga0495656_0052761_788_1324 | 168 |
| 664 | 3300046684 | Ga0495669_0164467 | Ga0495669_0164467_470_988 | 168 |
| 665 | 3300046794 | Ga0495589_0209124 | Ga0495589_0209124_13_531 | 168 |
| 666 | 3300047673 | Ga0495593_0099908 | Ga0495593_0099908_681_1199 | 168 |
| 667 | 3300048903 | Ga0496100_0004863 | Ga0496100_0004863_4169_4687 | 168 |
| 668 | 3300048903 | Ga0496100_0184615 | Ga0496100_0184615_685_1224 | 168 |
| 669 | 3300048904 | Ga0496101_0000593 | Ga0496101_0000593_17723_18241 | 168 |
| 670 | 3300048904 | Ga0496101_0126305 | Ga0496101_0126305_338_877 | 168 |
| 671 | 3300048905 | Ga0496102_0084290 | Ga0496102_0084290_1393_1932 | 168 |
| 672 | 3300048905 | Ga0496102_0415120 | Ga0496102_0415120_115_633 | 168 |
| 673 | 3300048905 | Ga0496102_1244908 | Ga0496102_1244908_104_622 | 168 |
| 674 | 3300048906 | Ga0496103_0054478 | Ga0496103_0054478_441_980 | 168 |
| 675 | 3300048907 | Ga0496104_0006811 | Ga0496104_0006811_6498_7016 | 168 |
| 676 | 3300048907 | Ga0496104_0018259 | Ga0496104_0018259_5375_5914 | 168 |
| 677 | 3300048909 | Ga0496106_0039922 | Ga0496106_0039922_2600_3118 | 168 |
| 678 | 3300048909 | Ga0496106_0102409 | Ga0496106_0102409_897_1436 | 168 |
| 679 | 3300048909 | Ga0496106_0365916 | Ga0496106_0365916_381_899 | 168 |
| 680 | 3300048910 | Ga0496107_0027686 | Ga0496107_0027686_369_887 | 168 |
| 681 | 3300048910 | Ga0496107_0186574 | Ga0496107_0186574_786_1304 | 168 |
| 682 | 3300048910 | Ga0496107_0255911 | Ga0496107_0255911_294_833 | 168 |
| 683 | 3300048911 | Ga0496108_0004415 | Ga0496108_0004415_5679_6218 | 168 |
| 684 | 3300048912 | Ga0496109_0028038 | Ga0496109_0028038_1862_2401 | 168 |
| 685 | 3300048913 | Ga0496110_0088759 | Ga0496110_0088759_1303_1842 | 168 |
| 686 | 3300048914 | Ga0496111_0368990 | Ga0496111_0368990_61_600 | 168 |
| 687 | 3300048917 | Ga0496114_0040677 | Ga0496114_0040677_2597_3115 | 168 |
| 688 | 3300048917 | Ga0496114_0426964 | Ga0496114_0426964_324_842 | 168 |
| 689 | 3300048918 | Ga0496115_0053453 | Ga0496115_0053453_1464_1982 | 168 |
| 690 | 3300048918 | Ga0496115_0118950 | Ga0496115_0118950_1332_1871 | 168 |
| 691 | 3300048918 | Ga0496115_1089090 | Ga0496115_1089090_13_531 | 168 |
| 692 | 3300049577 | Ga0501041_0098351 | Ga0501041_0098351_1160_1678 | 168 |
| 693 | 3300049578 | Ga0501042_0223871 | Ga0501042_0223871_462_980 | 168 |
| 694 | 3300049591 | Ga0501075_0580022 | Ga0501075_0580022_61_579 | 168 |
| 695 | 3300049592 | Ga0501076_0623511 | Ga0501076_0623511_248_769 | 168 |
| 696 | 3300050507 | nmdc:mga05p37_151291_c1 | nmdc:mga05p37_151291_c1_331_855 | 168 |
| 697 | 3300050509 | nmdc:mga0qj67_232358_c1 | nmdc:mga0qj67_232358_c1_702_1226 | 168 |
| 698 | 3300053104 | Ga0500556_0000472 | Ga0500556_0000472_4404_4940 | 168 |
| 699 | 3300053108 | Ga0500562_015745 | Ga0500562_015745_651_1187 | 168 |
| 700 | 3300053117 | Ga0500593_003899 | Ga0500593_003899_1309_1845 | 168 |
| 701 | 3300053129 | Ga0500628_136542 | Ga0500628_136542_112_648 | 168 |
| 702 | 3300053133 | Ga0500655_002692 | Ga0500655_002692_928_1464 | 168 |
| 703 | 3300053155 | Ga0500620_115434 | Ga0500620_115434_68_592 | 168 |
| 704 | 3300061734 | Ga0530510_0010046 | Ga0530510_0010046_4481_5002 | 168 |
| 705 | iso_pu_bacteria | 2904770941 | 2904772433 | 168 |
| 706 | 3300031852 | Ga0307410_10070078 | Ga0307410_100700783 | 169 |
| 707 | 3300031995 | Ga0307409_100356020 | Ga0307409_1003560202 | 169 |
| 708 | 3300032002 | Ga0307416_101509024 | Ga0307416_1015090241 | 169 |
| 709 | 3300032004 | Ga0307414_10588819 | Ga0307414_105888192 | 169 |
| 710 | 3300037853 | Ga0436364_0139643 | Ga0436364_0139643_1063_1632 | 169 |
| 711 | 3300045976 | Ga0466967_0003341 | Ga0466967_0003341_6136_6660 | 169 |
| 712 | 3300046691 | Ga0495670_0057578 | Ga0495670_0057578_771_1298 | 169 |
| 713 | 3300053153 | Ga0500616_0000027 | Ga0500616_0000027_418839_419366 | 169 |
| 714 | 3300053730 | Ga0500645_004203 | Ga0500645_004203_1060_1587 | 169 |
| 715 | 3300000549 | LJQas_1000116 | LJQas_10001163 | 170 |
| 716 | 3300000549 | LJQas_1004960 | LJQas_10049602 | 170 |
| 717 | 3300006058 | Ga0075432_10004226 | Ga0075432_100042262 | 170 |
| 718 | 3300025912 | Ga0207707_11068289 | Ga0207707_110682891 | 170 |
| 719 | 3300025918 | Ga0207662_10314910 | Ga0207662_103149102 | 170 |
| 720 | 3300027907 | Ga0207428_10006323 | Ga0207428_100063237 | 170 |
| 721 | 3300031852 | Ga0307410_10101609 | Ga0307410_101016092 | 170 |
| 722 | 3300041404 | Ga0439436_0007353 | Ga0439436_0007353_1560_2105 | 170 |
| 723 | 3300041405 | Ga0439438_027619 | Ga0439438_027619_73_618 | 170 |
| 724 | 3300041406 | Ga0439439_0014801 | Ga0439439_0014801_336_881 | 170 |
| 725 | 3300041411 | Ga0439466_0014804 | Ga0439466_0014804_689_1234 | 170 |
| 726 | 3300041413 | Ga0439465_0026887 | Ga0439465_0026887_1137_1682 | 170 |
| 727 | 3300041453 | Ga0451797_1178160 | Ga0451797_1178160_467_997 | 170 |
| 728 | 3300041999 | Ga0439433_0001119 | Ga0439433_0001119_4013_4558 | 170 |
| 729 | 3300042002 | Ga0439442_000790 | Ga0439442_000790_4430_4975 | 170 |
| 730 | 3300042007 | Ga0439449_0001002 | Ga0439449_0001002_2474_3019 | 170 |
| 731 | 3300042010 | Ga0439452_030960 | Ga0439452_030960_301_846 | 170 |
| 732 | 3300042014 | Ga0439457_005622 | Ga0439457_005622_736_1281 | 170 |
| 733 | 3300042015 | Ga0439462_0007839 | Ga0439462_0007839_1274_1819 | 170 |
| 734 | 3300042435 | Ga0439434_0031878 | Ga0439434_0031878_65_610 | 170 |
| 735 | 3300048905 | Ga0496102_0457661 | Ga0496102_0457661_344_880 | 170 |
| 736 | 3300048906 | Ga0496103_0054366 | Ga0496103_0054366_1850_2386 | 170 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3e99-assembly1.cif.gz_A | crystal structure of the beta subunit of the benzoate 1,2-dioxygenase (benb, bmaa0186) from burkholderia mallei atcc 23344 at 1.90 a resolution | 0.9196 | 8 | 170 |
| 3e99-assembly1.cif.gz_A | crystal structure of the beta subunit of the benzoate 1,2-dioxygenase (benb, bmaa0186) from burkholderia mallei atcc 23344 at 1.90 a resolution | 0.9078 | 8 | 170 |
| 3eby-assembly1.cif.gz_A | crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (yp_001165631.1) from novosphingobium aromaticivorans dsm 12444 at 1.75 a resolution | 0.8499 | 12 | 165 |
| 7urz-assembly1.cif.gz_B | hexadecameric hub domain of camkii beta | 0.8309 | 11 | 158 |
| 7urz-assembly1.cif.gz_G | hexadecameric hub domain of camkii beta | 0.8231 | 15 | 158 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3e99A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9184 | 8 | 170 | 3.10.450.50 |
| 3e99A00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9124 | 8 | 170 | 3.10.450.50 |
| 3ebyA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8651 | 12 | 161 | 3.10.450.50 |
| 2chcB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8263 | 15 | 158 | 3.10.450.50 |
| af_O07237_11_153_3.10.450.50 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8244 | 15 | 160 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A243SX33-F1-model_v4 | deleted | 0.9184 | 95 | 170 |
|
| AF-A0A5E7FVH8-F1-model_v4 | Uncharacterized protein | 0.9137 | 94 | 162 |
|
| AF-A0A243SX33-F1-model_v4 | deleted | 0.9069 | 95 | 170 |
|
| AF-A0A4R4ME56-F1-model_v4 | deleted | 0.9036 | 91 | 162 |
|
| AF-A0A090YWA0-F1-model_v4 | Putative transcriptional regulator, Bla/Mec | 0.8968 | 96 | 157 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar