F478284

General Info

Members Datasets Scaffolds Average Seq Length
736 364 709 170

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0139643|Ga0436364_0139643_1063_1632
Length 189
Sequence VSDALEQQEQREQAEWPAETPAGGHTFGIVLEDVRQFLYREARYLDDREFEQWLECYHSDAEFWMPAWADDDNVTTDPQSEISLVYYPNRAGLEDRVFRIRTDRSSATSLPEPRTGHNITNVEITGQEGAFVDVRFNWFTLYYRYQTVDTYFGTSFYRLDLSGPKPLITRKKVVLKNDYVHHVVDIYHV

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
3 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
4 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
5 2643221561 Nocardioides sp. Root151 Isolate Unclassified
6 2643221696 Nocardioides sp. Root140 Isolate Unclassified
7 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
8 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
9 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
10 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
11 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
12 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
13 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
14 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
15 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
16 2862574272 Streptomyces sp. AcE210 Isolate Nodule
17 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
18 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
19 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
20 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
21 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
22 2922554459 Rhodococcus sp. 66b Isolate Unclassified
23 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
24 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
25 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
26 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
27 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
28 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
29 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
30 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
31 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
32 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
34 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
35 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
48 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
49 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
50 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
70 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
71 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
74 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
75 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
83 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
89 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
90 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
105 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
108 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
109 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
110 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
111 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
112 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
116 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
117 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
118 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
119 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
121 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
122 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
123 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
124 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
125 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
126 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
127 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
128 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
129 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
141 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
142 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
143 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
144 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
150 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
154 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
215 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
219 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
220 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
223 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
224 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
232 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
233 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
234 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
235 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
236 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
237 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
238 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
239 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
243 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
244 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
245 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
246 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
247 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
248 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
249 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
250 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
251 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
252 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
253 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
254 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
255 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
256 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
257 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
258 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
259 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
260 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
261 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
262 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
263 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
264 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
265 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
266 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
267 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
268 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
269 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
270 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
271 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
272 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
273 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
276 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
277 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
278 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
287 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
288 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
293 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
294 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
295 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
300 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
304 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
305 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
306 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
307 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
322 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
323 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
328 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
329 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
330 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
335 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
336 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
337 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
338 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
339 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
340 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
341 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
342 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
343 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
344 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
345 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
346 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
347 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
348 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
349 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
350 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
351 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
352 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
363 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
364 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.49
Metatranscriptomes 5.84
Isolates 3.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.31
Nodule 0.27
Rhizoplane 7.74
Rhizosphere 86.55
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000116 3300000549 Bacteria 13834
2 LJQas_1004960 3300000549 Bacteria 1705
3 JGI24737J22298_10049507 3300001990 Bacteria 1278
4 JGI24743J22301_10003682 3300001991 Bacteria 2445
5 JGI24735J21928_10042444 3300002067 Bacteria 1324
6 JGI24738J21930_10007611 3300002075 Bacteria 2492
7 JGI24034J26672_10005656 3300002239 Bacteria 1795
8 JGI25406J46586_10079730 3300003203 Bacteria 1007
9 Ga0058858_1421484 3300004785 Bacteria 1590
10 Ga0058859_10009161 3300004798 Bacteria 1625
11 Ga0058863_10041758 3300004799 Bacteria 1474
12 Ga0058861_10087982 3300004800 Bacteria 2685
13 Ga0058862_10099156 3300004803 Bacteria 2414
14 Ga0070658_10130570 3300005327 Bacteria 2093
15 Ga0070676_10020890 3300005328 Bacteria 3661
16 Ga0070676_10118520 3300005328 Bacteria 1658
17 Ga0070683_100567343 3300005329 Bacteria 1085
18 Ga0070670_100209071 3300005331 Bacteria 1696
19 Ga0068869_100035747 3300005334 Bacteria 3523
20 Ga0068869_100039798 3300005334 Bacteria 3359
21 Ga0070666_10009026 3300005335 Bacteria 6211
22 Ga0070666_10096876 3300005335 Bacteria 2031
23 Ga0070680_100275773 3300005336 Bacteria 1424
24 Ga0070682_100030739 3300005337 Bacteria 3245
25 Ga0070682_100042072 3300005337 Bacteria 2819
26 Ga0070682_100167042 3300005337 Bacteria 1526
27 Ga0070682_100174053 3300005337 Bacteria 1498
28 Ga0070682_100361567 3300005337 Bacteria 1085
29 Ga0068868_100000203 3300005338 Bacteria 40057
30 Ga0068868_100219671 3300005338 Bacteria 1590
31 Ga0070660_100289439 3300005339 Bacteria 1341
32 Ga0070689_100040615 3300005340 Bacteria 3568
33 Ga0070689_100331091 3300005340 Bacteria 1274
34 Ga0070691_10000914 3300005341 Bacteria 11972
35 Ga0070691_10020230 3300005341 Bacteria 3074
36 Ga0070692_10019671 3300005345 Bacteria 3262
37 Ga0070668_100005307 3300005347 Bacteria 9566
38 Ga0070668_100152042 3300005347 Bacteria 1872
39 Ga0070668_100197378 3300005347 Bacteria 1651
40 Ga0070668_101364615 3300005347 Bacteria 646
41 Ga0070669_100031637 3300005353 Bacteria 3822
42 Ga0070669_100065201 3300005353 Bacteria 2683
43 Ga0070675_100087473 3300005354 Bacteria 2605
44 Ga0070675_100340366 3300005354 Bacteria 1328
45 Ga0070675_100765381 3300005354 Bacteria 881
46 Ga0070671_100021227 3300005355 Bacteria 5304
47 Ga0070671_100178098 3300005355 Bacteria 1799
48 Ga0070674_100000244 3300005356 Bacteria 26961
49 Ga0070674_100212458 3300005356 Bacteria 1500
50 Ga0070673_100449356 3300005364 Bacteria 1159
51 Ga0070688_100002188 3300005365 Bacteria 9856
52 Ga0070688_100018231 3300005365 Bacteria 4047
53 Ga0070688_100144039 3300005365 Bacteria 1622
54 Ga0070659_100028419 3300005366 Bacteria 4319
55 Ga0070659_100038097 3300005366 Bacteria 3749
56 Ga0070659_100049761 3300005366 Bacteria 3296
57 Ga0070659_100088400 3300005366 Bacteria 2481
58 Ga0070667_100066954 3300005367 Bacteria 3053
59 Ga0070667_100163065 3300005367 Bacteria 1964
60 Ga0070667_100850445 3300005367 Bacteria 848
61 Ga0070709_10014652 3300005434 Bacteria 4438
62 Ga0070709_10159348 3300005434 Bacteria 1568
63 Ga0070709_10190005 3300005434 Bacteria 1448
64 Ga0070709_10804763 3300005434 Bacteria 738
65 Ga0070714_100828600 3300005435 Bacteria 897
66 Ga0070713_100976370 3300005436 Bacteria 817
67 Ga0070710_10007738 3300005437 Bacteria 5212
68 Ga0070710_10025259 3300005437 Bacteria 3145
69 Ga0070710_10083926 3300005437 Bacteria 1865
70 Ga0070701_10055627 3300005438 Bacteria 2068
71 Ga0070711_100002396 3300005439 Bacteria 10681
72 Ga0070711_100005711 3300005439 Bacteria 7459
73 Ga0070711_100132440 3300005439 Bacteria 1858
74 Ga0070705_100005263 3300005440 Bacteria 6289
75 Ga0070705_100084114 3300005440 Bacteria 1963
76 Ga0070700_100012566 3300005441 Bacteria 4730
77 Ga0070700_100029765 3300005441 Bacteria 3258
78 Ga0070694_100044216 3300005444 Bacteria 2980
79 Ga0070694_100335162 3300005444 Bacteria 1168
80 Ga0070663_100012067 3300005455 Bacteria 5452
81 Ga0070663_100173838 3300005455 Bacteria 1666
82 Ga0070663_100694125 3300005455 Bacteria 864
83 Ga0070678_100125867 3300005456 Bacteria 2028
84 Ga0070678_100148518 3300005456 Bacteria 1885
85 Ga0070678_100171114 3300005456 Bacteria 1769
86 Ga0070678_100402445 3300005456 Bacteria 1189
87 Ga0070662_100000713 3300005457 Bacteria 20417
88 Ga0070662_100023543 3300005457 Bacteria 4231
89 Ga0070662_100190515 3300005457 Bacteria 1621
90 Ga0070662_100410529 3300005457 Bacteria 1119
91 Ga0068867_100001211 3300005459 Bacteria 17725
92 Ga0068867_100070477 3300005459 Bacteria 2613
93 Ga0068867_100163388 3300005459 Bacteria 1757
94 Ga0068867_100579396 3300005459 Bacteria 976
95 Ga0070685_10405609 3300005466 Bacteria 945
96 Ga0070685_10924288 3300005466 Bacteria 650
97 Ga0070706_101140514 3300005467 Bacteria 717
98 Ga0070698_100349102 3300005471 Bacteria 1411
99 Ga0070679_100231529 3300005530 Bacteria 1807
100 Ga0070684_100259830 3300005535 Bacteria 1588
101 Ga0070684_100790738 3300005535 Bacteria 887
102 Ga0070697_100578301 3300005536 Bacteria 986
103 Ga0068853_100020911 3300005539 Bacteria 5445
104 Ga0070672_100084142 3300005543 Bacteria 2554
105 Ga0070672_100252351 3300005543 Bacteria 1486
106 Ga0070686_100520250 3300005544 Bacteria 926
107 Ga0070695_100002690 3300005545 Bacteria 10289
108 Ga0070695_100105423 3300005545 Bacteria 1905
109 Ga0070696_100035559 3300005546 Bacteria 3431
110 Ga0070696_100044126 3300005546 Bacteria 3087
111 Ga0070696_100121686 3300005546 Bacteria 1889
112 Ga0070693_100035467 3300005547 Bacteria 2767
113 Ga0070693_100094314 3300005547 Bacteria 1810
114 Ga0070693_100292561 3300005547 Bacteria 1095
115 Ga0070693_100312734 3300005547 Bacteria 1063
116 Ga0070665_100005218 3300005548 Bacteria 13443
117 Ga0070665_100269005 3300005548 Bacteria 1706
118 Ga0070665_100443494 3300005548 Bacteria 1307
119 Ga0070665_100915168 3300005548 Bacteria 890
120 Ga0070665_101299194 3300005548 Bacteria 737
121 Ga0070704_100032452 3300005549 Bacteria 3522
122 Ga0070704_100330316 3300005549 Bacteria 1280
123 Ga0068855_100184547 3300005563 Bacteria 2357
124 Ga0068855_100320302 3300005563 Bacteria 1714
125 Ga0068855_100473773 3300005563 Bacteria 1363
126 Ga0068855_101153401 3300005563 Bacteria 808
127 Ga0068857_100068268 3300005577 Bacteria 3164
128 Ga0068854_100000262 3300005578 Bacteria 35841
129 Ga0068854_100017580 3300005578 Bacteria 4785
130 Ga0068854_100103823 3300005578 Bacteria 2134
131 Ga0068854_100775741 3300005578 Bacteria 833
132 Ga0068854_101038324 3300005578 Bacteria 727
133 Ga0068856_100095930 3300005614 Bacteria 2954
134 Ga0068856_100226532 3300005614 Bacteria 1885
135 Ga0070702_100001129 3300005615 Bacteria 10713
136 Ga0070702_100011029 3300005615 Bacteria 4482
137 Ga0068852_100097532 3300005616 Bacteria 2645
138 Ga0068852_100160012 3300005616 Bacteria 2102
139 Ga0068852_100316407 3300005616 Bacteria 1514
140 Ga0068852_100328356 3300005616 Bacteria 1488
141 Ga0068852_100396309 3300005616 Bacteria 1357
142 Ga0068859_100002266 3300005617 Bacteria 19509
143 Ga0068859_100018292 3300005617 Bacteria 7045
144 Ga0068859_100171048 3300005617 Bacteria 2253
145 Ga0068859_100903846 3300005617 Bacteria 967
146 Ga0068859_101674409 3300005617 Bacteria 703
147 Ga0068864_100357442 3300005618 Bacteria 1379
148 Ga0068864_100380674 3300005618 Bacteria 1337
149 Ga0068866_10000681 3300005718 Bacteria 15451
150 Ga0068866_10013634 3300005718 Bacteria 3572
151 Ga0068866_10069881 3300005718 Bacteria 1851
152 Ga0068866_10366871 3300005718 Bacteria 919
153 Ga0068866_10374820 3300005718 Bacteria 911
154 Ga0068861_100018017 3300005719 Bacteria 5022
155 Ga0068861_100031467 3300005719 Bacteria 3898
156 Ga0068861_100293577 3300005719 Bacteria 1405
157 Ga0068851_10036766 3300005834 Bacteria 2453
158 Ga0068870_10130974 3300005840 Bacteria 1457
159 Ga0068870_10374851 3300005840 Bacteria 919
160 Ga0068863_100064551 3300005841 Bacteria 3462
161 Ga0068863_100163747 3300005841 Bacteria 2132
162 Ga0068863_100325055 3300005841 Bacteria 1494
163 Ga0068858_100001689 3300005842 Bacteria 22563
164 Ga0068858_100072930 3300005842 Bacteria 3186
165 Ga0068858_100102866 3300005842 Bacteria 2664
166 Ga0068858_100143657 3300005842 Bacteria 2241
167 Ga0068858_100544263 3300005842 Bacteria 1124
168 Ga0068860_100001255 3300005843 Bacteria 27661
169 Ga0068860_100037958 3300005843 Bacteria 4609
170 Ga0068860_100084902 3300005843 Bacteria 3011
171 Ga0068860_100376133 3300005843 Bacteria 1402
172 Ga0068860_101278075 3300005843 Bacteria 754
173 Ga0068862_100001317 3300005844 Bacteria 23074
174 Ga0068862_100114511 3300005844 Bacteria 2370
175 Ga0068862_100174243 3300005844 Bacteria 1927
176 Ga0068862_100384621 3300005844 Bacteria 1309
177 Ga0081455_10007611 3300005937 Bacteria 11384
178 Ga0081455_10018209 3300005937 Bacteria 6704
179 Ga0081539_10006743 3300005985 Bacteria 10787
180 Ga0081539_10031667 3300005985 Bacteria 3255
181 Ga0070717_10121739 3300006028 Bacteria 2236
182 Ga0075365_10215282 3300006038 Bacteria 1347
183 Ga0075364_10244722 3300006051 Bacteria 1218
184 Ga0075364_10591662 3300006051 Bacteria 758
185 Ga0075432_10004226 3300006058 Bacteria 4887
186 Ga0075432_10085879 3300006058 Bacteria 1146
187 Ga0070715_10016658 3300006163 Bacteria 2767
188 Ga0070715_10041328 3300006163 Bacteria 1932
189 Ga0070716_100001673 3300006173 Bacteria 9998
190 Ga0070716_100001813 3300006173 Bacteria 9669
191 Ga0070712_100001225 3300006175 Bacteria 15514
192 Ga0070712_100056512 3300006175 Bacteria 2753
193 Ga0070712_100206841 3300006175 Bacteria 1545
194 Ga0097621_100038572 3300006237 Bacteria 3834
195 Ga0097621_100217142 3300006237 Bacteria 1665
196 Ga0068871_100044030 3300006358 Bacteria 3588
197 Ga0068871_100080370 3300006358 Bacteria 2699
198 Ga0068871_100274619 3300006358 Bacteria 1473
199 Ga0075428_100092968 3300006844 Bacteria 3288
200 Ga0068865_100300952 3300006881 Bacteria 1284
201 Ga0068865_100461217 3300006881 Bacteria 1052
202 Ga0097620_100002267 3300006931 Bacteria 19509
203 Ga0097620_100018292 3300006931 Bacteria 7045
204 Ga0097620_100171066 3300006931 Bacteria 2253
205 Ga0097620_100903897 3300006931 Bacteria 967
206 Ga0097620_101674463 3300006931 Bacteria 703
207 Ga0105251_10137392 3300009011 Bacteria 1106
208 Ga0105250_10206822 3300009092 Bacteria 829
209 Ga0111539_10438119 3300009094 Bacteria 1522
210 Ga0111539_10690177 3300009094 Bacteria 1188
211 Ga0111539_10861476 3300009094 Bacteria 1054
212 Ga0111539_10902890 3300009094 Bacteria 1028
213 Ga0111539_11205917 3300009094 Bacteria 879
214 Ga0105245_10001005 3300009098 Bacteria 25622
215 Ga0105245_10092913 3300009098 Bacteria 2779
216 Ga0105245_10207686 3300009098 Bacteria 1883
217 Ga0105245_10361532 3300009098 Bacteria 1441
218 Ga0105247_10000372 3300009101 Bacteria 38190
219 Ga0105247_10094069 3300009101 Bacteria 1906
220 Ga0105247_10185883 3300009101 Bacteria 1389
221 Ga0105247_10213937 3300009101 Bacteria 1301
222 Ga0105247_10714032 3300009101 Bacteria 756
223 Ga0105247_10954126 3300009101 Bacteria 666
224 Ga0114129_10111628 3300009147 Bacteria 3772
225 Ga0105243_10000676 3300009148 Bacteria 33249
226 Ga0105243_10092718 3300009148 Bacteria 2491
227 Ga0105243_10178741 3300009148 Bacteria 1844
228 Ga0105243_10573239 3300009148 Bacteria 1082
229 Ga0105243_11161613 3300009148 Bacteria 783
230 Ga0105241_10030340 3300009174 Bacteria 4040
231 Ga0105241_10641842 3300009174 Bacteria 963
232 Ga0105242_10000197 3300009176 Bacteria 46948
233 Ga0105242_10060569 3300009176 Bacteria 3111
234 Ga0105242_10081548 3300009176 Bacteria 2705
235 Ga0105242_10835790 3300009176 Bacteria 915
236 Ga0105248_10014539 3300009177 Bacteria 8663
237 Ga0105248_10016388 3300009177 Bacteria 8156
238 Ga0105248_10027828 3300009177 Bacteria 6294
239 Ga0105248_10177001 3300009177 Bacteria 2404
240 Ga0105248_12625132 3300009177 Bacteria 574
241 Ga0105237_10005565 3300009545 Bacteria 14206
242 Ga0105237_10168447 3300009545 Bacteria 2190
243 Ga0105237_10414322 3300009545 Bacteria 1352
244 Ga0105238_10093100 3300009551 Bacteria 3002
245 Ga0105238_10320379 3300009551 Bacteria 1536
246 Ga0105238_10515638 3300009551 Bacteria 1198
247 Ga0105238_11642875 3300009551 Bacteria 673
248 Ga0105249_10355110 3300009553 Bacteria 1486
249 Ga0105249_10378634 3300009553 Bacteria 1441
250 Ga0105239_10004408 3300010375 Bacteria 16853
251 Ga0105246_10018879 3300011119 Bacteria 4397
252 Ga0105246_10310978 3300011119 Bacteria 1276
253 Ga0105246_11397793 3300011119 Bacteria 653
254 Ga0157371_10249588 3300013102 Bacteria 1277
255 Ga0157370_10739994 3300013104 Bacteria 896
256 Ga0157370_10864992 3300013104 Bacteria 821
257 Ga0157369_10375380 3300013105 Bacteria 1476
258 Ga0157369_10597261 3300013105 Bacteria 1139
259 Ga0157374_10047682 3300013296 Bacteria 3973
260 Ga0157374_10052951 3300013296 Bacteria 3782
261 Ga0157374_10645124 3300013296 Bacteria 1070
262 Ga0157378_10002889 3300013297 Bacteria 15295
263 Ga0157378_10030416 3300013297 Bacteria 4771
264 Ga0157378_10978990 3300013297 Bacteria 879
265 Ga0163162_10002808 3300013306 Bacteria 16565
266 Ga0163162_10120757 3300013306 Bacteria 2725
267 Ga0163162_10210930 3300013306 Bacteria 2072
268 Ga0163162_10630926 3300013306 Bacteria 1196
269 Ga0163162_11750459 3300013306 Bacteria 710
270 Ga0157372_10090951 3300013307 Bacteria 3470
271 Ga0157372_10303835 3300013307 Bacteria 1856
272 Ga0157372_10610941 3300013307 Bacteria 1271
273 Ga0157372_11187422 3300013307 Bacteria 882
274 Ga0157375_10001551 3300013308 Bacteria 19772
275 Ga0157375_10228743 3300013308 Bacteria 2018
276 Ga0157375_10303332 3300013308 Bacteria 1761
277 Ga0157375_10337393 3300013308 Bacteria 1673
278 Ga0157375_10470027 3300013308 Bacteria 1423
279 Ga0157375_11573654 3300013308 Bacteria 777
280 Ga0163163_10329677 3300014325 Bacteria 1581
281 Ga0163163_11921292 3300014325 Bacteria 652
282 Ga0157380_10000136 3300014326 Bacteria 41118
283 Ga0157380_10023621 3300014326 Bacteria 4641
284 Ga0157380_10542956 3300014326 Bacteria 1139
285 Ga0157377_10019708 3300014745 Bacteria 3527
286 Ga0157377_10021065 3300014745 Bacteria 3424
287 Ga0157377_10051551 3300014745 Bacteria 2321
288 Ga0157379_10002115 3300014968 Bacteria 16461
289 Ga0157379_10181559 3300014968 Bacteria 1901
290 Ga0157379_10967930 3300014968 Bacteria 810
291 Ga0157376_10039949 3300014969 Bacteria 3831
292 Ga0157376_10171043 3300014969 Bacteria 1979
293 Ga0157376_10355796 3300014969 Bacteria 1403
294 Ga0163161_10012707 3300017792 Bacteria 5848
295 Ga0163161_10338074 3300017792 Bacteria 1194
296 Ga0163161_10360074 3300017792 Bacteria 1158
297 Ga0163161_11163407 3300017792 Bacteria 665
298 Ga0197907_10831311 3300020069 Bacteria 1987
299 Ga0206356_10184193 3300020070 Bacteria 2400
300 Ga0206356_10309572 3300020070 Bacteria 2818
301 Ga0206356_11613575 3300020070 Bacteria 831
302 Ga0206349_1889663 3300020075 Bacteria 1114
303 Ga0206355_1246002 3300020076 Bacteria 2492
304 Ga0206355_1653515 3300020076 Bacteria 1593
305 Ga0206351_10992062 3300020077 Bacteria 814
306 Ga0206352_10290768 3300020078 Bacteria 983
307 Ga0206352_11145297 3300020078 Bacteria 2584
308 Ga0206354_11208453 3300020081 Bacteria 1806
309 Ga0206353_11504654 3300020082 Bacteria 966
310 Ga0206353_11544153 3300020082 Bacteria 1990
311 Ga0224712_10004343 3300022467 Bacteria 3812
312 Ga0207426_1009534 3300025302 Bacteria 3832
313 Ga0207653_10028622 3300025885 Bacteria 1793
314 Ga0207692_10018628 3300025898 Bacteria 3120
315 Ga0207692_10027995 3300025898 Bacteria 2660
316 Ga0207692_10345997 3300025898 Bacteria 915
317 Ga0207642_10000178 3300025899 Bacteria 18339
318 Ga0207642_10049043 3300025899 Bacteria 1896
319 Ga0207642_10067860 3300025899 Bacteria 1685
320 Ga0207642_10306547 3300025899 Bacteria 922
321 Ga0207710_10011878 3300025900 Bacteria 3664
322 Ga0207710_10309640 3300025900 Bacteria 799
323 Ga0207710_10459625 3300025900 Bacteria 658
324 Ga0207710_10594830 3300025900 Bacteria 578
325 Ga0207688_10002022 3300025901 Bacteria 10880
326 Ga0207688_10004903 3300025901 Bacteria 7285
327 Ga0207688_10007863 3300025901 Bacteria 5803
328 Ga0207688_10335108 3300025901 Bacteria 930
329 Ga0207680_10007555 3300025903 Bacteria 5308
330 Ga0207647_10008739 3300025904 Bacteria 7232
331 Ga0207647_10034190 3300025904 Bacteria 3248
332 Ga0207647_10060164 3300025904 Bacteria 2322
333 Ga0207647_10075426 3300025904 Bacteria 2030
334 Ga0207685_10028489 3300025905 Bacteria 1968
335 Ga0207699_10057278 3300025906 Bacteria 2326
336 Ga0207645_10010732 3300025907 Bacteria 6280
337 Ga0207645_10653094 3300025907 Bacteria 715
338 Ga0207643_10185680 3300025908 Bacteria 1260
339 Ga0207654_10159947 3300025911 Bacteria 1454
340 Ga0207707_11068289 3300025912 Bacteria 659
341 Ga0207671_10056867 3300025914 Bacteria 2899
342 Ga0207671_10234171 3300025914 Bacteria 1441
343 Ga0207693_10000507 3300025915 Bacteria 35136
344 Ga0207693_10004862 3300025915 Bacteria 11307
345 Ga0207693_10006779 3300025915 Bacteria 9457
346 Ga0207663_10006272 3300025916 Bacteria 6068
347 Ga0207663_10045140 3300025916 Bacteria 2709
348 Ga0207663_10051804 3300025916 Bacteria 2558
349 Ga0207660_10374424 3300025917 Bacteria 1144
350 Ga0207660_10384185 3300025917 Bacteria 1129
351 Ga0207660_10676576 3300025917 Bacteria 842
352 Ga0207662_10015986 3300025918 Bacteria 4230
353 Ga0207662_10314910 3300025918 Bacteria 1043
354 Ga0207657_10206611 3300025919 Bacteria 1577
355 Ga0207652_10188672 3300025921 Bacteria 1854
356 Ga0207652_11096743 3300025921 Bacteria 696
357 Ga0207681_10032097 3300025923 Bacteria 3437
358 Ga0207681_10039095 3300025923 Bacteria 3147
359 Ga0207681_10140195 3300025923 Bacteria 1800
360 Ga0207681_10443862 3300025923 Bacteria 1055
361 Ga0207694_10548643 3300025924 Bacteria 970
362 Ga0207650_11108999 3300025925 Bacteria 673
363 Ga0207659_11420819 3300025926 Bacteria 594
364 Ga0207687_10003137 3300025927 Bacteria 11208
365 Ga0207687_10054043 3300025927 Bacteria 2808
366 Ga0207687_10200706 3300025927 Bacteria 1559
367 Ga0207687_11324535 3300025927 Bacteria 619
368 Ga0207700_10274240 3300025928 Bacteria 1449
369 Ga0207700_11046575 3300025928 Bacteria 730
370 Ga0207664_10137255 3300025929 Bacteria 2065
371 Ga0207664_10533673 3300025929 Bacteria 1052
372 Ga0207644_10031815 3300025931 Bacteria 3678
373 Ga0207690_10034702 3300025932 Bacteria 3252
374 Ga0207690_10161856 3300025932 Bacteria 1669
375 Ga0207706_10001533 3300025933 Bacteria 22933
376 Ga0207706_10012019 3300025933 Bacteria 7886
377 Ga0207706_10014036 3300025933 Bacteria 7265
378 Ga0207706_10026774 3300025933 Bacteria 5161
379 Ga0207706_10372102 3300025933 Bacteria 1241
380 Ga0207686_10001322 3300025934 Bacteria 14150
381 Ga0207686_10078273 3300025934 Bacteria 2150
382 Ga0207686_10086228 3300025934 Bacteria 2062
383 Ga0207709_10003151 3300025935 Bacteria 9912
384 Ga0207709_10071722 3300025935 Bacteria 2201
385 Ga0207670_10005363 3300025936 Bacteria 7032
386 Ga0207670_10254533 3300025936 Bacteria 1358
387 Ga0207670_10569550 3300025936 Bacteria 927
388 Ga0207669_10002448 3300025937 Bacteria 7918
389 Ga0207669_10010783 3300025937 Bacteria 4416
390 Ga0207669_10027073 3300025937 Bacteria 3131
391 Ga0207669_10250046 3300025937 Bacteria 1319
392 Ga0207669_10257420 3300025937 Bacteria 1303
393 Ga0207704_10000458 3300025938 Bacteria 18202
394 Ga0207704_10138481 3300025938 Bacteria 1698
395 Ga0207704_10165215 3300025938 Bacteria 1580
396 Ga0207704_10355392 3300025938 Bacteria 1142
397 Ga0207665_10001870 3300025939 Bacteria 14190
398 Ga0207665_10006046 3300025939 Bacteria 8044
399 Ga0207665_10031079 3300025939 Bacteria 3531
400 Ga0207691_10041110 3300025940 Bacteria 4270
401 Ga0207691_10142949 3300025940 Bacteria 2107
402 Ga0207711_10023282 3300025941 Bacteria 5184
403 Ga0207711_10108648 3300025941 Bacteria 2464
404 Ga0207711_10556727 3300025941 Bacteria 1070
405 Ga0207711_10691785 3300025941 Bacteria 951
406 Ga0207689_10012131 3300025942 Bacteria 7375
407 Ga0207689_10012362 3300025942 Bacteria 7302
408 Ga0207689_10534632 3300025942 Bacteria 984
409 Ga0207661_10747266 3300025944 Bacteria 900
410 Ga0207667_10156712 3300025949 Bacteria 2343
411 Ga0207667_10596152 3300025949 Bacteria 1114
412 Ga0207667_10832049 3300025949 Bacteria 918
413 Ga0207651_10362039 3300025960 Bacteria 1224
414 Ga0207651_10992737 3300025960 Bacteria 750
415 Ga0207712_10005323 3300025961 Bacteria 8124
416 Ga0207712_10131269 3300025961 Bacteria 1909
417 Ga0207712_10259405 3300025961 Bacteria 1409
418 Ga0207668_10001538 3300025972 Bacteria 13494
419 Ga0207668_10111361 3300025972 Bacteria 2055
420 Ga0207668_10134239 3300025972 Bacteria 1894
421 Ga0207668_10188472 3300025972 Bacteria 1632
422 Ga0207668_10553031 3300025972 Bacteria 997
423 Ga0207640_10000827 3300025981 Bacteria 17626
424 Ga0207640_10116261 3300025981 Bacteria 1906
425 Ga0207640_10264466 3300025981 Bacteria 1342
426 Ga0207658_10018537 3300025986 Bacteria 4807
427 Ga0207658_10312260 3300025986 Bacteria 1358
428 Ga0207658_10751297 3300025986 Bacteria 883
429 Ga0207677_10018504 3300026023 Bacteria 4182
430 Ga0207677_10075635 3300026023 Bacteria 2394
431 Ga0207677_10384001 3300026023 Bacteria 1186
432 Ga0207703_10000920 3300026035 Bacteria 28669
433 Ga0207703_10055283 3300026035 Bacteria 3229
434 Ga0207703_10464993 3300026035 Bacteria 1183
435 Ga0207678_10003253 3300026067 Bacteria 14661
436 Ga0207678_10024038 3300026067 Bacteria 5325
437 Ga0207678_10358757 3300026067 Bacteria 1258
438 Ga0207678_10407898 3300026067 Bacteria 1177
439 Ga0207708_10024290 3300026075 Bacteria 4584
440 Ga0207708_10063951 3300026075 Bacteria 2811
441 Ga0207708_10091736 3300026075 Bacteria 2343
442 Ga0207702_10420643 3300026078 Bacteria 1292
443 Ga0207702_10852773 3300026078 Bacteria 902
444 Ga0207641_10297562 3300026088 Bacteria 1523
445 Ga0207641_10451556 3300026088 Bacteria 1242
446 Ga0207648_10000929 3300026089 Bacteria 33018
447 Ga0207648_10033327 3300026089 Bacteria 4543
448 Ga0207648_10120299 3300026089 Bacteria 2309
449 Ga0207676_10432246 3300026095 Bacteria 1237
450 Ga0207676_10551392 3300026095 Bacteria 1101
451 Ga0207674_10017599 3300026116 Bacteria 7795
452 Ga0207675_100000544 3300026118 Bacteria 36830
453 Ga0207675_100041890 3300026118 Bacteria 4276
454 Ga0207675_100497880 3300026118 Bacteria 1213
455 Ga0207675_100723494 3300026118 Bacteria 1005
456 Ga0207683_10000335 3300026121 Bacteria 42789
457 Ga0207683_10013403 3300026121 Bacteria 6991
458 Ga0207683_10180226 3300026121 Bacteria 1915
459 Ga0207683_11145132 3300026121 Bacteria 721
460 Ga0207698_10073687 3300026142 Bacteria 2720
461 Ga0207698_10148975 3300026142 Bacteria 2028
462 Ga0207698_10350143 3300026142 Bacteria 1395
463 Ga0207698_10633796 3300026142 Bacteria 1057
464 Ga0207428_10006323 3300027907 Bacteria 10951
465 Ga0207428_10219838 3300027907 Bacteria 1424
466 Ga0207428_10379496 3300027907 Bacteria 1037
467 Ga0268266_10673515 3300028379 Bacteria 996
468 Ga0268265_10236677 3300028380 Bacteria 1608
469 Ga0268265_10310037 3300028380 Bacteria 1425
470 Ga0268265_10379022 3300028380 Bacteria 1300
471 Ga0268264_10001041 3300028381 Bacteria 27858
472 Ga0268264_10443187 3300028381 Bacteria 1257
473 Ga0268264_10586425 3300028381 Bacteria 1097
474 Ga0268264_10684798 3300028381 Bacteria 1017
475 Ga0307511_10001365 3300030521 Bacteria 25829
476 Ga0314311_1002826 3300030733 Bacteria 1023
477 Ga0307513_10000684 3300031456 Bacteria 48768
478 Ga0307408_100058841 3300031548 Bacteria 2795
479 Ga0307408_100380303 3300031548 Bacteria 1207
480 Ga0307408_101807763 3300031548 Bacteria 584
481 Ga0307405_10458926 3300031731 Bacteria 1012
482 Ga0307413_10064012 3300031824 Bacteria 2283
483 Ga0307413_10329929 3300031824 Bacteria 1169
484 Ga0307518_10000028 3300031838 Bacteria 98010
485 Ga0307410_10070078 3300031852 Bacteria 2427
486 Ga0307410_10093619 3300031852 Bacteria 2138
487 Ga0307410_10101609 3300031852 Bacteria 2062
488 Ga0307406_10079533 3300031901 Bacteria 2174
489 Ga0307406_10716839 3300031901 Bacteria 837
490 Ga0307407_10002834 3300031903 Bacteria 6929
491 Ga0307407_10148401 3300031903 Bacteria 1521
492 Ga0307407_10228782 3300031903 Bacteria 1262
493 Ga0307409_100042297 3300031995 Bacteria 3411
494 Ga0307409_100114582 3300031995 Bacteria 2268
495 Ga0307409_100122689 3300031995 Bacteria 2204
496 Ga0307409_100356020 3300031995 Bacteria 1383
497 Ga0307409_100418559 3300031995 Bacteria 1285
498 Ga0307409_100453166 3300031995 Bacteria 1239
499 Ga0307409_100528314 3300031995 Bacteria 1154
500 Ga0307416_100150513 3300032002 Bacteria 2133
501 Ga0307416_101509024 3300032002 Bacteria 778
502 Ga0307414_10588819 3300032004 Bacteria 996
503 Ga0307415_100230900 3300032126 Bacteria 1490
504 Ga0307415_101428380 3300032126 Bacteria 660
505 Ga0373958_0065009 3300034819 Bacteria 798
506 Ga0373959_0067870 3300034820 Bacteria 801
507 Ga0373951_0201422 3300035091 Bacteria 580
508 Ga0373932_0021433 3300035112 Bacteria 1706
509 Ga0373960_0051766 3300035121 Bacteria 1221
510 Ga0373942_0108728 3300035207 Bacteria 855
511 Ga0373961_0034242 3300035241 Bacteria 1435
512 Ga0373931_0036791 3300035691 Bacteria 2553
513 Ga0373931_0126691 3300035691 Bacteria 1465
514 Ga0373931_0300983 3300035691 Bacteria 990
515 Ga0395900_0117571 3300037418 Bacteria 2728
516 Ga0395900_0450194 3300037418 Bacteria 1244
517 Ga0395898_0334390 3300037466 Bacteria 1444
518 Ga0436364_0139643 3300037853 Bacteria 10617
519 Ga0395901_0069819 3300038443 Bacteria 3659
520 Ga0439436_0007353 3300041404 Bacteria 3390
521 Ga0439438_027619 3300041405 Bacteria 1531
522 Ga0439439_0014801 3300041406 Bacteria 1901
523 Ga0439466_0014804 3300041411 Bacteria 2837
524 Ga0439466_0205833 3300041411 Bacteria 598
525 Ga0439465_0026887 3300041413 Bacteria 1821
526 Ga0451789_0783324 3300041443 Bacteria 1510
527 Ga0451793_0320317 3300041452 Bacteria 2384
528 Ga0451797_0745449 3300041453 Bacteria 1398
529 Ga0451797_1178160 3300041453 Bacteria 1009
530 Ga0451795_0224208 3300041456 Bacteria 1550
531 Ga0451802_0591086 3300041460 Bacteria 751
532 Ga0451806_806050 3300041462 Bacteria 1451
533 Ga0451804_0721298 3300041463 Bacteria 726
534 Ga0451841_0419520 3300041498 Bacteria 595
535 Ga0451845_0365457 3300041501 Bacteria 1337
536 Ga0451853_0649725 3300041512 Bacteria 729
537 Ga0439433_0001119 3300041999 Bacteria 5477
538 Ga0439442_000790 3300042002 Bacteria 6582
539 Ga0439448_0027472 3300042005 Bacteria 1794
540 Ga0439449_0001002 3300042007 Bacteria 11117
541 Ga0439452_030960 3300042010 Bacteria 1316
542 Ga0439457_005622 3300042014 Bacteria 3132
543 Ga0439462_0007839 3300042015 Bacteria 2680
544 Ga0439463_051944 3300042016 Bacteria 1046
545 Ga0439446_0013747 3300042156 Bacteria 2226
546 Ga0439434_0020631 3300042435 Bacteria 1979
547 Ga0439434_0031878 3300042435 Bacteria 1603
548 Ga0439459_0042308 3300042438 Bacteria 973
549 Ga0439464_0082322 3300042439 Bacteria 963
550 Ga0466969_0043728 3300044656 Bacteria 2231
551 Ga0466972_0022428 3300044658 Bacteria 3145
552 Ga0466965_0380622 3300044683 Bacteria 777
553 Ga0466966_0009336 3300044684 Bacteria 6496
554 Ga0466966_0048045 3300044684 Bacteria 2719
555 Ga0466961_0025109 3300044693 Bacteria 3835
556 Ga0466963_0014835 3300044694 Bacteria 4812
557 Ga0466971_0008198 3300044719 Bacteria 4556
558 Ga0466971_0043951 3300044719 Bacteria 2007
559 Ga0466970_0007129 3300044765 Bacteria 5596
560 Ga0466970_0012159 3300044765 Bacteria 4396
561 Ga0466970_0019982 3300044765 Bacteria 3477
562 Ga0466957_0107245 3300044842 Bacteria 1768
563 Ga0466957_0334522 3300044842 Bacteria 1024
564 Ga0466960_0001756 3300044901 Bacteria 7961
565 Ga0466960_0394323 3300044901 Bacteria 796
566 Ga0466959_0032739 3300045049 Bacteria 3848
567 Ga0466959_0080005 3300045049 Bacteria 2356
568 Ga0466959_0113302 3300045049 Bacteria 1934
569 Ga0466958_0101292 3300045836 Bacteria 1791
570 Ga0466958_0153823 3300045836 Bacteria 1451
571 Ga0466958_0711955 3300045836 Bacteria 654
572 Ga0466967_0003341 3300045976 Bacteria 10433
573 Ga0466967_0115293 3300045976 Bacteria 2474
574 Ga0495627_134968 3300046453 Bacteria 693
575 Ga0495603_0084998 3300046455 Bacteria 1852
576 Ga0495638_0021571 3300046460 Bacteria 4242
577 Ga0495650_0056992 3300046471 Bacteria 1583
578 Ga0495664_0092530 3300046477 Bacteria 1819
579 Ga0495585_0111285 3300046492 Bacteria 1456
580 Ga0495585_0265819 3300046492 Bacteria 852
581 Ga0495594_0044020 3300046499 Bacteria 2448
582 Ga0495608_0174282 3300046511 Bacteria 1363
583 Ga0495631_0308848 3300046518 Bacteria 673
584 Ga0495654_0000140 3300046530 Bacteria 75508
585 Ga0495587_0534783 3300046536 Bacteria 647
586 Ga0495622_0256308 3300046557 Bacteria 769
587 Ga0495656_0052761 3300046615 Bacteria 1744
588 Ga0495669_0164467 3300046684 Bacteria 1054
589 Ga0495613_0274905 3300046689 Bacteria 1171
590 Ga0495613_0308785 3300046689 Bacteria 1094
591 Ga0495624_0276047 3300046690 Bacteria 1015
592 Ga0495624_0396558 3300046690 Bacteria 829
593 Ga0495670_0057578 3300046691 Bacteria 1951
594 Ga0495670_0087786 3300046691 Bacteria 1589
595 Ga0495589_0011210 3300046794 Bacteria 4652
596 Ga0495589_0209124 3300046794 Bacteria 919
597 Ga0495600_0329958 3300046809 Bacteria 958
598 Ga0495636_0001755 3300047318 Bacteria 8263
599 Ga0495636_0072739 3300047318 Bacteria 1470
600 Ga0495676_0017481 3300047321 Bacteria 6339
601 Ga0495676_0264355 3300047321 Bacteria 1169
602 Ga0495680_0708361 3300047322 Bacteria 664
603 Ga0495687_003383 3300047443 Bacteria 11627
604 Ga0495685_001492 3300047447 Bacteria 7162
605 Ga0495686_0003364 3300047472 Bacteria 13933
606 Ga0495686_0521345 3300047472 Bacteria 624
607 Ga0495593_0099908 3300047673 Bacteria 1489
608 Ga0496100_0000383 3300048903 Bacteria 21527
609 Ga0496100_0004863 3300048903 Bacteria 7176
610 Ga0496100_0184615 3300048903 Bacteria 1510
611 Ga0496101_0000593 3300048904 Bacteria 22016
612 Ga0496101_0011857 3300048904 Bacteria 5801
613 Ga0496101_0126305 3300048904 Bacteria 1938
614 Ga0496102_0004668 3300048905 Bacteria 11588
615 Ga0496102_0084290 3300048905 Bacteria 2933
616 Ga0496102_0205197 3300048905 Bacteria 1858
617 Ga0496102_0415120 3300048905 Bacteria 1264
618 Ga0496102_0457661 3300048905 Bacteria 1197
619 Ga0496102_1244908 3300048905 Bacteria 663
620 Ga0496103_0002854 3300048906 Bacteria 10742
621 Ga0496103_0054366 3300048906 Bacteria 2482
622 Ga0496103_0054478 3300048906 Bacteria 2479
623 Ga0496104_0006811 3300048907 Bacteria 10067
624 Ga0496104_0018259 3300048907 Bacteria 6399
625 Ga0496104_0193330 3300048907 Bacteria 1947
626 Ga0496104_0392167 3300048907 Bacteria 1301
627 Ga0496106_0000615 3300048909 Bacteria 25459
628 Ga0496106_0039922 3300048909 Bacteria 3514
629 Ga0496106_0102409 3300048909 Bacteria 2221
630 Ga0496106_0365916 3300048909 Bacteria 1158
631 Ga0496107_0001171 3300048910 Bacteria 15903
632 Ga0496107_0027686 3300048910 Bacteria 4025
633 Ga0496107_0186574 3300048910 Bacteria 1540
634 Ga0496107_0255911 3300048910 Bacteria 1303
635 Ga0496107_0330251 3300048910 Bacteria 1135
636 Ga0496108_0004415 3300048911 Bacteria 11319
637 Ga0496108_0012219 3300048911 Bacteria 6986
638 Ga0496108_0135328 3300048911 Bacteria 2120
639 Ga0496108_0601994 3300048911 Bacteria 958
640 Ga0496109_0028038 3300048912 Bacteria 5033
641 Ga0496109_0129519 3300048912 Bacteria 2354
642 Ga0496109_0460088 3300048912 Bacteria 1201
643 Ga0496110_0088759 3300048913 Bacteria 2762
644 Ga0496110_0092534 3300048913 Bacteria 2706
645 Ga0496110_0722379 3300048913 Bacteria 898
646 Ga0496111_0368990 3300048914 Bacteria 1062
647 Ga0496111_0529616 3300048914 Bacteria 866
648 Ga0496113_0408736 3300048916 Bacteria 1090
649 Ga0496114_0000517 3300048917 Bacteria 28403
650 Ga0496114_0040677 3300048917 Bacteria 3849
651 Ga0496114_0426964 3300048917 Bacteria 1174
652 Ga0496115_0008256 3300048918 Bacteria 7695
653 Ga0496115_0053453 3300048918 Bacteria 3241
654 Ga0496115_0118950 3300048918 Bacteria 2173
655 Ga0496115_1089090 3300048918 Bacteria 606
656 Ga0496119_0015035 3300048922 Bacteria 5996
657 Ga0501041_0098351 3300049577 Bacteria 1810
658 Ga0501042_0223871 3300049578 Bacteria 1357
659 Ga0501075_0580022 3300049591 Bacteria 856
660 Ga0501076_0623511 3300049592 Bacteria 890
661 Ga0501045_0334080 3300049824 Bacteria 1128
662 nmdc:mga0yw44_136577_c1 3300050492 Bacteria 1591
663 nmdc:mga05p37_151291_c1 3300050507 Bacteria 1372
664 nmdc:mga0qj67_232358_c1 3300050509 Bacteria 1496
665 nmdc:mga0qj67_475227_c1 3300050509 Bacteria 1006
666 nmdc:mga08y16_1306930_c1 3300050511 Bacteria 692
667 nmdc:mga08y16_338710_c1 3300050511 Bacteria 1546
668 nmdc:mga08y16_933665_c1 3300050511 Bacteria 852
669 nmdc:mga0rr50_591096_c1 3300050513 Bacteria 946
670 Ga0495655_0230238 3300053083 Bacteria 617
671 Ga0495595_0409082 3300053084 Bacteria 688
672 Ga0500660_099896 3300053100 Bacteria 1269
673 Ga0500556_0000472 3300053104 Bacteria 28259
674 Ga0500560_000103 3300053107 Bacteria 8711
675 Ga0500562_015745 3300053108 Bacteria 1941
676 Ga0500593_003899 3300053117 Bacteria 5721
677 Ga0500628_136542 3300053129 Bacteria 677
678 Ga0500655_002692 3300053133 Bacteria 3219
679 Ga0500559_0019671 3300053136 Bacteria 2853
680 Ga0500573_0227834 3300053140 Bacteria 973
681 Ga0500616_0000027 3300053153 Bacteria 441053
682 Ga0500620_115434 3300053155 Bacteria 940
683 Ga0500645_004203 3300053730 Bacteria 5602
684 Ga0587093_053513 3300059478 Bacteria 643
685 Ga0587066_012376 3300059490 Bacteria 1272
686 Ga0587070_035744 3300059491 Bacteria 926
687 Ga0587070_050901 3300059491 Bacteria 827
688 Ga0587077_082409 3300059493 Bacteria 741
689 Ga0587080_032628 3300059503 Bacteria 915
690 Ga0587080_060492 3300059503 Bacteria 737
691 Ga0587082_016022 3300059504 Bacteria 1165
692 Ga0587082_029850 3300059504 Bacteria 944
693 Ga0587082_069561 3300059504 Bacteria 712
694 Ga0587082_084282 3300059504 Bacteria 668
695 Ga0587086_040533 3300059507 Bacteria 719
696 Ga0587088_047972 3300059508 Bacteria 827
697 Ga0587088_061262 3300059508 Bacteria 763
698 Ga0587075_008119 3300059644 Bacteria 1334
699 Ga0587075_035026 3300059644 Bacteria 817
700 Ga0587078_049321 3300059646 Bacteria 614
701 Ga0587079_004925 3300059647 Bacteria 1853
702 Ga0587079_034119 3300059647 Bacteria 994
703 Ga0587079_137505 3300059647 Bacteria 620
704 Ga0587079_168628 3300059647 Bacteria 578
705 Ga0587071_071833 3300060344 Bacteria 755
706 Ga0587071_114682 3300060344 Bacteria 637
707 Ga0587071_123693 3300060344 Bacteria 621
708 Ga0466962_0290710 3300061719 Bacteria 807
709 Ga0530510_0010046 3300061734 Bacteria 6639

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031548 Ga0307408_100380303 Ga0307408_1003803032 151
2 3300049824 Ga0501045_0334080 Ga0501045_0334080_585_1115 151
3 3300031995 Ga0307409_100122689 Ga0307409_1001226893 154
4 3300046460 Ga0495638_0021571 Ga0495638_0021571_1275_1745 156
5 3300046530 Ga0495654_0000140 Ga0495654_0000140_17269_17739 156
6 3300009094 Ga0111539_10861476 Ga0111539_108614762 157
7 3300047472 Ga0495686_0521345 Ga0495686_0521345_61_534 157
8 iso_pu_bacteria 8011350971 8011356985 157
9 iso_pu_bacteria 2554235132 2554815058 158
10 iso_pu_bacteria 2606217733 2608383560 158
11 iso_pu_bacteria 2791355253 2793283815 158
12 iso_pu_bacteria 3005409236 3005416110 159
13 3300045836 Ga0466958_0711955 Ga0466958_0711955_57_602 160
14 3300005337 Ga0070682_100174053 Ga0070682_1001740532 161
15 3300005367 Ga0070667_100850445 Ga0070667_1008504451 161
16 3300005456 Ga0070678_100148518 Ga0070678_1001485182 161
17 3300005618 Ga0068864_100380674 Ga0068864_1003806742 161
18 3300009098 Ga0105245_10092913 Ga0105245_100929131 161
19 3300009101 Ga0105247_10185883 Ga0105247_101858831 161
20 3300025901 Ga0207688_10335108 Ga0207688_103351082 161
21 3300025986 Ga0207658_10751297 Ga0207658_107512972 161
22 3300026095 Ga0207676_10551392 Ga0207676_105513922 161
23 3300026121 Ga0207683_10180226 Ga0207683_101802262 161
24 3300048905 Ga0496102_0205197 Ga0496102_0205197_540_1064 161
25 3300048911 Ga0496108_0012219 Ga0496108_0012219_4957_5481 161
26 3300048912 Ga0496109_0460088 Ga0496109_0460088_63_587 161
27 3300048922 Ga0496119_0015035 Ga0496119_0015035_5008_5496 161
28 iso_pu_bacteria 8054472261 8054479161 161
29 3300006051 Ga0075364_10244722 Ga0075364_102447222 162
30 3300041411 Ga0439466_0205833 Ga0439466_0205833_32_520 162
31 3300042156 Ga0439446_0013747 Ga0439446_0013747_1289_1777 162
32 3300042435 Ga0439434_0020631 Ga0439434_0020631_50_538 162
33 3300044658 Ga0466972_0022428 Ga0466972_0022428_255_776 162
34 3300044765 Ga0466970_0007129 Ga0466970_0007129_2291_2812 162
35 3300044842 Ga0466957_0107245 Ga0466957_0107245_957_1478 162
36 3300044901 Ga0466960_0001756 Ga0466960_0001756_2132_2653 162
37 3300045836 Ga0466958_0101292 Ga0466958_0101292_394_915 162
38 3300003203 JGI25406J46586_10079730 JGI25406J46586_100797301 163
39 3300004785 Ga0058858_1421484 Ga0058858_14214842 163
40 3300004798 Ga0058859_10009161 Ga0058859_100091612 163
41 3300004799 Ga0058863_10041758 Ga0058863_100417582 163
42 3300004800 Ga0058861_10087982 Ga0058861_100879822 163
43 3300004803 Ga0058862_10099156 Ga0058862_100991562 163
44 3300005327 Ga0070658_10130570 Ga0070658_101305702 163
45 3300005329 Ga0070683_100567343 Ga0070683_1005673432 163
46 3300005331 Ga0070670_100209071 Ga0070670_1002090712 163
47 3300005337 Ga0070682_100361567 Ga0070682_1003615672 163
48 3300005338 Ga0068868_100219671 Ga0068868_1002196712 163
49 3300005345 Ga0070692_10019671 Ga0070692_100196712 163
50 3300005347 Ga0070668_101364615 Ga0070668_1013646151 163
51 3300005354 Ga0070675_100087473 Ga0070675_1000874731 163
52 3300005354 Ga0070675_100765381 Ga0070675_1007653811 163
53 3300005366 Ga0070659_100088400 Ga0070659_1000884002 163
54 3300005436 Ga0070713_100976370 Ga0070713_1009763702 163
55 3300005455 Ga0070663_100173838 Ga0070663_1001738382 163
56 3300005455 Ga0070663_100694125 Ga0070663_1006941252 163
57 3300005456 Ga0070678_100402445 Ga0070678_1004024452 163
58 3300005457 Ga0070662_100190515 Ga0070662_1001905152 163
59 3300005459 Ga0068867_100579396 Ga0068867_1005793962 163
60 3300005466 Ga0070685_10924288 Ga0070685_109242881 163
61 3300005467 Ga0070706_101140514 Ga0070706_1011405141 163
62 3300005535 Ga0070684_100259830 Ga0070684_1002598302 163
63 3300005535 Ga0070684_100790738 Ga0070684_1007907382 163
64 3300005547 Ga0070693_100094314 Ga0070693_1000943142 163
65 3300005548 Ga0070665_100443494 Ga0070665_1004434942 163
66 3300005548 Ga0070665_100915168 Ga0070665_1009151682 163
67 3300005548 Ga0070665_101299194 Ga0070665_1012991942 163
68 3300005563 Ga0068855_101153401 Ga0068855_1011534012 163
69 3300005577 Ga0068857_100068268 Ga0068857_1000682683 163
70 3300005578 Ga0068854_100017580 Ga0068854_1000175806 163
71 3300005578 Ga0068854_101038324 Ga0068854_1010383241 163
72 3300005614 Ga0068856_100095930 Ga0068856_1000959302 163
73 3300005616 Ga0068852_100316407 Ga0068852_1003164072 163
74 3300005616 Ga0068852_100328356 Ga0068852_1003283562 163
75 3300005617 Ga0068859_100903846 Ga0068859_1009038462 163
76 3300005617 Ga0068859_101674409 Ga0068859_1016744091 163
77 3300005618 Ga0068864_100357442 Ga0068864_1003574422 163
78 3300005718 Ga0068866_10366871 Ga0068866_103668712 163
79 3300005834 Ga0068851_10036766 Ga0068851_100367663 163
80 3300005840 Ga0068870_10374851 Ga0068870_103748512 163
81 3300005841 Ga0068863_100064551 Ga0068863_1000645514 163
82 3300005841 Ga0068863_100325055 Ga0068863_1003250552 163
83 3300005842 Ga0068858_100102866 Ga0068858_1001028663 163
84 3300005842 Ga0068858_100544263 Ga0068858_1005442632 163
85 3300005843 Ga0068860_100376133 Ga0068860_1003761332 163
86 3300005843 Ga0068860_101278075 Ga0068860_1012780752 163
87 3300005844 Ga0068862_100384621 Ga0068862_1003846212 163
88 3300005937 Ga0081455_10007611 Ga0081455_1000761112 163
89 3300005985 Ga0081539_10006743 Ga0081539_1000674310 163
90 3300005985 Ga0081539_10031667 Ga0081539_100316672 163
91 3300006881 Ga0068865_100300952 Ga0068865_1003009522 163
92 3300006931 Ga0097620_100903897 Ga0097620_1009038972 163
93 3300006931 Ga0097620_101674463 Ga0097620_1016744632 163
94 3300009011 Ga0105251_10137392 Ga0105251_101373922 163
95 3300009094 Ga0111539_10438119 Ga0111539_104381191 163
96 3300009094 Ga0111539_10690177 Ga0111539_106901772 163
97 3300009094 Ga0111539_10902890 Ga0111539_109028902 163
98 3300009094 Ga0111539_11205917 Ga0111539_112059172 163
99 3300009098 Ga0105245_10207686 Ga0105245_102076862 163
100 3300009101 Ga0105247_10213937 Ga0105247_102139371 163
101 3300009101 Ga0105247_10714032 Ga0105247_107140321 163
102 3300009101 Ga0105247_10954126 Ga0105247_109541262 163
103 3300009148 Ga0105243_10573239 Ga0105243_105732392 163
104 3300009148 Ga0105243_11161613 Ga0105243_111616131 163
105 3300009174 Ga0105241_10641842 Ga0105241_106418422 163
106 3300009176 Ga0105242_10060569 Ga0105242_100605692 163
107 3300009177 Ga0105248_12625132 Ga0105248_126251321 163
108 3300009545 Ga0105237_10168447 Ga0105237_101684472 163
109 3300009551 Ga0105238_10515638 Ga0105238_105156382 163
110 3300009551 Ga0105238_11642875 Ga0105238_116428752 163
111 3300009553 Ga0105249_10355110 Ga0105249_103551102 163
112 3300011119 Ga0105246_10310978 Ga0105246_103109782 163
113 3300013102 Ga0157371_10249588 Ga0157371_102495882 163
114 3300013104 Ga0157370_10864992 Ga0157370_108649922 163
115 3300013105 Ga0157369_10597261 Ga0157369_105972612 163
116 3300013296 Ga0157374_10645124 Ga0157374_106451242 163
117 3300013307 Ga0157372_10090951 Ga0157372_100909511 163
118 3300013307 Ga0157372_10610941 Ga0157372_106109412 163
119 3300013308 Ga0157375_10470027 Ga0157375_104700272 163
120 3300013308 Ga0157375_11573654 Ga0157375_115736542 163
121 3300014325 Ga0163163_10329677 Ga0163163_103296771 163
122 3300014968 Ga0157379_10967930 Ga0157379_109679302 163
123 3300017792 Ga0163161_10360074 Ga0163161_103600742 163
124 3300017792 Ga0163161_11163407 Ga0163161_111634071 163
125 3300020069 Ga0197907_10831311 Ga0197907_108313112 163
126 3300020070 Ga0206356_10184193 Ga0206356_101841932 163
127 3300020070 Ga0206356_10309572 Ga0206356_103095722 163
128 3300020070 Ga0206356_11613575 Ga0206356_116135752 163
129 3300020075 Ga0206349_1889663 Ga0206349_18896632 163
130 3300020076 Ga0206355_1246002 Ga0206355_12460022 163
131 3300020076 Ga0206355_1653515 Ga0206355_16535152 163
132 3300020077 Ga0206351_10992062 Ga0206351_109920622 163
133 3300020078 Ga0206352_10290768 Ga0206352_102907681 163
134 3300020078 Ga0206352_11145297 Ga0206352_111452972 163
135 3300020081 Ga0206354_11208453 Ga0206354_112084532 163
136 3300020082 Ga0206353_11504654 Ga0206353_115046541 163
137 3300020082 Ga0206353_11544153 Ga0206353_115441532 163
138 3300022467 Ga0224712_10004343 Ga0224712_100043432 163
139 3300025898 Ga0207692_10345997 Ga0207692_103459971 163
140 3300025900 Ga0207710_10459625 Ga0207710_104596252 163
141 3300025900 Ga0207710_10594830 Ga0207710_105948301 163
142 3300025901 Ga0207688_10002022 Ga0207688_100020226 163
143 3300025904 Ga0207647_10034190 Ga0207647_100341904 163
144 3300025907 Ga0207645_10010732 Ga0207645_100107325 163
145 3300025917 Ga0207660_10676576 Ga0207660_106765762 163
146 3300025918 Ga0207662_10015986 Ga0207662_100159862 163
147 3300025921 Ga0207652_11096743 Ga0207652_110967432 163
148 3300025923 Ga0207681_10140195 Ga0207681_101401952 163
149 3300025924 Ga0207694_10548643 Ga0207694_105486431 163
150 3300025925 Ga0207650_11108999 Ga0207650_111089992 163
151 3300025926 Ga0207659_11420819 Ga0207659_114208191 163
152 3300025927 Ga0207687_10054043 Ga0207687_100540432 163
153 3300025927 Ga0207687_11324535 Ga0207687_113245352 163
154 3300025928 Ga0207700_10274240 Ga0207700_102742402 163
155 3300025932 Ga0207690_10161856 Ga0207690_101618562 163
156 3300025933 Ga0207706_10026774 Ga0207706_100267746 163
157 3300025934 Ga0207686_10086228 Ga0207686_100862282 163
158 3300025936 Ga0207670_10254533 Ga0207670_102545332 163
159 3300025936 Ga0207670_10569550 Ga0207670_105695502 163
160 3300025937 Ga0207669_10010783 Ga0207669_100107832 163
161 3300025938 Ga0207704_10355392 Ga0207704_103553922 163
162 3300025941 Ga0207711_10691785 Ga0207711_106917852 163
163 3300025942 Ga0207689_10534632 Ga0207689_105346322 163
164 3300025944 Ga0207661_10747266 Ga0207661_107472662 163
165 3300025949 Ga0207667_10832049 Ga0207667_108320492 163
166 3300025960 Ga0207651_10992737 Ga0207651_109927372 163
167 3300025961 Ga0207712_10131269 Ga0207712_101312692 163
168 3300025972 Ga0207668_10553031 Ga0207668_105530312 163
169 3300026067 Ga0207678_10358757 Ga0207678_103587572 163
170 3300026075 Ga0207708_10091736 Ga0207708_100917362 163
171 3300026078 Ga0207702_10420643 Ga0207702_104206432 163
172 3300026088 Ga0207641_10297562 Ga0207641_102975622 163
173 3300026095 Ga0207676_10432246 Ga0207676_104322461 163
174 3300026116 Ga0207674_10017599 Ga0207674_100175994 163
175 3300026118 Ga0207675_100497880 Ga0207675_1004978802 163
176 3300026121 Ga0207683_11145132 Ga0207683_111451322 163
177 3300026142 Ga0207698_10148975 Ga0207698_101489752 163
178 3300026142 Ga0207698_10633796 Ga0207698_106337962 163
179 3300027907 Ga0207428_10219838 Ga0207428_102198382 163
180 3300027907 Ga0207428_10379496 Ga0207428_103794962 163
181 3300028380 Ga0268265_10310037 Ga0268265_103100372 163
182 3300028381 Ga0268264_10443187 Ga0268264_104431872 163
183 3300031456 Ga0307513_10000684 Ga0307513_1000068421 163
184 3300031901 Ga0307406_10716839 Ga0307406_107168392 163
185 3300031995 Ga0307409_100418559 Ga0307409_1004185592 163
186 3300031995 Ga0307409_100453166 Ga0307409_1004531662 163
187 3300032126 Ga0307415_101428380 Ga0307415_1014283802 163
188 3300035091 Ga0373951_0201422 Ga0373951_0201422_57_548 163
189 3300035691 Ga0373931_0300983 Ga0373931_0300983_71_562 163
190 3300037418 Ga0395900_0450194 Ga0395900_0450194_715_1209 163
191 3300037466 Ga0395898_0334390 Ga0395898_0334390_495_989 163
192 3300038443 Ga0395901_0069819 Ga0395901_0069819_2942_3436 163
193 3300041460 Ga0451802_0591086 Ga0451802_0591086_62_553 163
194 3300041463 Ga0451804_0721298 Ga0451804_0721298_214_705 163
195 3300041498 Ga0451841_0419520 Ga0451841_0419520_35_526 163
196 3300041501 Ga0451845_0365457 Ga0451845_0365457_369_860 163
197 3300041512 Ga0451853_0649725 Ga0451853_0649725_131_622 163
198 3300042016 Ga0439463_051944 Ga0439463_051944_344_835 163
199 3300042438 Ga0439459_0042308 Ga0439459_0042308_353_844 163
200 3300042439 Ga0439464_0082322 Ga0439464_0082322_361_852 163
201 3300045976 Ga0466967_0115293 Ga0466967_0115293_912_1403 163
202 3300046477 Ga0495664_0092530 Ga0495664_0092530_323_814 163
203 3300046511 Ga0495608_0174282 Ga0495608_0174282_133_624 163
204 3300046536 Ga0495587_0534783 Ga0495587_0534783_130_621 163
205 3300046689 Ga0495613_0274905 Ga0495613_0274905_230_721 163
206 3300046690 Ga0495624_0396558 Ga0495624_0396558_14_505 163
207 3300046809 Ga0495600_0329958 Ga0495600_0329958_133_624 163
208 3300047322 Ga0495680_0708361 Ga0495680_0708361_106_597 163
209 3300048907 Ga0496104_0392167 Ga0496104_0392167_533_1024 163
210 3300048910 Ga0496107_0330251 Ga0496107_0330251_167_658 163
211 3300048911 Ga0496108_0135328 Ga0496108_0135328_1166_1657 163
212 3300048912 Ga0496109_0129519 Ga0496109_0129519_970_1461 163
213 3300048913 Ga0496110_0092534 Ga0496110_0092534_324_815 163
214 3300048913 Ga0496110_0722379 Ga0496110_0722379_307_798 163
215 3300048914 Ga0496111_0529616 Ga0496111_0529616_279_770 163
216 3300048916 Ga0496113_0408736 Ga0496113_0408736_569_1060 163
217 3300050509 nmdc:mga0qj67_475227_c1 nmdc:mga0qj67_475227_c1_25_516 163
218 3300050511 nmdc:mga08y16_1306930_c1 nmdc:mga08y16_1306930_c1_93_584 163
219 3300050511 nmdc:mga08y16_338710_c1 nmdc:mga08y16_338710_c1_720_1211 163
220 3300050513 nmdc:mga0rr50_591096_c1 nmdc:mga0rr50_591096_c1_283_774 163
221 3300053083 Ga0495655_0230238 Ga0495655_0230238_27_518 163
222 3300053084 Ga0495595_0409082 Ga0495595_0409082_39_530 163
223 3300053136 Ga0500559_0019671 Ga0500559_0019671_2204_2704 163
224 3300059478 Ga0587093_053513 Ga0587093_053513_117_608 163
225 3300059490 Ga0587066_012376 Ga0587066_012376_140_631 163
226 3300059491 Ga0587070_035744 Ga0587070_035744_86_577 163
227 3300059491 Ga0587070_050901 Ga0587070_050901_146_637 163
228 3300059493 Ga0587077_082409 Ga0587077_082409_123_614 163
229 3300059503 Ga0587080_032628 Ga0587080_032628_303_794 163
230 3300059503 Ga0587080_060492 Ga0587080_060492_117_608 163
231 3300059504 Ga0587082_016022 Ga0587082_016022_358_849 163
232 3300059504 Ga0587082_029850 Ga0587082_029850_70_561 163
233 3300059504 Ga0587082_069561 Ga0587082_069561_144_635 163
234 3300059504 Ga0587082_084282 Ga0587082_084282_67_558 163
235 3300059507 Ga0587086_040533 Ga0587086_040533_40_531 163
236 3300059508 Ga0587088_047972 Ga0587088_047972_279_770 163
237 3300059508 Ga0587088_061262 Ga0587088_061262_184_675 163
238 3300059644 Ga0587075_008119 Ga0587075_008119_755_1246 163
239 3300059644 Ga0587075_035026 Ga0587075_035026_119_610 163
240 3300059646 Ga0587078_049321 Ga0587078_049321_82_573 163
241 3300059647 Ga0587079_004925 Ga0587079_004925_613_1104 163
242 3300059647 Ga0587079_034119 Ga0587079_034119_313_804 163
243 3300059647 Ga0587079_137505 Ga0587079_137505_86_577 163
244 3300059647 Ga0587079_168628 Ga0587079_168628_19_510 163
245 3300060344 Ga0587071_071833 Ga0587071_071833_34_525 163
246 3300060344 Ga0587071_114682 Ga0587071_114682_122_613 163
247 3300060344 Ga0587071_123693 Ga0587071_123693_85_576 163
248 iso_pu_bacteria 2893684298 2893685409 163
249 iso_pu_bacteria 2974315732 2974315792 163
250 3300025302 Ga0207426_1009534 Ga0207426_10095343 164
251 3300031548 Ga0307408_101807763 Ga0307408_1018077631 164
252 3300037418 Ga0395900_0117571 Ga0395900_0117571_1075_1581 164
253 3300041453 Ga0451797_0745449 Ga0451797_0745449_250_753 164
254 3300044656 Ga0466969_0043728 Ga0466969_0043728_1660_2166 164
255 3300044684 Ga0466966_0009336 Ga0466966_0009336_4657_5163 164
256 3300044684 Ga0466966_0048045 Ga0466966_0048045_1954_2460 164
257 3300044693 Ga0466961_0025109 Ga0466961_0025109_615_1121 164
258 3300044694 Ga0466963_0014835 Ga0466963_0014835_1081_1587 164
259 3300044719 Ga0466971_0008198 Ga0466971_0008198_1908_2414 164
260 3300044765 Ga0466970_0019982 Ga0466970_0019982_2809_3315 164
261 3300044842 Ga0466957_0334522 Ga0466957_0334522_109_615 164
262 3300045049 Ga0466959_0032739 Ga0466959_0032739_584_1090 164
263 3300045049 Ga0466959_0113302 Ga0466959_0113302_275_781 164
264 3300046689 Ga0495613_0308785 Ga0495613_0308785_499_999 164
265 3300047318 Ga0495636_0001755 Ga0495636_0001755_2667_3173 164
266 3300047443 Ga0495687_003383 Ga0495687_003383_1564_2070 164
267 3300053100 Ga0500660_099896 Ga0500660_099896_22_528 164
268 iso_pu_bacteria 2751185725 2753036186 164
269 iso_pu_bacteria 2751185792 2753324058 164
270 iso_pu_bacteria 2775506925 2776374623 164
271 iso_pu_bacteria 2862507626 2862514025 164
272 iso_pu_bacteria 2862574272 2862581646 164
273 iso_pu_bacteria 2863067949 2863075421 164
274 3300006038 Ga0075365_10215282 Ga0075365_102152822 165
275 3300046455 Ga0495603_0084998 Ga0495603_0084998_206_754 165
276 3300046492 Ga0495585_0111285 Ga0495585_0111285_765_1313 165
277 3300046499 Ga0495594_0044020 Ga0495594_0044020_274_822 165
278 3300046557 Ga0495622_0256308 Ga0495622_0256308_77_625 165
279 3300046690 Ga0495624_0276047 Ga0495624_0276047_481_990 165
280 3300046691 Ga0495670_0087786 Ga0495670_0087786_672_1220 165
281 3300046794 Ga0495589_0011210 Ga0495589_0011210_2583_3131 165
282 3300047318 Ga0495636_0072739 Ga0495636_0072739_788_1336 165
283 3300047321 Ga0495676_0017481 Ga0495676_0017481_1273_1821 165
284 3300047321 Ga0495676_0264355 Ga0495676_0264355_454_1002 165
285 3300047447 Ga0495685_001492 Ga0495685_001492_5232_5780 165
286 3300050492 nmdc:mga0yw44_136577_c1 nmdc:mga0yw44_136577_c1_461_979 165
287 3300053107 Ga0500560_000103 Ga0500560_000103_5683_6192 165
288 3300053140 Ga0500573_0227834 Ga0500573_0227834_94_603 165
289 iso_pu_bacteria 2537561592 2537898874 165
290 iso_pu_bacteria 2565956761 2566993344 165
291 iso_pu_bacteria 2643221561 2643827360 165
292 iso_pu_bacteria 2643221696 2644533813 165
293 iso_pu_bacteria 2773857762 2774396716 165
294 iso_pu_bacteria 2811994878 2812349557 165
295 iso_pu_bacteria 2842134933 2842137130 165
296 iso_pu_bacteria 2891968417 2891969407 165
297 iso_pu_bacteria 2922554459 2922559674 165
298 3300001990 JGI24737J22298_10049507 JGI24737J22298_100495072 166
299 3300002239 JGI24034J26672_10005656 JGI24034J26672_100056562 166
300 3300005328 Ga0070676_10020890 Ga0070676_100208904 166
301 3300005334 Ga0068869_100039798 Ga0068869_1000397982 166
302 3300005335 Ga0070666_10009026 Ga0070666_100090263 166
303 3300005337 Ga0070682_100042072 Ga0070682_1000420722 166
304 3300005338 Ga0068868_100000203 Ga0068868_10000020318 166
305 3300005340 Ga0070689_100040615 Ga0070689_1000406152 166
306 3300005341 Ga0070691_10000914 Ga0070691_1000091411 166
307 3300005347 Ga0070668_100005307 Ga0070668_1000053078 166
308 3300005353 Ga0070669_100065201 Ga0070669_1000652012 166
309 3300005355 Ga0070671_100021227 Ga0070671_1000212272 166
310 3300005356 Ga0070674_100000244 Ga0070674_10000024415 166
311 3300005364 Ga0070673_100449356 Ga0070673_1004493562 166
312 3300005365 Ga0070688_100002188 Ga0070688_10000218811 166
313 3300005366 Ga0070659_100049761 Ga0070659_1000497612 166
314 3300005367 Ga0070667_100066954 Ga0070667_1000669543 166
315 3300005434 Ga0070709_10159348 Ga0070709_101593482 166
316 3300005434 Ga0070709_10804763 Ga0070709_108047632 166
317 3300005437 Ga0070710_10025259 Ga0070710_100252592 166
318 3300005439 Ga0070711_100002396 Ga0070711_1000023963 166
319 3300005440 Ga0070705_100005263 Ga0070705_1000052632 166
320 3300005441 Ga0070700_100012566 Ga0070700_1000125662 166
321 3300005444 Ga0070694_100044216 Ga0070694_1000442163 166
322 3300005455 Ga0070663_100012067 Ga0070663_1000120675 166
323 3300005457 Ga0070662_100000713 Ga0070662_10000071318 166
324 3300005459 Ga0068867_100001211 Ga0068867_1000012117 166
325 3300005466 Ga0070685_10405609 Ga0070685_104056092 166
326 3300005530 Ga0070679_100231529 Ga0070679_1002315292 166
327 3300005543 Ga0070672_100084142 Ga0070672_1000841422 166
328 3300005545 Ga0070695_100002690 Ga0070695_1000026902 166
329 3300005546 Ga0070696_100044126 Ga0070696_1000441262 166
330 3300005547 Ga0070693_100312734 Ga0070693_1003127342 166
331 3300005563 Ga0068855_100184547 Ga0068855_1001845472 166
332 3300005578 Ga0068854_100000262 Ga0068854_10000026211 166
333 3300005614 Ga0068856_100226532 Ga0068856_1002265322 166
334 3300005615 Ga0070702_100001129 Ga0070702_1000011293 166
335 3300005616 Ga0068852_100396309 Ga0068852_1003963092 166
336 3300005617 Ga0068859_100002266 Ga0068859_10000226610 166
337 3300005718 Ga0068866_10000681 Ga0068866_100006812 166
338 3300005719 Ga0068861_100018017 Ga0068861_1000180172 166
339 3300005842 Ga0068858_100001689 Ga0068858_10000168911 166
340 3300005843 Ga0068860_100001255 Ga0068860_10000125513 166
341 3300005844 Ga0068862_100001317 Ga0068862_10000131712 166
342 3300005937 Ga0081455_10018209 Ga0081455_100182092 166
343 3300006163 Ga0070715_10016658 Ga0070715_100166582 166
344 3300006173 Ga0070716_100001813 Ga0070716_1000018132 166
345 3300006175 Ga0070712_100001225 Ga0070712_1000012259 166
346 3300006237 Ga0097621_100038572 Ga0097621_1000385722 166
347 3300006358 Ga0068871_100080370 Ga0068871_1000803703 166
348 3300006931 Ga0097620_100002267 Ga0097620_10000226711 166
349 3300009098 Ga0105245_10001005 Ga0105245_1000100524 166
350 3300009101 Ga0105247_10000372 Ga0105247_1000037212 166
351 3300009148 Ga0105243_10000676 Ga0105243_1000067614 166
352 3300009176 Ga0105242_10000197 Ga0105242_1000019726 166
353 3300009177 Ga0105248_10014539 Ga0105248_100145398 166
354 3300009545 Ga0105237_10005565 Ga0105237_100055653 166
355 3300009551 Ga0105238_10093100 Ga0105238_100931002 166
356 3300010375 Ga0105239_10004408 Ga0105239_100044082 166
357 3300013104 Ga0157370_10739994 Ga0157370_107399942 166
358 3300013297 Ga0157378_10002889 Ga0157378_1000288914 166
359 3300013306 Ga0163162_10002808 Ga0163162_1000280811 166
360 3300013308 Ga0157375_10001551 Ga0157375_1000155113 166
361 3300014326 Ga0157380_10000136 Ga0157380_1000013617 166
362 3300014745 Ga0157377_10051551 Ga0157377_100515512 166
363 3300014968 Ga0157379_10002115 Ga0157379_1000211515 166
364 3300014969 Ga0157376_10039949 Ga0157376_100399492 166
365 3300017792 Ga0163161_10012707 Ga0163161_100127072 166
366 3300025885 Ga0207653_10028622 Ga0207653_100286222 166
367 3300025898 Ga0207692_10018628 Ga0207692_100186282 166
368 3300025899 Ga0207642_10000178 Ga0207642_100001784 166
369 3300025900 Ga0207710_10011878 Ga0207710_100118783 166
370 3300025901 Ga0207688_10007863 Ga0207688_100078633 166
371 3300025903 Ga0207680_10007555 Ga0207680_100075553 166
372 3300025904 Ga0207647_10075426 Ga0207647_100754262 166
373 3300025907 Ga0207645_10653094 Ga0207645_106530942 166
374 3300025914 Ga0207671_10056867 Ga0207671_100568672 166
375 3300025915 Ga0207693_10000507 Ga0207693_1000050714 166
376 3300025916 Ga0207663_10051804 Ga0207663_100518042 166
377 3300025917 Ga0207660_10384185 Ga0207660_103841852 166
378 3300025921 Ga0207652_10188672 Ga0207652_101886722 166
379 3300025923 Ga0207681_10039095 Ga0207681_100390952 166
380 3300025927 Ga0207687_10003137 Ga0207687_100031378 166
381 3300025929 Ga0207664_10137255 Ga0207664_101372552 166
382 3300025931 Ga0207644_10031815 Ga0207644_100318152 166
383 3300025932 Ga0207690_10034702 Ga0207690_100347022 166
384 3300025933 Ga0207706_10001533 Ga0207706_1000153313 166
385 3300025934 Ga0207686_10001322 Ga0207686_1000132213 166
386 3300025935 Ga0207709_10003151 Ga0207709_100031514 166
387 3300025936 Ga0207670_10005363 Ga0207670_100053633 166
388 3300025937 Ga0207669_10002448 Ga0207669_100024482 166
389 3300025938 Ga0207704_10000458 Ga0207704_1000045816 166
390 3300025939 Ga0207665_10001870 Ga0207665_1000187011 166
391 3300025940 Ga0207691_10041110 Ga0207691_100411102 166
392 3300025941 Ga0207711_10023282 Ga0207711_100232822 166
393 3300025942 Ga0207689_10012131 Ga0207689_100121311 166
394 3300025949 Ga0207667_10156712 Ga0207667_101567122 166
395 3300025960 Ga0207651_10362039 Ga0207651_103620392 166
396 3300025961 Ga0207712_10005323 Ga0207712_100053232 166
397 3300025972 Ga0207668_10001538 Ga0207668_1000153810 166
398 3300025981 Ga0207640_10000827 Ga0207640_1000082711 166
399 3300025986 Ga0207658_10018537 Ga0207658_100185372 166
400 3300026023 Ga0207677_10018504 Ga0207677_100185042 166
401 3300026035 Ga0207703_10000920 Ga0207703_1000092014 166
402 3300026067 Ga0207678_10003253 Ga0207678_1000325313 166
403 3300026067 Ga0207678_10407898 Ga0207678_104078982 166
404 3300026075 Ga0207708_10024290 Ga0207708_100242902 166
405 3300026078 Ga0207702_10852773 Ga0207702_108527732 166
406 3300026089 Ga0207648_10000929 Ga0207648_100009298 166
407 3300026118 Ga0207675_100000544 Ga0207675_10000054427 166
408 3300026121 Ga0207683_10000335 Ga0207683_1000033528 166
409 3300026142 Ga0207698_10350143 Ga0207698_103501432 166
410 3300028380 Ga0268265_10236677 Ga0268265_102366772 166
411 3300028381 Ga0268264_10001041 Ga0268264_1000104113 166
412 3300031838 Ga0307518_10000028 Ga0307518_1000002852 166
413 3300034819 Ga0373958_0065009 Ga0373958_0065009_14_529 166
414 3300035241 Ga0373961_0034242 Ga0373961_0034242_177_692 166
415 3300035691 Ga0373931_0036791 Ga0373931_0036791_1175_1690 166
416 3300041443 Ga0451789_0783324 Ga0451789_0783324_346_861 166
417 3300041452 Ga0451793_0320317 Ga0451793_0320317_1359_1874 166
418 3300041456 Ga0451795_0224208 Ga0451795_0224208_732_1247 166
419 3300041462 Ga0451806_806050 Ga0451806_806050_20_535 166
420 3300044719 Ga0466971_0043951 Ga0466971_0043951_180_737 166
421 3300044765 Ga0466970_0012159 Ga0466970_0012159_3276_3833 166
422 3300045049 Ga0466959_0080005 Ga0466959_0080005_1268_1825 166
423 3300045836 Ga0466958_0153823 Ga0466958_0153823_173_730 166
424 3300047472 Ga0495686_0003364 Ga0495686_0003364_10241_10756 166
425 3300048903 Ga0496100_0000383 Ga0496100_0000383_12084_12599 166
426 3300048904 Ga0496101_0011857 Ga0496101_0011857_3623_4138 166
427 3300048905 Ga0496102_0004668 Ga0496102_0004668_10747_11262 166
428 3300048906 Ga0496103_0002854 Ga0496103_0002854_3469_3984 166
429 3300048907 Ga0496104_0193330 Ga0496104_0193330_951_1466 166
430 3300048909 Ga0496106_0000615 Ga0496106_0000615_13511_14026 166
431 3300048910 Ga0496107_0001171 Ga0496107_0001171_8914_9429 166
432 3300048911 Ga0496108_0601994 Ga0496108_0601994_157_672 166
433 3300048917 Ga0496114_0000517 Ga0496114_0000517_15211_15726 166
434 3300048918 Ga0496115_0008256 Ga0496115_0008256_1010_1525 166
435 3300050511 nmdc:mga08y16_933665_c1 nmdc:mga08y16_933665_c1_224_739 166
436 3300061719 Ga0466962_0290710 Ga0466962_0290710_147_704 166
437 3300005719 Ga0068861_100293577 Ga0068861_1002935772 167
438 3300006058 Ga0075432_10085879 Ga0075432_100858791 167
439 3300030521 Ga0307511_10001365 Ga0307511_1000136517 167
440 3300030733 Ga0314311_1002826 Ga0314311_10028261 167
441 3300031548 Ga0307408_100058841 Ga0307408_1000588412 167
442 3300031824 Ga0307413_10329929 Ga0307413_103299292 167
443 3300031901 Ga0307406_10079533 Ga0307406_100795332 167
444 3300031903 Ga0307407_10148401 Ga0307407_101484012 167
445 3300031903 Ga0307407_10228782 Ga0307407_102287822 167
446 3300031995 Ga0307409_100114582 Ga0307409_1001145822 167
447 3300031995 Ga0307409_100528314 Ga0307409_1005283142 167
448 3300046453 Ga0495627_134968 Ga0495627_134968_65_586 167
449 iso_pu_bacteria 2808606439 2809198363 167
450 iso_pu_bacteria 2919391150 2919395199 167
451 iso_pu_bacteria 2945956166 2945958916 167
452 3300001991 JGI24743J22301_10003682 JGI24743J22301_100036822 168
453 3300002067 JGI24735J21928_10042444 JGI24735J21928_100424442 168
454 3300002075 JGI24738J21930_10007611 JGI24738J21930_100076112 168
455 3300005328 Ga0070676_10118520 Ga0070676_101185201 168
456 3300005334 Ga0068869_100035747 Ga0068869_1000357472 168
457 3300005335 Ga0070666_10096876 Ga0070666_100968762 168
458 3300005336 Ga0070680_100275773 Ga0070680_1002757732 168
459 3300005337 Ga0070682_100030739 Ga0070682_1000307392 168
460 3300005337 Ga0070682_100167042 Ga0070682_1001670422 168
461 3300005339 Ga0070660_100289439 Ga0070660_1002894392 168
462 3300005340 Ga0070689_100331091 Ga0070689_1003310912 168
463 3300005341 Ga0070691_10020230 Ga0070691_100202302 168
464 3300005347 Ga0070668_100152042 Ga0070668_1001520422 168
465 3300005347 Ga0070668_100197378 Ga0070668_1001973782 168
466 3300005353 Ga0070669_100031637 Ga0070669_1000316372 168
467 3300005354 Ga0070675_100340366 Ga0070675_1003403662 168
468 3300005355 Ga0070671_100178098 Ga0070671_1001780982 168
469 3300005356 Ga0070674_100212458 Ga0070674_1002124582 168
470 3300005365 Ga0070688_100018231 Ga0070688_1000182312 168
471 3300005365 Ga0070688_100144039 Ga0070688_1001440392 168
472 3300005366 Ga0070659_100028419 Ga0070659_1000284193 168
473 3300005366 Ga0070659_100038097 Ga0070659_1000380972 168
474 3300005367 Ga0070667_100163065 Ga0070667_1001630652 168
475 3300005434 Ga0070709_10014652 Ga0070709_100146522 168
476 3300005434 Ga0070709_10190005 Ga0070709_101900052 168
477 3300005435 Ga0070714_100828600 Ga0070714_1008286001 168
478 3300005437 Ga0070710_10007738 Ga0070710_100077383 168
479 3300005437 Ga0070710_10083926 Ga0070710_100839262 168
480 3300005438 Ga0070701_10055627 Ga0070701_100556272 168
481 3300005439 Ga0070711_100005711 Ga0070711_1000057116 168
482 3300005439 Ga0070711_100132440 Ga0070711_1001324402 168
483 3300005440 Ga0070705_100084114 Ga0070705_1000841142 168
484 3300005441 Ga0070700_100029765 Ga0070700_1000297652 168
485 3300005444 Ga0070694_100335162 Ga0070694_1003351622 168
486 3300005456 Ga0070678_100125867 Ga0070678_1001258672 168
487 3300005456 Ga0070678_100171114 Ga0070678_1001711142 168
488 3300005457 Ga0070662_100023543 Ga0070662_1000235435 168
489 3300005457 Ga0070662_100410529 Ga0070662_1004105292 168
490 3300005459 Ga0068867_100070477 Ga0068867_1000704772 168
491 3300005459 Ga0068867_100163388 Ga0068867_1001633882 168
492 3300005471 Ga0070698_100349102 Ga0070698_1003491021 168
493 3300005536 Ga0070697_100578301 Ga0070697_1005783012 168
494 3300005539 Ga0068853_100020911 Ga0068853_1000209113 168
495 3300005543 Ga0070672_100252351 Ga0070672_1002523512 168
496 3300005544 Ga0070686_100520250 Ga0070686_1005202502 168
497 3300005545 Ga0070695_100105423 Ga0070695_1001054232 168
498 3300005546 Ga0070696_100035559 Ga0070696_1000355592 168
499 3300005546 Ga0070696_100121686 Ga0070696_1001216862 168
500 3300005547 Ga0070693_100035467 Ga0070693_1000354672 168
501 3300005547 Ga0070693_100292561 Ga0070693_1002925612 168
502 3300005548 Ga0070665_100005218 Ga0070665_1000052187 168
503 3300005548 Ga0070665_100269005 Ga0070665_1002690052 168
504 3300005549 Ga0070704_100032452 Ga0070704_1000324522 168
505 3300005549 Ga0070704_100330316 Ga0070704_1003303162 168
506 3300005563 Ga0068855_100320302 Ga0068855_1003203022 168
507 3300005563 Ga0068855_100473773 Ga0068855_1004737731 168
508 3300005578 Ga0068854_100103823 Ga0068854_1001038232 168
509 3300005578 Ga0068854_100775741 Ga0068854_1007757411 168
510 3300005615 Ga0070702_100011029 Ga0070702_1000110292 168
511 3300005616 Ga0068852_100097532 Ga0068852_1000975322 168
512 3300005616 Ga0068852_100160012 Ga0068852_1001600122 168
513 3300005617 Ga0068859_100018292 Ga0068859_1000182922 168
514 3300005617 Ga0068859_100171048 Ga0068859_1001710482 168
515 3300005718 Ga0068866_10013634 Ga0068866_100136342 168
516 3300005718 Ga0068866_10069881 Ga0068866_100698812 168
517 3300005718 Ga0068866_10374820 Ga0068866_103748202 168
518 3300005719 Ga0068861_100031467 Ga0068861_1000314672 168
519 3300005840 Ga0068870_10130974 Ga0068870_101309742 168
520 3300005841 Ga0068863_100163747 Ga0068863_1001637472 168
521 3300005842 Ga0068858_100072930 Ga0068858_1000729302 168
522 3300005842 Ga0068858_100143657 Ga0068858_1001436572 168
523 3300005843 Ga0068860_100037958 Ga0068860_1000379582 168
524 3300005843 Ga0068860_100084902 Ga0068860_1000849022 168
525 3300005844 Ga0068862_100114511 Ga0068862_1001145112 168
526 3300005844 Ga0068862_100174243 Ga0068862_1001742432 168
527 3300006028 Ga0070717_10121739 Ga0070717_101217392 168
528 3300006051 Ga0075364_10591662 Ga0075364_105916621 168
529 3300006163 Ga0070715_10041328 Ga0070715_100413282 168
530 3300006173 Ga0070716_100001673 Ga0070716_1000016733 168
531 3300006175 Ga0070712_100056512 Ga0070712_1000565122 168
532 3300006175 Ga0070712_100206841 Ga0070712_1002068412 168
533 3300006237 Ga0097621_100217142 Ga0097621_1002171422 168
534 3300006358 Ga0068871_100044030 Ga0068871_1000440302 168
535 3300006358 Ga0068871_100274619 Ga0068871_1002746192 168
536 3300006844 Ga0075428_100092968 Ga0075428_1000929682 168
537 3300006881 Ga0068865_100461217 Ga0068865_1004612172 168
538 3300006931 Ga0097620_100018292 Ga0097620_1000182922 168
539 3300006931 Ga0097620_100171066 Ga0097620_1001710662 168
540 3300009092 Ga0105250_10206822 Ga0105250_102068222 168
541 3300009098 Ga0105245_10361532 Ga0105245_103615322 168
542 3300009101 Ga0105247_10094069 Ga0105247_100940692 168
543 3300009147 Ga0114129_10111628 Ga0114129_101116282 168
544 3300009148 Ga0105243_10092718 Ga0105243_100927181 168
545 3300009148 Ga0105243_10178741 Ga0105243_101787412 168
546 3300009174 Ga0105241_10030340 Ga0105241_100303402 168
547 3300009176 Ga0105242_10081548 Ga0105242_100815482 168
548 3300009176 Ga0105242_10835790 Ga0105242_108357902 168
549 3300009177 Ga0105248_10016388 Ga0105248_100163882 168
550 3300009177 Ga0105248_10027828 Ga0105248_100278289 168
551 3300009177 Ga0105248_10177001 Ga0105248_101770012 168
552 3300009545 Ga0105237_10414322 Ga0105237_104143222 168
553 3300009551 Ga0105238_10320379 Ga0105238_103203792 168
554 3300009553 Ga0105249_10378634 Ga0105249_103786342 168
555 3300011119 Ga0105246_10018879 Ga0105246_100188792 168
556 3300011119 Ga0105246_11397793 Ga0105246_113977931 168
557 3300013105 Ga0157369_10375380 Ga0157369_103753802 168
558 3300013296 Ga0157374_10047682 Ga0157374_100476822 168
559 3300013296 Ga0157374_10052951 Ga0157374_100529512 168
560 3300013297 Ga0157378_10030416 Ga0157378_100304162 168
561 3300013297 Ga0157378_10978990 Ga0157378_109789902 168
562 3300013306 Ga0163162_10120757 Ga0163162_101207572 168
563 3300013306 Ga0163162_10210930 Ga0163162_102109302 168
564 3300013306 Ga0163162_10630926 Ga0163162_106309262 168
565 3300013306 Ga0163162_11750459 Ga0163162_117504591 168
566 3300013307 Ga0157372_10303835 Ga0157372_103038351 168
567 3300013307 Ga0157372_11187422 Ga0157372_111874221 168
568 3300013308 Ga0157375_10228743 Ga0157375_102287432 168
569 3300013308 Ga0157375_10303332 Ga0157375_103033322 168
570 3300013308 Ga0157375_10337393 Ga0157375_103373932 168
571 3300014325 Ga0163163_11921292 Ga0163163_119212921 168
572 3300014326 Ga0157380_10023621 Ga0157380_100236213 168
573 3300014326 Ga0157380_10542956 Ga0157380_105429562 168
574 3300014745 Ga0157377_10019708 Ga0157377_100197082 168
575 3300014745 Ga0157377_10021065 Ga0157377_100210652 168
576 3300014968 Ga0157379_10181559 Ga0157379_101815592 168
577 3300014969 Ga0157376_10171043 Ga0157376_101710432 168
578 3300014969 Ga0157376_10355796 Ga0157376_103557962 168
579 3300017792 Ga0163161_10338074 Ga0163161_103380742 168
580 3300025898 Ga0207692_10027995 Ga0207692_100279952 168
581 3300025899 Ga0207642_10049043 Ga0207642_100490432 168
582 3300025899 Ga0207642_10067860 Ga0207642_100678602 168
583 3300025899 Ga0207642_10306547 Ga0207642_103065472 168
584 3300025900 Ga0207710_10309640 Ga0207710_103096401 168
585 3300025901 Ga0207688_10004903 Ga0207688_100049035 168
586 3300025904 Ga0207647_10008739 Ga0207647_100087395 168
587 3300025904 Ga0207647_10060164 Ga0207647_100601642 168
588 3300025905 Ga0207685_10028489 Ga0207685_100284892 168
589 3300025906 Ga0207699_10057278 Ga0207699_100572782 168
590 3300025908 Ga0207643_10185680 Ga0207643_101856802 168
591 3300025911 Ga0207654_10159947 Ga0207654_101599472 168
592 3300025914 Ga0207671_10234171 Ga0207671_102341712 168
593 3300025915 Ga0207693_10004862 Ga0207693_100048628 168
594 3300025915 Ga0207693_10006779 Ga0207693_100067796 168
595 3300025916 Ga0207663_10006272 Ga0207663_100062722 168
596 3300025916 Ga0207663_10045140 Ga0207663_100451402 168
597 3300025917 Ga0207660_10374424 Ga0207660_103744242 168
598 3300025919 Ga0207657_10206611 Ga0207657_102066112 168
599 3300025923 Ga0207681_10032097 Ga0207681_100320972 168
600 3300025923 Ga0207681_10443862 Ga0207681_104438622 168
601 3300025927 Ga0207687_10200706 Ga0207687_102007062 168
602 3300025928 Ga0207700_11046575 Ga0207700_110465752 168
603 3300025929 Ga0207664_10533673 Ga0207664_105336732 168
604 3300025933 Ga0207706_10012019 Ga0207706_100120198 168
605 3300025933 Ga0207706_10014036 Ga0207706_100140365 168
606 3300025933 Ga0207706_10372102 Ga0207706_103721022 168
607 3300025934 Ga0207686_10078273 Ga0207686_100782732 168
608 3300025935 Ga0207709_10071722 Ga0207709_100717222 168
609 3300025937 Ga0207669_10027073 Ga0207669_100270732 168
610 3300025937 Ga0207669_10250046 Ga0207669_102500461 168
611 3300025937 Ga0207669_10257420 Ga0207669_102574202 168
612 3300025938 Ga0207704_10138481 Ga0207704_101384812 168
613 3300025938 Ga0207704_10165215 Ga0207704_101652151 168
614 3300025939 Ga0207665_10006046 Ga0207665_100060462 168
615 3300025939 Ga0207665_10031079 Ga0207665_100310792 168
616 3300025940 Ga0207691_10142949 Ga0207691_101429492 168
617 3300025941 Ga0207711_10108648 Ga0207711_101086482 168
618 3300025941 Ga0207711_10556727 Ga0207711_105567271 168
619 3300025942 Ga0207689_10012362 Ga0207689_100123622 168
620 3300025949 Ga0207667_10596152 Ga0207667_105961522 168
621 3300025961 Ga0207712_10259405 Ga0207712_102594051 168
622 3300025972 Ga0207668_10111361 Ga0207668_101113612 168
623 3300025972 Ga0207668_10134239 Ga0207668_101342392 168
624 3300025972 Ga0207668_10188472 Ga0207668_101884722 168
625 3300025981 Ga0207640_10116261 Ga0207640_101162612 168
626 3300025981 Ga0207640_10264466 Ga0207640_102644662 168
627 3300025986 Ga0207658_10312260 Ga0207658_103122602 168
628 3300026023 Ga0207677_10075635 Ga0207677_100756352 168
629 3300026023 Ga0207677_10384001 Ga0207677_103840012 168
630 3300026035 Ga0207703_10055283 Ga0207703_100552833 168
631 3300026035 Ga0207703_10464993 Ga0207703_104649932 168
632 3300026067 Ga0207678_10024038 Ga0207678_100240386 168
633 3300026075 Ga0207708_10063951 Ga0207708_100639512 168
634 3300026088 Ga0207641_10451556 Ga0207641_104515562 168
635 3300026089 Ga0207648_10033327 Ga0207648_100333273 168
636 3300026089 Ga0207648_10120299 Ga0207648_101202992 168
637 3300026118 Ga0207675_100041890 Ga0207675_1000418902 168
638 3300026118 Ga0207675_100723494 Ga0207675_1007234942 168
639 3300026121 Ga0207683_10013403 Ga0207683_100134035 168
640 3300026142 Ga0207698_10073687 Ga0207698_100736872 168
641 3300028379 Ga0268266_10673515 Ga0268266_106735152 168
642 3300028380 Ga0268265_10379022 Ga0268265_103790222 168
643 3300028381 Ga0268264_10586425 Ga0268264_105864252 168
644 3300028381 Ga0268264_10684798 Ga0268264_106847982 168
645 3300031731 Ga0307405_10458926 Ga0307405_104589261 168
646 3300031824 Ga0307413_10064012 Ga0307413_100640122 168
647 3300031852 Ga0307410_10093619 Ga0307410_100936191 168
648 3300031903 Ga0307407_10002834 Ga0307407_100028342 168
649 3300031995 Ga0307409_100042297 Ga0307409_1000422972 168
650 3300032002 Ga0307416_100150513 Ga0307416_1001505132 168
651 3300032126 Ga0307415_100230900 Ga0307415_1002309002 168
652 3300034820 Ga0373959_0067870 Ga0373959_0067870_21_539 168
653 3300035112 Ga0373932_0021433 Ga0373932_0021433_323_862 168
654 3300035121 Ga0373960_0051766 Ga0373960_0051766_46_585 168
655 3300035207 Ga0373942_0108728 Ga0373942_0108728_174_713 168
656 3300035691 Ga0373931_0126691 Ga0373931_0126691_493_1032 168
657 3300042005 Ga0439448_0027472 Ga0439448_0027472_223_747 168
658 3300044683 Ga0466965_0380622 Ga0466965_0380622_216_764 168
659 3300044901 Ga0466960_0394323 Ga0466960_0394323_215_763 168
660 3300046471 Ga0495650_0056992 Ga0495650_0056992_403_927 168
661 3300046492 Ga0495585_0265819 Ga0495585_0265819_135_653 168
662 3300046518 Ga0495631_0308848 Ga0495631_0308848_113_631 168
663 3300046615 Ga0495656_0052761 Ga0495656_0052761_788_1324 168
664 3300046684 Ga0495669_0164467 Ga0495669_0164467_470_988 168
665 3300046794 Ga0495589_0209124 Ga0495589_0209124_13_531 168
666 3300047673 Ga0495593_0099908 Ga0495593_0099908_681_1199 168
667 3300048903 Ga0496100_0004863 Ga0496100_0004863_4169_4687 168
668 3300048903 Ga0496100_0184615 Ga0496100_0184615_685_1224 168
669 3300048904 Ga0496101_0000593 Ga0496101_0000593_17723_18241 168
670 3300048904 Ga0496101_0126305 Ga0496101_0126305_338_877 168
671 3300048905 Ga0496102_0084290 Ga0496102_0084290_1393_1932 168
672 3300048905 Ga0496102_0415120 Ga0496102_0415120_115_633 168
673 3300048905 Ga0496102_1244908 Ga0496102_1244908_104_622 168
674 3300048906 Ga0496103_0054478 Ga0496103_0054478_441_980 168
675 3300048907 Ga0496104_0006811 Ga0496104_0006811_6498_7016 168
676 3300048907 Ga0496104_0018259 Ga0496104_0018259_5375_5914 168
677 3300048909 Ga0496106_0039922 Ga0496106_0039922_2600_3118 168
678 3300048909 Ga0496106_0102409 Ga0496106_0102409_897_1436 168
679 3300048909 Ga0496106_0365916 Ga0496106_0365916_381_899 168
680 3300048910 Ga0496107_0027686 Ga0496107_0027686_369_887 168
681 3300048910 Ga0496107_0186574 Ga0496107_0186574_786_1304 168
682 3300048910 Ga0496107_0255911 Ga0496107_0255911_294_833 168
683 3300048911 Ga0496108_0004415 Ga0496108_0004415_5679_6218 168
684 3300048912 Ga0496109_0028038 Ga0496109_0028038_1862_2401 168
685 3300048913 Ga0496110_0088759 Ga0496110_0088759_1303_1842 168
686 3300048914 Ga0496111_0368990 Ga0496111_0368990_61_600 168
687 3300048917 Ga0496114_0040677 Ga0496114_0040677_2597_3115 168
688 3300048917 Ga0496114_0426964 Ga0496114_0426964_324_842 168
689 3300048918 Ga0496115_0053453 Ga0496115_0053453_1464_1982 168
690 3300048918 Ga0496115_0118950 Ga0496115_0118950_1332_1871 168
691 3300048918 Ga0496115_1089090 Ga0496115_1089090_13_531 168
692 3300049577 Ga0501041_0098351 Ga0501041_0098351_1160_1678 168
693 3300049578 Ga0501042_0223871 Ga0501042_0223871_462_980 168
694 3300049591 Ga0501075_0580022 Ga0501075_0580022_61_579 168
695 3300049592 Ga0501076_0623511 Ga0501076_0623511_248_769 168
696 3300050507 nmdc:mga05p37_151291_c1 nmdc:mga05p37_151291_c1_331_855 168
697 3300050509 nmdc:mga0qj67_232358_c1 nmdc:mga0qj67_232358_c1_702_1226 168
698 3300053104 Ga0500556_0000472 Ga0500556_0000472_4404_4940 168
699 3300053108 Ga0500562_015745 Ga0500562_015745_651_1187 168
700 3300053117 Ga0500593_003899 Ga0500593_003899_1309_1845 168
701 3300053129 Ga0500628_136542 Ga0500628_136542_112_648 168
702 3300053133 Ga0500655_002692 Ga0500655_002692_928_1464 168
703 3300053155 Ga0500620_115434 Ga0500620_115434_68_592 168
704 3300061734 Ga0530510_0010046 Ga0530510_0010046_4481_5002 168
705 iso_pu_bacteria 2904770941 2904772433 168
706 3300031852 Ga0307410_10070078 Ga0307410_100700783 169
707 3300031995 Ga0307409_100356020 Ga0307409_1003560202 169
708 3300032002 Ga0307416_101509024 Ga0307416_1015090241 169
709 3300032004 Ga0307414_10588819 Ga0307414_105888192 169
710 3300037853 Ga0436364_0139643 Ga0436364_0139643_1063_1632 169
711 3300045976 Ga0466967_0003341 Ga0466967_0003341_6136_6660 169
712 3300046691 Ga0495670_0057578 Ga0495670_0057578_771_1298 169
713 3300053153 Ga0500616_0000027 Ga0500616_0000027_418839_419366 169
714 3300053730 Ga0500645_004203 Ga0500645_004203_1060_1587 169
715 3300000549 LJQas_1000116 LJQas_10001163 170
716 3300000549 LJQas_1004960 LJQas_10049602 170
717 3300006058 Ga0075432_10004226 Ga0075432_100042262 170
718 3300025912 Ga0207707_11068289 Ga0207707_110682891 170
719 3300025918 Ga0207662_10314910 Ga0207662_103149102 170
720 3300027907 Ga0207428_10006323 Ga0207428_100063237 170
721 3300031852 Ga0307410_10101609 Ga0307410_101016092 170
722 3300041404 Ga0439436_0007353 Ga0439436_0007353_1560_2105 170
723 3300041405 Ga0439438_027619 Ga0439438_027619_73_618 170
724 3300041406 Ga0439439_0014801 Ga0439439_0014801_336_881 170
725 3300041411 Ga0439466_0014804 Ga0439466_0014804_689_1234 170
726 3300041413 Ga0439465_0026887 Ga0439465_0026887_1137_1682 170
727 3300041453 Ga0451797_1178160 Ga0451797_1178160_467_997 170
728 3300041999 Ga0439433_0001119 Ga0439433_0001119_4013_4558 170
729 3300042002 Ga0439442_000790 Ga0439442_000790_4430_4975 170
730 3300042007 Ga0439449_0001002 Ga0439449_0001002_2474_3019 170
731 3300042010 Ga0439452_030960 Ga0439452_030960_301_846 170
732 3300042014 Ga0439457_005622 Ga0439457_005622_736_1281 170
733 3300042015 Ga0439462_0007839 Ga0439462_0007839_1274_1819 170
734 3300042435 Ga0439434_0031878 Ga0439434_0031878_65_610 170
735 3300048905 Ga0496102_0457661 Ga0496102_0457661_344_880 170
736 3300048906 Ga0496103_0054366 Ga0496103_0054366_1850_2386 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00866

Ring_hydroxyl_B

Ring hydroxylating beta subunit

40

182

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e99-assembly1.cif.gz_A crystal structure of the beta subunit of the benzoate 1,2-dioxygenase (benb, bmaa0186) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9196 8 170
3e99-assembly1.cif.gz_A crystal structure of the beta subunit of the benzoate 1,2-dioxygenase (benb, bmaa0186) from burkholderia mallei atcc 23344 at 1.90 a resolution 0.9078 8 170
3eby-assembly1.cif.gz_A crystal structure of the beta subunit of a putative aromatic-ring-hydroxylating dioxygenase (yp_001165631.1) from novosphingobium aromaticivorans dsm 12444 at 1.75 a resolution 0.8499 12 165
7urz-assembly1.cif.gz_B hexadecameric hub domain of camkii beta 0.8309 11 158
7urz-assembly1.cif.gz_G hexadecameric hub domain of camkii beta 0.8231 15 158
ID Description Score Start End Superfamily
3e99A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9184 8 170 3.10.450.50
3e99A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9124 8 170 3.10.450.50
3ebyA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8651 12 161 3.10.450.50
2chcB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8263 15 158 3.10.450.50
af_O07237_11_153_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8244 15 160 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A243SX33-F1-model_v4 deleted 0.9184 95 170
AF-A0A5E7FVH8-F1-model_v4 Uncharacterized protein 0.9137 94 162
AF-A0A243SX33-F1-model_v4 deleted 0.9069 95 170
AF-A0A4R4ME56-F1-model_v4 deleted 0.9036 91 162
AF-A0A090YWA0-F1-model_v4 Putative transcriptional regulator, Bla/Mec 0.8968 96 157

Feature Viewer

pLDDT pTM Quality
82.51 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map